BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780272|ref|YP_003064685.1| ATP-dependent Clp protease
proteolytic subunit [Candidatus Liberibacter asiaticus str. psy62]
         (216 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|83311891|ref|YP_422155.1| protease subunit of ATP-dependent Clp protease [Magnetospirillum
           magneticum AMB-1]
 gi|82946732|dbj|BAE51596.1| Protease subunit of ATP-dependent Clp protease [Magnetospirillum
           magneticum AMB-1]
          Length = 244

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 130/213 (61%), Positives = 177/213 (83%), Gaps = 1/213 (0%)

Query: 4   EGCAKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQ 62
               ++D  D+++  LVPMVVEQTNRGERSYDIYSRLLKERI+F+TGQ+ D +A+LICAQ
Sbjct: 30  RNMRERDPIDLYMNTLVPMVVEQTNRGERSYDIYSRLLKERIIFLTGQVYDEVASLICAQ 89

Query: 63  LLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAG 122
           LLFLE+ENP K+I+ YINSPGGVVT+G+AIYDTMQ+I+P +ST C+GQAASMGSLL++AG
Sbjct: 90  LLFLESENPSKDIAFYINSPGGVVTSGLAIYDTMQYIRPKVSTVCIGQAASMGSLLMTAG 149

Query: 123 EKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK 182
           EKG RF+LPN+RI++HQPSGG  GQA+DIE  A++I+ ++ RLN IYV++ G+  + +EK
Sbjct: 150 EKGKRFSLPNSRIMVHQPSGGAQGQATDIEIQAREILALRARLNNIYVEHTGQPLDVIEK 209

Query: 183 TLDRDHIMSASEACDWGVVDKVLMSRIDIEEKS 215
            ++RD  M+A EA ++G++D+V+  R  +E+ S
Sbjct: 210 VMERDKFMTADEAKEFGLIDEVVNKRPAVEDDS 242


>gi|119898362|ref|YP_933575.1| ATP-dependent Clp protease proteolytic subunit [Azoarcus sp. BH72]
 gi|166201798|sp|A1K783|CLPP_AZOSB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|119670775|emb|CAL94688.1| Endopeptidase Clp [Azoarcus sp. BH72]
          Length = 212

 Score =  257 bits (657), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 130/196 (66%), Positives = 161/196 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGL+PMVVEQ+ RGERSYDIYSRLLKER+VF+ G + D  A LI AQLLFLE+ENP K+I
Sbjct: 17  LGLIPMVVEQSGRGERSYDIYSRLLKERVVFLVGPVNDVTANLIVAQLLFLESENPDKDI 76

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG VTAG+AIYDTMQFIKP +ST C+GQAASMG+ LL+AGEKG RF LPN+R+
Sbjct: 77  YFYINSPGGSVTAGLAIYDTMQFIKPNVSTLCIGQAASMGAFLLAAGEKGKRFCLPNSRV 136

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+ ++ RLN +  K+ G+T E++EK  DRD+ MSA+ A
Sbjct: 137 MIHQPLGGFQGQASDIEIHAREILYLRERLNGMLAKHTGQTIEQIEKDTDRDNFMSATAA 196

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G+VDKVL SR D 
Sbjct: 197 VEYGLVDKVLTSRADT 212


>gi|225627583|ref|ZP_03785620.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti str.
           Cudo]
 gi|237815533|ref|ZP_04594530.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           str. 2308 A]
 gi|225617588|gb|EEH14633.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti str.
           Cudo]
 gi|237788831|gb|EEP63042.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           str. 2308 A]
          Length = 247

 Score =  255 bits (652), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 148/216 (68%), Positives = 186/216 (86%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           + ++    +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+C
Sbjct: 32  LIYQRPIMRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVC 91

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+
Sbjct: 92  AQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLT 151

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG  G R+ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +
Sbjct: 152 AGATGHRYALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTI 211

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           E+TLDRDH M+A EA ++G++DKV+ +R    ++SK
Sbjct: 212 ERTLDRDHFMTAQEALEFGLIDKVVEARDVSADESK 247


>gi|56478265|ref|YP_159854.1| ATP-dependent Clp protease proteolytic subunit [Aromatoleum
           aromaticum EbN1]
 gi|67460188|sp|Q5P161|CLPP_AZOSE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56314308|emb|CAI08953.1| ATP-dependent Clp protease proteolytic subunit [Aromatoleum
           aromaticum EbN1]
          Length = 212

 Score =  254 bits (649), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 127/195 (65%), Positives = 161/195 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G + D  A LI AQLLFLE+ENP K++
Sbjct: 17  LGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDVTANLIVAQLLFLESENPDKDV 76

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG V++GMAIYDTMQFIKP +ST C+GQAASMGS LL+AGEKG RF LPN+R+
Sbjct: 77  YFYINSPGGSVSSGMAIYDTMQFIKPSVSTLCIGQAASMGSFLLAAGEKGKRFCLPNSRV 136

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+ I+ +LNE+  K+ G+  E++EK  DRD  MSA++A
Sbjct: 137 MIHQPLGGFQGQASDIEIHAREILGIRAKLNEMLAKHTGQPIEQIEKDTDRDRFMSAADA 196

Query: 196 CDWGVVDKVLMSRID 210
            ++G+VDKVL +R D
Sbjct: 197 VEYGIVDKVLTNRAD 211


>gi|254780272|ref|YP_003064685.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039949|gb|ACT56745.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 216

 Score =  254 bits (648), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 216/216 (100%), Positives = 216/216 (100%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC
Sbjct: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS
Sbjct: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV
Sbjct: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK
Sbjct: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216


>gi|23014984|ref|ZP_00054776.1| COG0740: Protease subunit of ATP-dependent Clp proteases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 213

 Score =  253 bits (647), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 134/211 (63%), Positives = 175/211 (82%), Gaps = 1/211 (0%)

Query: 6   CAKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLL 64
             ++D  DV++  LVPMVVEQTNRGERSYDIYSRLLKERIVF+TGQ+ D +A+LICAQLL
Sbjct: 1   MRERDPIDVYMNTLVPMVVEQTNRGERSYDIYSRLLKERIVFLTGQVYDEVASLICAQLL 60

Query: 65  FLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEK 124
           FLE+ENP K+IS YINSPGGVVT+G+AIYDTMQ+I+P +ST C+GQAASMGSLL++AGEK
Sbjct: 61  FLESENPSKDISFYINSPGGVVTSGLAIYDTMQYIRPAVSTLCIGQAASMGSLLMTAGEK 120

