PSIBLAST alignment of GI: 254780272 and protein with PDB id: 3mt6

gi|310942734|pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With Adep1 Length = 207
>gi|310942735|pdb|3MT6|S Chain S, Structure Of Clpp From Escherichia Coli In Complex With Adep1 Length = 207
 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHRN 207