PSIBLAST alignment of GI: 254780272 and protein with PDB id: 3ktg

>gi|291463558|pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic Crystal Form Length = 199
>gi|291463559|pdb|3KTG|B Chain B, Structure Of Clpp From Bacillus Subtilis In Monoclinic Crystal Form Length = 199
 Score =  232 bits (592), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 110/191 (57%), Positives = 151/191 (79%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFL AE+P+KEIS
Sbjct: 1   NLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEIS 60

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG R+ALPN+ ++
Sbjct: 61  LYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVM 120

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA++IE  A+ I+ ++ +LN++  +  G+  E +E+  DRD+  SA EA 
Sbjct: 121 IHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEAL 180

Query: 197 DWGVVDKVLMS 207
           ++G++DK+L  
Sbjct: 181 EYGLIDKILTH 191