Query: 125 GMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL 184
           G RF+LPN+RI++HQPSGG  GQA+DIE  A++I+ ++ RLN IYV + G+  E +EK +
Sbjct: 121 GKRFSLPNSRIMVHQPSGGAQGQATDIEIQAREILALRARLNNIYVDHTGQPLEVIEKVM 180

Query: 185 DRDHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           +RD  M+A EA ++G++D+V+  R   E+ S
Sbjct: 181 ERDKFMTAEEAKEFGLIDEVVNKRPVAEDDS 211


>gi|225175200|ref|ZP_03729196.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dethiobacter
           alkaliphilus AHT 1]
 gi|225169376|gb|EEG78174.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dethiobacter
           alkaliphilus AHT 1]
          Length = 193

 Score =  253 bits (646), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 116/193 (60%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGER+YDIYSRLLK+RI+F+   I+D++A L+ AQLLFLE+E+P+K+I
Sbjct: 1   MNLVPMVVEQTNRGERAYDIYSRLLKDRIIFIGSPIDDNVANLVIAQLLFLESEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++Y+NSPGG V AG+AIYDTMQ+IKP +ST C+G AASMG++LL+AG  G RF+LPN+RI
Sbjct: 61  NIYVNSPGGSVYAGLAIYDTMQYIKPDVSTICVGLAASMGAVLLAAGADGKRFSLPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA DIE HA++I++I+ RLNEI   + GK  E++ +  DRD+ MSA +A
Sbjct: 121 MVHQPLGGAQGQAVDIEIHAKEILRIRERLNEILSGHTGKPVEQIARDTDRDYFMSAEQA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D VL  R
Sbjct: 181 KEYGLIDGVLEKR 193


>gi|27380055|ref|NP_771584.1| ATP-dependent Clp protease proteolytic subunit [Bradyrhizobium
           japonicum USDA 110]
 gi|67460543|sp|Q89KG1|CLPP2_BRAJA RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|27353209|dbj|BAC50209.1| ATP-dependent Clp protease proteolytic subunit [Bradyrhizobium
           japonicum USDA 110]
          Length = 211

 Score =  253 bits (646), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 138/209 (66%), Positives = 180/209 (86%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED M+TL+ AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AGEK MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGEKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD
Sbjct: 121 FSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKTIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
             ++A++A ++G+VD+V+  R +    +K
Sbjct: 181 KFLTANDAKEFGLVDRVIDKRAEEPAAAK 209


>gi|296536161|ref|ZP_06898289.1| endopeptidase Clp [Roseomonas cervicalis ATCC 49957]
 gi|296263532|gb|EFH10029.1| endopeptidase Clp [Roseomonas cervicalis ATCC 49957]
          Length = 213

 Score =  253 bits (646), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 125/211 (59%), Positives = 174/211 (82%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
              +D  +++  LVPMV+EQT RGER++DIYSRLLKERI+F+TG + D M++LICAQLLF
Sbjct: 1   MRDRDPVELYNNLVPMVIEQTARGERAFDIYSRLLKERIIFLTGPVYDQMSSLICAQLLF 60

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP K+I+ YINSPGGVV+AG+A+YDTMQ+I+ P+ST C+G AASMGSLLL+AG KG
Sbjct: 61  LESENPNKDIAFYINSPGGVVSAGLAMYDTMQYIRAPVSTVCLGMAASMGSLLLTAGAKG 120

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            RFALPN+RI++HQPSGG  GQA+DIE  A++I+ +++RLN+IYVK+ G+  EE+E+ L+
Sbjct: 121 KRFALPNSRIMVHQPSGGAQGQATDIEIQAREILALRKRLNQIYVKHTGQPIEEIERKLE 180

Query: 186 RDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           RD  MSA EA ++G++D+V++ R     +++
Sbjct: 181 RDSYMSAEEAKEFGLIDEVVLERPTTPAEAQ 211


>gi|157369338|ref|YP_001477327.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Serratia
           proteamaculans 568]
 gi|157321102|gb|ABV40199.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Serratia
           proteamaculans 568]
          Length = 207

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 172/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAE+P+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAESPEKDIFLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGSFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G+T E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAEHTGQTLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  M+A EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFMTAEEAVEYGLVDGILTHRK 207


>gi|319784104|ref|YP_004143580.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317169992|gb|ADV13530.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 209

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 154/205 (75%), Positives = 183/205 (89%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            K+  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED MATL+CAQLLFLE
Sbjct: 1   MKNPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFITGPVEDGMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVT+GMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEINLYINSPGGVVTSGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI++HQPSGGF GQASDIERHA DI+K+KRRLNE+YVK+ GK+YEE+EKTLDRD
Sbjct: 121 FATPNARIMVHQPSGGFQGQASDIERHALDIIKLKRRLNEVYVKHTGKSYEEIEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIE 212
           H M+A EA D+G++DKV+ SR   E
Sbjct: 181 HFMTADEAKDFGLIDKVISSREAAE 205


>gi|74317695|ref|YP_315435.1| ATP-dependent Clp protease proteolytic subunit ClpP [Thiobacillus
           denitrificans ATCC 25259]
 gi|90183186|sp|Q3SI98|CLPP_THIDA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|74057190|gb|AAZ97630.1| peptidase S14, ClpP [Thiobacillus denitrificans ATCC 25259]
          Length = 212

 Score =  252 bits (644), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 123/203 (60%), Positives = 161/203 (79%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +   E   LGLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G + D  A LI AQ+LFLE
Sbjct: 7   RTAPEPQGLGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDATANLIVAQMLFLE 66

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+I LYINSPGG V+AG+AIYDTMQFIKP +ST C+GQAASMG+ LL+AG KG R
Sbjct: 67  SENPDKDIYLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCIGQAASMGAFLLTAGAKGKR 126

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           + LPN+R+++HQP GGF GQASDIE HA++I+ +K RLN +  K+ G++ E +++  DRD
Sbjct: 127 YCLPNSRVMIHQPLGGFQGQASDIEIHAKEILYLKARLNGMLAKHTGQSLEVIDRDTDRD 186

Query: 188 HIMSASEACDWGVVDKVLMSRID 210
           + MSA ++  +G+VDKVL SR +
Sbjct: 187 NFMSAEDSVKYGLVDKVLTSRNE 209


>gi|91787906|ref|YP_548858.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Polaromonas
           sp. JS666]
 gi|91697131|gb|ABE43960.1| ATP-dependent Clp protease proteolytic subunit ClpP [Polaromonas
           sp. JS666]
          Length = 218

 Score =  252 bits (644), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 121/208 (58%), Positives = 160/208 (76%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           ++ G      +   LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ A
Sbjct: 11  AYAGPQAGAQDAQGLGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDQTANLVVA 70

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLLFLE+ENP K+IS YINSPGG VTAGMAIYDTMQFIKP +ST C+G AASMG+ LLSA
Sbjct: 71  QLLFLESENPDKDISFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCVGMAASMGAFLLSA 130

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG RF+LPN+R+++HQPSGG  GQA+DIE HA+DI+K + +LN I   N G+  E++E
Sbjct: 131 GAKGKRFSLPNSRVMIHQPSGGAQGQATDIEIHARDILKTRDQLNRILAANTGQPIEKIE 190

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  +RD+ + A +A ++G+VD+V+  R 
Sbjct: 191 RDTERDYFLFAEDAKEYGLVDQVISRRP 218


>gi|148558952|ref|YP_001259031.1| ATP-dependent Clp protease proteolytic subunit [Brucella ovis ATCC
           25840]
 gi|297248424|ref|ZP_06932142.1| ATP-dependent Clp protease, protease subunit [Brucella abortus bv.
           5 str. B3196]
 gi|148370209|gb|ABQ60188.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Brucella ovis
           ATCC 25840]
 gi|297175593|gb|EFH34940.1| ATP-dependent Clp protease, protease subunit [Brucella abortus bv.
           5 str. B3196]
          Length = 228

 Score =  252 bits (643), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 148/216 (68%), Positives = 186/216 (86%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           + ++    +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+C
Sbjct: 13  LIYQRPIMRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVC 72

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+
Sbjct: 73  AQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLT 132

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG  G R+ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +
Sbjct: 133 AGATGHRYALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTI 192

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           E+TLDRDH M+A EA ++G++DKV+ +R    ++SK
Sbjct: 193 ERTLDRDHFMTAQEALEFGLIDKVVEARDVSADESK 228


>gi|13476994|ref|NP_108564.1| ATP-dependent Clp protease proteolytic subunit [Mesorhizobium loti
           MAFF303099]
 gi|18202642|sp|Q982V6|CLPP2_RHILO RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|14027757|dbj|BAB54350.1| ATP-dependent Clp proteinase [Mesorhizobium loti MAFF303099]
          Length = 209

 Score =  252 bits (643), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 154/207 (74%), Positives = 183/207 (88%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            K+  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED MATL+CAQLLFLE
Sbjct: 1   MKNPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFITGPVEDGMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVT+GMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEINLYINSPGGVVTSGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI++HQPSGGF GQASDIERHA DIVK+KRRLNE+YVK+ GK+YEE+E+TLDRD
Sbjct: 121 FATPNARIMVHQPSGGFQGQASDIERHAMDIVKLKRRLNEVYVKHTGKSYEEIERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEK 214
           H M+A EA D+G++DKV+ SR   E  
Sbjct: 181 HFMTADEAKDFGLIDKVISSREPAESA 207


>gi|237653230|ref|YP_002889544.1| ATP-dependent Clp protease proteolytic subunit [Thauera sp. MZ1T]
 gi|237624477|gb|ACR01167.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thauera sp.
           MZ1T]
          Length = 212

 Score =  252 bits (643), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 132/205 (64%), Positives = 162/205 (79%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
              D   V LGLVPMVVEQ+ RGER+YDIYSRLLKER+VF+ G + D  A LI AQLLFL
Sbjct: 8   HSSDWNPVGLGLVPMVVEQSGRGERAYDIYSRLLKERVVFLVGPVNDVTANLIVAQLLFL 67

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I  YINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+AGEKG 
Sbjct: 68  ESENPDKDIYFYINSPGGSVTAGMAIYDTMQFIKPNVSTLCIGQAASMGAFLLAAGEKGK 127

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF LPN+R+++HQP GGF GQASDIE HA++I+ ++ RLN++  K+ G+  E +EK  DR
Sbjct: 128 RFILPNSRVMIHQPLGGFQGQASDIEIHAREILYLRSRLNDMLSKHTGQALERIEKDTDR 187

Query: 187 DHIMSASEACDWGVVDKVLMSRIDI 211
           D+ MSA+ A ++G+VDKVL SR D 
Sbjct: 188 DNFMSATAAVEYGLVDKVLTSRDDT 212


>gi|260460897|ref|ZP_05809147.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Mesorhizobium
           opportunistum WSM2075]
 gi|259033474|gb|EEW34735.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Mesorhizobium
           opportunistum WSM2075]
          Length = 209

 Score =  252 bits (643), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 155/205 (75%), Positives = 184/205 (89%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            K+  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED MATL+CAQLLFLE
Sbjct: 1   MKNPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFITGPVEDGMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVT+GMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEINLYINSPGGVVTSGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNE+YVK+ GK+YEE+EKTLDRD
Sbjct: 121 FATPNARIMVHQPSGGFQGQASDIERHAQDIIKLKRRLNEVYVKHTGKSYEEIEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIE 212
           H M+A EA D+G++DKV+ SR   E
Sbjct: 181 HFMTADEARDFGLIDKVISSREAAE 205


>gi|270263570|ref|ZP_06191839.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Serratia
           odorifera 4Rx13]
 gi|270042454|gb|EFA15549.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Serratia
           odorifera 4Rx13]
          Length = 207

 Score =  252 bits (643), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 172/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAE+P+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAESPEKDIYLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGSFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G+T E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAEHTGQTLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  M+A EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFMTAEEAVEYGLVDGILTHRS 207


>gi|17982823|gb|AAL52055.1| ATP-dependent clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. 16M]
          Length = 247

 Score =  252 bits (643), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 147/216 (68%), Positives = 185/216 (85%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           + ++    +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+C
Sbjct: 32  LIYQRPIMRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVC 91

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+
Sbjct: 92  AQLLFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLT 151

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG  G R+AL NARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +
Sbjct: 152 AGATGHRYALLNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTI 211

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           E+TLDRDH M+A EA ++G++DKV+ +R    ++SK
Sbjct: 212 ERTLDRDHFMTAQEALEFGLIDKVVEARDVSADESK 247


>gi|323495056|ref|ZP_08100145.1| ATP-dependent Clp protease proteolytic subunit [Vibrio brasiliensis
           LMG 20546]
 gi|323310713|gb|EGA63888.1| ATP-dependent Clp protease proteolytic subunit [Vibrio brasiliensis
           LMG 20546]
          Length = 208

 Score =  251 bits (642), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 129/210 (61%), Positives = 165/210 (78%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPILDALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R  LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +
Sbjct: 119 GGAPGKRHVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ MSA +A ++G+VD VL  R +
Sbjct: 179 ERDTDRDNFMSADQAVEYGLVDSVLNHRGE 208


>gi|153009536|ref|YP_001370751.1| ATP-dependent Clp protease proteolytic subunit [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561424|gb|ABS14922.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ochrobactrum
           anthropi ATCC 49188]
          Length = 230

 Score =  251 bits (642), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 150/213 (70%), Positives = 184/213 (86%)

Query: 4   EGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           +    +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQL
Sbjct: 18  QRPIMRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQL 77

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           LFLEAENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG 
Sbjct: 78  LFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGA 137

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
            G R+ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ YE +E+T
Sbjct: 138 TGQRYALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYETIERT 197

Query: 184 LDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           LDRDH M+A EA ++G++DKV+ SR    ++SK
Sbjct: 198 LDRDHFMTAQEALEFGLIDKVVESRDVGADESK 230


>gi|226314841|ref|YP_002774737.1| ATP-dependent Clp protease proteolytic subunit [Brevibacillus
           brevis NBRC 100599]
 gi|226097791|dbj|BAH46233.1| ATP-dependent Clp protease proteolytic subunit [Brevibacillus
           brevis NBRC 100599]
          Length = 198

 Score =  251 bits (642), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 113/198 (57%), Positives = 154/198 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+F+   I D +A ++ AQLLFL+AE+P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIFLGTPINDTVANIVVAQLLFLQAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTM FIKP +ST C+G AASMG+ LL+AG KG RFALPN+ +
Sbjct: 61  HLYINSPGGSITAGMAIYDTMHFIKPDVSTICIGMAASMGAFLLAAGAKGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A+ I+K++  LN I  +  G+  E ++K  DRD+ +SA+EA
Sbjct: 121 MIHQPLGGAQGQASDIEIAAKRILKMRDHLNTILAERTGQPLERIQKDTDRDNFLSAAEA 180

Query: 196 CDWGVVDKVLMSRIDIEE 213
            ++G++DKV+ S    ++
Sbjct: 181 VEYGLIDKVITSEPSSKK 198


>gi|83954269|ref|ZP_00962989.1| Protease subunit of ATP-dependent Clp protease [Sulfitobacter sp.
           NAS-14.1]
 gi|83841306|gb|EAP80476.1| Protease subunit of ATP-dependent Clp protease [Sulfitobacter sp.
           NAS-14.1]
          Length = 219

 Score =  251 bits (641), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 171/209 (81%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             D  D ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL L
Sbjct: 1   MNDPHDTYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL AGEKGM
Sbjct: 61  EAENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLQAGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGG+ GQA+DI  HAQ+  K+K RLNEIYVK+ G+  E+VE  L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGYQGQATDIMIHAQETQKLKTRLNEIYVKHTGQPLEKVEAALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ MS  EA DWG++D+++ +R  +++  
Sbjct: 181 DNFMSPEEAKDWGLIDEIVENRGKMDDPD 209


>gi|237730414|ref|ZP_04560895.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226905953|gb|EEH91871.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 243

 Score =  251 bits (641), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 174/209 (83%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA ++G+VD +L  R 
Sbjct: 215 ERDTERDRFLSASEAVEYGLVDSILTHRN 243


>gi|91775762|ref|YP_545518.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Methylobacillus flagellatus KT]
 gi|116243149|sp|Q1H1G0|CLPP_METFK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|91709749|gb|ABE49677.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Methylobacillus flagellatus KT]
          Length = 213

 Score =  251 bits (641), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 122/210 (58%), Positives = 159/210 (75%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           + +   A+   E   LG +PMV+EQ+ RGERSYDIYSRLLKERI+F+ G + D  A L+ 
Sbjct: 2   IHYPATAQSQFEAQGLGYIPMVIEQSGRGERSYDIYSRLLKERIIFLVGPVNDATANLVV 61

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENP K+I  YINSPGG VTAGM IYDTMQF+KP +ST C+GQAASMG+LLL+
Sbjct: 62  AQLLFLEAENPDKDIYFYINSPGGSVTAGMGIYDTMQFVKPDVSTLCVGQAASMGALLLA 121

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG +G RF LPN+R+++HQP GGF GQASDIE HA++I+ ++ +LN I   + G+  E++
Sbjct: 122 AGAQGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILFLREKLNHILASHTGQPVEKI 181

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
               DRD+ MSA ++  +G+VDKV+ SR D
Sbjct: 182 ALDTDRDNFMSAEQSVAYGIVDKVIASRAD 211


>gi|261822507|ref|YP_003260613.1| ATP-dependent Clp protease proteolytic subunit [Pectobacterium
           wasabiae WPP163]
 gi|261606520|gb|ACX89006.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Pectobacterium wasabiae WPP163]
          Length = 207

 Score =  251 bits (640), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 130/208 (62%), Positives = 170/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++  +   + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ 
Sbjct: 1   MSYSGEQER--QAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R  LPN+R+++HQP GGF GQA+DIE HA++I+K+K ++NE+  K+ G+  E +
Sbjct: 119 AGAKGKRICLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKAKMNELMAKHTGQPLEAI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD V  +R
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSVFTNR 206


>gi|115311359|sp|Q2W3H9|CLPP_MAGMM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 203

 Score =  251 bits (640), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 128/201 (63%), Positives = 170/201 (84%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQTNRGERSYDIYSRLLKERI+F+TGQ+ D +A+LICAQLLFLE+ENP K+
Sbjct: 1   MNTLVPMVVEQTNRGERSYDIYSRLLKERIIFLTGQVYDEVASLICAQLLFLESENPSKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I+ YINSPGGVVT+G+AIYDTMQ+I+P +ST C+GQAASMGSLL++AGEKG RF+LPN+R
Sbjct: 61  IAFYINSPGGVVTSGLAIYDTMQYIRPKVSTVCIGQAASMGSLLMTAGEKGKRFSLPNSR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQPSGG  GQA+DIE  A++I+ ++ RLN IYV++ G+  + +EK ++RD  M+A E
Sbjct: 121 IMVHQPSGGAQGQATDIEIQAREILALRARLNNIYVEHTGQPLDVIEKVMERDKFMTADE 180

Query: 195 ACDWGVVDKVLMSRIDIEEKS 215
           A ++G++D+V+  R  +E+ S
Sbjct: 181 AKEFGLIDEVVNKRPAVEDDS 201


>gi|71907348|ref|YP_284935.1| ATP-dependent Clp protease proteolytic subunit ClpP [Dechloromonas
           aromatica RCB]
 gi|110816458|sp|Q47FB6|CLPP_DECAR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|71846969|gb|AAZ46465.1| ATP-dependent Clp protease proteolytic subunit ClpP [Dechloromonas
           aromatica RCB]
          Length = 209

 Score =  250 bits (639), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 127/209 (60%), Positives = 163/209 (77%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M+ +  +  D +   LGLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G + D  A L+ 
Sbjct: 1   MNIDNASNWDPQA--LGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDVTANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENP K+I  YINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+
Sbjct: 59  AQLLFLEAENPDKDIYFYINSPGGSVTAGMSIYDTMQFIKPDVSTLCIGQAASMGAFLLN 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RFALPN+R+++HQP GGF GQASDI  HA++I+ I+ RLN I  ++ G+  E +
Sbjct: 119 AGAKGKRFALPNSRVMIHQPLGGFQGQASDIAIHAKEILSIRDRLNRIMAEHSGQPLERI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           EK  DRD+ +SA+EA ++G++DKVL  R 
Sbjct: 179 EKDTDRDNFLSAAEAAEYGLIDKVLTRRD 207


>gi|258621302|ref|ZP_05716336.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM573]
 gi|258625374|ref|ZP_05720271.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM603]
 gi|262166052|ref|ZP_06033789.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM223]
 gi|262171083|ref|ZP_06038761.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           MB-451]
 gi|258582365|gb|EEW07217.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM603]
 gi|258586690|gb|EEW11405.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM573]
 gi|261892159|gb|EEY38145.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           MB-451]
 gi|262025768|gb|EEY44436.1| ATP-dependent Clp protease proteolytic subunit [Vibrio mimicus
           VM223]
          Length = 208

 Score =  250 bits (639), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 128/210 (60%), Positives = 165/210 (78%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +F  LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPIFDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HA++I+ IK +LN +  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAKEILTIKNKLNRLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ MSA +A ++G+VD VL  R +
Sbjct: 179 ERDTDRDNFMSADQAVEYGLVDAVLKHRGE 208


>gi|157146946|ref|YP_001454265.1| hypothetical protein CKO_02723 [Citrobacter koseri ATCC BAA-895]
 gi|157084151|gb|ABV13829.1| hypothetical protein CKO_02723 [Citrobacter koseri ATCC BAA-895]
          Length = 243

 Score =  250 bits (639), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 174/209 (83%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA ++G+VD +L  R 
Sbjct: 215 ERDTERDRFLSASEAVEYGLVDSILTHRN 243


>gi|307129927|ref|YP_003881943.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Dickeya dadantii 3937]
 gi|306527456|gb|ADM97386.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Dickeya dadantii 3937]
          Length = 207

 Score =  250 bits (639), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 134/209 (64%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++ +   + LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--EQEKQAPHMALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G+  E +
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKARMNELMAKHTGQPLEAI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA+EA D+G+VD VL  R 
Sbjct: 179 ERDTERDRFLSAAEAVDYGLVDSVLTHRE 207


>gi|261210563|ref|ZP_05924856.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. RC341]
 gi|262404275|ref|ZP_06080830.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. RC586]
 gi|260840348|gb|EEX66919.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. RC341]
 gi|262349307|gb|EEY98445.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. RC586]
          Length = 208

 Score =  250 bits (639), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 129/210 (61%), Positives = 165/210 (78%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +F  LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPIFDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK +LN +  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKNKLNRLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ MSA +A ++G+VD VL  R +
Sbjct: 179 ERDTDRDNFMSADQAVEYGLVDAVLKHRGE 208


>gi|237707568|ref|ZP_04538049.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Escherichia
           sp. 3_2_53FAA]
 gi|226898778|gb|EEH85037.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Escherichia
           sp. 3_2_53FAA]
 gi|332103940|gb|EGJ07286.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Shigella sp.
           D9]
          Length = 227

 Score =  250 bits (639), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 21  MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 78

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 79  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 138

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 139 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQI 198

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 199 ERDTERDRFLSAPEAVEYGLVDSILTHRN 227


>gi|161504375|ref|YP_001571487.1| hypothetical protein SARI_02486 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865722|gb|ABX22345.1| hypothetical protein SARI_02486 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 243

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 215 ERDTERDRFLSAPEAVEYGLVDSILTHRN 243


>gi|299135043|ref|ZP_07028234.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Afipia sp.
           1NLS2]
 gi|298590020|gb|EFI50224.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Afipia sp.
           1NLS2]
          Length = 210

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 137/203 (67%), Positives = 177/203 (87%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED M+TL+ AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AGEK MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGEKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+ Y+ +E  L+RD
Sbjct: 121 FSLPNSRIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQDYKTIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRID 210
           + ++A +A D+G+VDKV+  R +
Sbjct: 181 NFLTADKAKDFGIVDKVIDKRPE 203


>gi|62126693|gb|AAX64396.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease,
           heat shock protein F215 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
          Length = 246

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 40  MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 97

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 98  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 157

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 158 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 217

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 218 ERDTERDRFLSAPEAVEYGLVDSILTHRN 246


>gi|227113465|ref|ZP_03827121.1| ATP-dependent Clp protease proteolytic subunit [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
 gi|253687443|ref|YP_003016633.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754021|gb|ACT12097.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 207

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 131/208 (62%), Positives = 170/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++  +   + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ 
Sbjct: 1   MSYSGEQER--QAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R  LPN+R+++HQP GGF GQA+DIE HA++I+K+K ++NE+  K+ G+  E +
Sbjct: 119 AGAKGKRICLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKAKMNELMAKHTGQPLEAI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA D+G+VD V  +R
Sbjct: 179 ERDTERDRFLSASEAVDYGLVDSVFTNR 206


>gi|144899460|emb|CAM76324.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 214

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 177/209 (84%), Gaps = 1/209 (0%)

Query: 6   CAKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLL 64
             ++D  D+++  LVPMVVEQTNRGERSYDIYSRLLKERIVF+TGQ+ D ++TLICAQLL
Sbjct: 1   MRERDPIDLYMNTLVPMVVEQTNRGERSYDIYSRLLKERIVFLTGQVYDEVSTLICAQLL 60

Query: 65  FLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEK 124
           FLE+ENP K+I+ YINSPGGVVT+G+A+YDTMQ+I+P +ST C+GQAASMGSLLL+AG K
Sbjct: 61  FLESENPNKDIAFYINSPGGVVTSGLAMYDTMQYIRPSVSTVCLGQAASMGSLLLTAGAK 120

Query: 125 GMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL 184
           G RF+LPNAR+++HQPSGG  GQA+DIE  A++I+ ++ RLN +YV++ G+T E +E+ +
Sbjct: 121 GKRFSLPNARVMIHQPSGGAQGQATDIEIQAREILALRARLNNMYVQHTGQTLEVIERAM 180

Query: 185 DRDHIMSASEACDWGVVDKVLMSRIDIEE 213
           +RD  M+A EA ++G++D+V+ +R  +EE
Sbjct: 181 ERDKYMTADEAKEFGLIDEVVSNRPTLEE 209


>gi|313903081|ref|ZP_07836475.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Thermaerobacter subterraneus DSM 13965]
 gi|313466583|gb|EFR62103.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Thermaerobacter subterraneus DSM 13965]
          Length = 199

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 101/195 (51%), Positives = 148/195 (75%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQTNRGER+YDIYSRLLK+RIVF+   I+D +A  + AQLLFL+ ++P ++I
Sbjct: 1   MNLVPYVIEQTNRGERAYDIYSRLLKDRIVFIGTPIDDVVANSVIAQLLFLQTDDPDRDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG V +G+AIYDTMQ IKP ++T+C+G AASMG++LL+ G KG R+ALP++RI
Sbjct: 61  SIYINSPGGSVDSGLAIYDTMQHIKPDVATYCVGLAASMGAILLAGGTKGKRYALPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP     G A+D++ +A  ++K+++  NEI  K+ G+  E +E+  +RD  M+A EA
Sbjct: 121 MIHQPHSQVGGTAADVKIYADQLLKLRQVANEILAKHTGQPLERIERDTERDFFMTAEEA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D VL  R  
Sbjct: 181 KEYGIIDHVLEPRSK 195


>gi|269102129|ref|ZP_06154826.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162027|gb|EEZ40523.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 207

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 165/209 (78%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPILDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIYLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G KG R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +
Sbjct: 119 GGAKGKRYCLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNNLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  DRD+ MSA +A ++G+VD VL  R 
Sbjct: 179 ERDTDRDNFMSADQAVEYGLVDAVLSHRS 207


>gi|312113123|ref|YP_004010719.1| endopeptidase Clp [Rhodomicrobium vannielii ATCC 17100]
 gi|311218252|gb|ADP69620.1| Endopeptidase Clp [Rhodomicrobium vannielii ATCC 17100]
          Length = 214

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 142/208 (68%), Positives = 179/208 (86%), Gaps = 1/208 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  + +   LVPMVVEQTNRGER++DIYSRLLKERI+F+TG +ED+MA+L+ AQLLFL
Sbjct: 1   MRDPVEFYTSQLVPMVVEQTNRGERAFDIYSRLLKERIIFLTGVVEDNMASLVIAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP+KEI++YINSPGG VT+G+A+YDTMQFI+PP+ST C+GQAASMGSLLL+AGE GM
Sbjct: 61  ESENPKKEINIYINSPGGHVTSGLAMYDTMQFIRPPVSTLCVGQAASMGSLLLAAGEPGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNAR+++HQPS GF GQASDIERHA+DI+K KRRLNEIYVK+ G+ YE +E+TLDR
Sbjct: 121 RWALPNARVMVHQPSAGFQGQASDIERHAEDILKTKRRLNEIYVKHTGQPYEVIERTLDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEK 214
           DH MS  +A  +G++D+VL  R   EE 
Sbjct: 181 DHFMSPEQAKAFGIIDEVLTKRAAAEET 208


>gi|164686707|ref|ZP_02210735.1| hypothetical protein CLOBAR_00302 [Clostridium bartlettii DSM
           16795]
 gi|164604097|gb|EDQ97562.1| hypothetical protein CLOBAR_00302 [Clostridium bartlettii DSM
           16795]
          Length = 193

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 117/193 (60%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP VVEQT RGER+YDIYSRLLK+RI+F++ ++ D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MALVPTVVEQTGRGERAYDIYSRLLKDRIIFLSDEVNDTTASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  HLYINSPGGSVTAGMAIYDTMQYIKPDVSTICIGMAASMGAFLLNAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE HA+ I+KIK RLN+I  +  G+  E++++  +RD+ MSA EA
Sbjct: 121 MIHQPLGGAKGQATDIEIHAKWILKIKERLNKILSERTGQPIEKIQEDTERDNFMSAQEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+V+  +
Sbjct: 181 KEYGLIDEVIEKK 193


>gi|123443342|ref|YP_001007316.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|2493738|sp|Q60107|CLPP_YEREN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214722|sp|A1JNN2|CLPP_YERE8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|1377852|gb|AAC45782.1| ClpP [Yersinia enterocolitica]
 gi|122090303|emb|CAL13169.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 207

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 134/209 (64%), Positives = 171/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAKHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD V   R 
Sbjct: 179 ERDTERDRFLSADEAVEYGLVDSVFTRRD 207


>gi|167646810|ref|YP_001684473.1| ATP-dependent Clp protease proteolytic subunit [Caulobacter sp.
           K31]
 gi|189082451|sp|B0SZQ2|CLPP_CAUSK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167349240|gb|ABZ71975.1| Endopeptidase Clp [Caulobacter sp. K31]
          Length = 208

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 150/206 (72%), Positives = 178/206 (86%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D     + LVPMVVEQT+RGER++DI+SRLLKERI+F+TG +ED MA+LICAQLLFLE+E
Sbjct: 3   DPMATAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+KEI++YINSPGGVVTAG+AIYDTMQ+IK P+ST CMG AASMGSLLL AG  G R A
Sbjct: 63  NPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLQAGAPGHRIA 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNARI++HQPSGGF GQASDIERHA+DI+K KRRLNEIYVK+ G+TYEEVEKTLDRDH 
Sbjct: 123 LPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHTGRTYEEVEKTLDRDHF 182

Query: 190 MSASEACDWGVVDKVLMSRIDIEEKS 215
           MSA EA  WG++D +  SR + +EK+
Sbjct: 183 MSAEEAKAWGLIDHINESRDEADEKA 208


>gi|206578475|ref|YP_002240083.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Klebsiella
           pneumoniae 342]
 gi|238893386|ref|YP_002918120.1| ATP-dependent Clp protease proteolytic subunit [Klebsiella
           pneumoniae NTUH-K2044]
 gi|288936834|ref|YP_003440893.1| ATP-dependent Clp protease proteolytic subunit ClpP [Klebsiella
           variicola At-22]
 gi|290510110|ref|ZP_06549480.1| Clp protease [Klebsiella sp. 1_1_55]
 gi|206567533|gb|ACI09309.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Klebsiella
           pneumoniae 342]
 gi|238545702|dbj|BAH62053.1| ATP-dependent Clp protease proteolytic subunit [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|288891543|gb|ADC59861.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Klebsiella
           variicola At-22]
 gi|289776826|gb|EFD84824.1| Clp protease [Klebsiella sp. 1_1_55]
          Length = 207

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 174/209 (83%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA+EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSAAEAVEYGLVDSILTHRN 207


>gi|283784263|ref|YP_003364128.1| ATP-dependent clp protease proteolytic subunit [Citrobacter
           rodentium ICC168]
 gi|282947717|emb|CBG87272.1| ATP-dependent clp protease proteolytic subunit [Citrobacter
           rodentium ICC168]
          Length = 207

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHRN 207


>gi|127513436|ref|YP_001094633.1| ATP-dependent Clp protease proteolytic subunit [Shewanella loihica
           PV-4]
 gi|171855248|sp|A3QFX6|CLPP_SHELP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|126638731|gb|ABO24374.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella
           loihica PV-4]
          Length = 203

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 127/202 (62%), Positives = 159/202 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +   E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFL
Sbjct: 1   MQNAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G KG 
Sbjct: 61  ESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++   + G+  E +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNQMLADHTGQPLEVIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MSA+EA ++G+VD VL  R
Sbjct: 181 DNFMSATEAAEYGLVDSVLDKR 202


>gi|169831635|ref|YP_001717617.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169638479|gb|ACA59985.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 198

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 118/198 (59%), Positives = 157/198 (79%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVP+VVEQT RGER+YDIYSRLLK+RIVF+ G IEDH+A LI AQLLFLEAE+P K+
Sbjct: 1   MNTLVPIVVEQTARGERAYDIYSRLLKDRIVFIGGPIEDHVANLIIAQLLFLEAEDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGG+VT+GMAIYDTMQ+I+P +ST C+GQAAS G+ LL+AG  G RFALP AR
Sbjct: 61  IHLYINSPGGLVTSGMAIYDTMQYIRPDVSTICLGQAASFGAFLLAAGTPGKRFALPYAR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQA++I+ HA++I++ KR LNE+  K+ G+  E++E+  +RD  MS  +
Sbjct: 121 IMMHQPLGGVQGQATEIDIHAREILRTKRVLNELLAKHTGQPVEKIERDTERDFFMSPEQ 180

Query: 195 ACDWGVVDKVLMSRIDIE 212
           A ++G++D+V+  R   +
Sbjct: 181 AREYGIIDEVITVRKKAK 198


>gi|115524517|ref|YP_781428.1| endopeptidase Clp [Rhodopseudomonas palustris BisA53]
 gi|122296222|sp|Q07NN6|CLPP_RHOP5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|115518464|gb|ABJ06448.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Rhodopseudomonas palustris BisA53]
          Length = 211

 Score =  249 bits (637), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 139/209 (66%), Positives = 176/209 (84%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED M+TL+ AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL AG K MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLCAGAKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD
Sbjct: 121 FSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
             ++A  A D+G+VDKV+  R +    +K
Sbjct: 181 KFLTADMARDFGLVDKVIDKRPEEASPAK 209


>gi|161615359|ref|YP_001589324.1| hypothetical protein SPAB_03130 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197263975|ref|ZP_03164049.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|198242637|ref|YP_002214402.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|200390046|ref|ZP_03216657.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205357179|ref|ZP_02345490.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205359635|ref|ZP_02830941.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|224582286|ref|YP_002636084.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|161364723|gb|ABX68491.1| hypothetical protein SPAB_03130 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197242230|gb|EDY24850.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197937153|gb|ACH74486.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199602491|gb|EDZ01037.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205323485|gb|EDZ11324.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205344194|gb|EDZ30958.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|224466813|gb|ACN44643.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|322713521|gb|EFZ05092.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|326622151|gb|EGE28496.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
          Length = 243

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 215 ERDTERDRFLSAPEAVEYGLVDSILTHRN 243


>gi|86148885|ref|ZP_01067136.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. MED222]
 gi|85833328|gb|EAQ51535.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. MED222]
          Length = 198

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 127/198 (64%), Positives = 159/198 (80%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
            +   LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ AQLLFLE+ENP 
Sbjct: 1   SIMDALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVVAQLLFLESENPD 60

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R  LPN
Sbjct: 61  KDIYLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGTPGKRHVLPN 120

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E VE+  DRD+ MSA
Sbjct: 121 SRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVVERDTDRDNFMSA 180

Query: 193 SEACDWGVVDKVLMSRID 210
            +A ++G+VD VL  R  
Sbjct: 181 DQAVEYGLVDSVLNHRGQ 198


>gi|239831859|ref|ZP_04680188.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ochrobactrum
           intermedium LMG 3301]
 gi|239824126|gb|EEQ95694.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ochrobactrum
           intermedium LMG 3301]
          Length = 230

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 149/213 (69%), Positives = 184/213 (86%)

Query: 4   EGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           +    +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQL
Sbjct: 18  QRPIMRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQL 77

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           LFLEAENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG 
Sbjct: 78  LFLEAENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGA 137

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
            G R+ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ YE +E+T
Sbjct: 138 TGQRYALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYETIERT 197

Query: 184 LDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           LDRDH M+A EA ++G++DKV+ +R    ++SK
Sbjct: 198 LDRDHFMTAQEALEFGLIDKVVEARDVSADESK 230


>gi|84387735|ref|ZP_00990751.1| ATP-dependent Clp protease proteolytic subunit [Vibrio splendidus
           12B01]
 gi|218710174|ref|YP_002417795.1| ATP-dependent Clp protease proteolytic subunit [Vibrio splendidus
           LGP32]
 gi|254763809|sp|B7VI00|CLPP_VIBSL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|84377418|gb|EAP94285.1| ATP-dependent Clp protease proteolytic subunit [Vibrio splendidus
           12B01]
 gi|218323193|emb|CAV19370.1| ATP-dependent Clp protease proteolytic subunit [Vibrio splendidus
           LGP32]
          Length = 208

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 130/210 (61%), Positives = 164/210 (78%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNTMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIYLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R  LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E V
Sbjct: 119 GGTPGKRHVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVV 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ MSA +A ++G+VD VL  R  
Sbjct: 179 ERDTDRDNFMSADQAVEYGLVDSVLNHRGQ 208


>gi|260892392|ref|YP_003238489.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ammonifex
           degensii KC4]
 gi|260864533|gb|ACX51639.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ammonifex
           degensii KC4]
          Length = 200

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 117/196 (59%), Positives = 162/196 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT+RGER+YDIYSRLLK+RI+F+ G I+DH+A L+ AQLLFLEAE+P+K+I L
Sbjct: 5   LVPIVVEQTSRGERAYDIYSRLLKDRIIFIGGPIDDHLANLVIAQLLFLEAEDPEKDIHL 64

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG+VTAGMAIYDTMQ+I+P +ST C+GQAASM + LL+AG KG R+ALP ARI+L
Sbjct: 65  YINSPGGLVTAGMAIYDTMQYIRPDVSTICLGQAASMAAFLLAAGAKGKRYALPYARIML 124

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+++E HA++I+++++ LNE+  K+ G+  E++ +  DRD  M+A +A D
Sbjct: 125 HQPLGGFQGQATEVEIHAREIMRMRQVLNELLSKHTGQPVEKIAQDTDRDFFMTAQQAKD 184

Query: 198 WGVVDKVLMSRIDIEE 213
           +G++D+V+  R    +
Sbjct: 185 YGLIDEVITMRKKPAK 200


>gi|323128768|gb|ADX16198.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
          Length = 246

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 40  MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 97

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 98  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 157

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 158 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 217

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 218 ERDTERDRFLSAPEAVEYGLVDSILTHRN 246


>gi|50120087|ref|YP_049254.1| ATP-dependent Clp protease proteolytic subunit [Pectobacterium
           atrosepticum SCRI1043]
 gi|60389567|sp|Q6D827|CLPP_ERWCT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|49610613|emb|CAG74058.1| ATP-dependent Clp protease proteolytic subunit [Pectobacterium
           atrosepticum SCRI1043]
          Length = 207

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 129/208 (62%), Positives = 169/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++  +   + LVPMVVEQT RGERSYDIYSRLLKERI+F+TGQ+ED+MA L+ 
Sbjct: 1   MSYSGEQER--QAPHMALVPMVVEQTARGERSYDIYSRLLKERIIFLTGQVEDYMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R  LPN+R+++HQP GGF GQA+DIE HA++I+K+K ++NE+  K+ G+  E +
Sbjct: 119 AGAKGKRICLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKAKMNELMAKHTGQPLEAI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA ++G+VD V  +R
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSVFTNR 206


>gi|296101559|ref|YP_003611705.1| ATP-dependent Clp protease, protease subunit [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295056018|gb|ADF60756.1| ATP-dependent Clp protease, protease subunit [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 207

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 175/209 (83%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSILTHRN 207


>gi|197105280|ref|YP_002130657.1| ATP-dependent Clp protease, proteolytic subunit [Phenylobacterium
           zucineum HLK1]
 gi|196478700|gb|ACG78228.1| ATP-dependent Clp protease, proteolytic subunit [Phenylobacterium
           zucineum HLK1]
          Length = 205

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 139/202 (68%), Positives = 168/202 (83%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D     LGLVPMVVEQT+RGER+YDI+SRLLK+RIVF+ G +ED MA+LICAQLL LE
Sbjct: 1   MRDPVTTALGLVPMVVEQTSRGERAYDIFSRLLKDRIVFLAGPVEDGMASLICAQLLHLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI +YINSPGGVVT+G+AIYDTMQ+IK P+ T C+G AASMGS LL AGEKG R
Sbjct: 61  AENPKKEIQMYINSPGGVVTSGLAIYDTMQYIKSPVITLCLGMAASMGSFLLMAGEKGQR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
            ALPN+RI++HQPSGG+SG+A+DI+RHA+DI+K KRRLNEIY K+ G+  E VE+TLDRD
Sbjct: 121 IALPNSRIMVHQPSGGYSGKATDIQRHAEDIIKTKRRLNEIYAKHTGQPIEAVEETLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
             M+A EA DWG+VD V   R 
Sbjct: 181 FFMTAQEAKDWGLVDHVWEKRD 202


>gi|89073230|ref|ZP_01159760.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium sp.
           SKA34]
 gi|90579278|ref|ZP_01235088.1| ATP-dependent Clp protease proteolytic subunit [Vibrio angustum
           S14]
 gi|89050940|gb|EAR56404.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium sp.
           SKA34]
 gi|90440111|gb|EAS65292.1| ATP-dependent Clp protease proteolytic subunit [Vibrio angustum
           S14]
          Length = 207

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 165/209 (78%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPILDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G KG R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK+RLN +  ++ G+  E V
Sbjct: 119 GGAKGKRYCLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQRLNGLLAEHTGQPLEVV 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  DRD+ MSA +A ++G+VD VL  R 
Sbjct: 179 ERDTDRDNFMSAEQAVEYGLVDAVLSQRD 207


>gi|332160749|ref|YP_004297326.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318604628|emb|CBY26126.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325664979|gb|ADZ41623.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859950|emb|CBX70279.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           enterocolitica W22703]
          Length = 207

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 134/209 (64%), Positives = 170/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAKHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA  +G+VD V   R 
Sbjct: 179 ERDTERDRFLSADEAVKYGLVDSVFTRRD 207


>gi|226939792|ref|YP_002794865.1| Protease subunit of ATP-dependent Clp protease [Laribacter
           hongkongensis HLHK9]
 gi|254763792|sp|C1D539|CLPP_LARHH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226714718|gb|ACO73856.1| Protease subunit of ATP-dependent Clp protease [Laribacter
           hongkongensis HLHK9]
          Length = 212

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 123/202 (60%), Positives = 162/202 (80%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
                 LGLVPMVVEQ+ RGER+YDIYSRLLKERIVF+ G + D  A L+ AQ+LFLE+E
Sbjct: 11  QPAPQALGLVPMVVEQSGRGERAYDIYSRLLKERIVFMVGPVTDETANLVVAQMLFLESE 70

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I LYINSPGG VTAG++IYDTM FIKP +ST C+GQAASMG+ LLSAG KG RFA
Sbjct: 71  NPDKDIHLYINSPGGSVTAGLSIYDTMNFIKPSVSTLCIGQAASMGAFLLSAGAKGKRFA 130

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQASD E HA++I+ +KR+LNE+   +CG+  E++E+  DRD+ 
Sbjct: 131 LPNSRVMIHQPLGGFQGQASDFEIHAREILTLKRKLNELMAAHCGRPLEDLERDTDRDNF 190

Query: 190 MSASEACDWGVVDKVLMSRIDI 211
           M+A++A ++G++D+VL +R  +
Sbjct: 191 MNAAQALEYGLIDQVLENRAAV 212


>gi|121727845|ref|ZP_01680912.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae V52]
 gi|229507982|ref|ZP_04397487.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae BX
           330286]
 gi|229511781|ref|ZP_04401260.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           B33]
 gi|229515308|ref|ZP_04404768.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae TMA
           21]
 gi|229518918|ref|ZP_04408361.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           RC9]
 gi|229523942|ref|ZP_04413347.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae bv.
           albensis VL426]
 gi|229529052|ref|ZP_04418442.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           12129(1)]
 gi|229607528|ref|YP_002878176.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           MJ-1236]
 gi|254849010|ref|ZP_05238360.1| ATP-dependent Clp protease [Vibrio cholerae MO10]
 gi|255745319|ref|ZP_05419268.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholera CIRS
           101]
 gi|262156043|ref|ZP_06029163.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           INDRE 91/1]
 gi|262167884|ref|ZP_06035584.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           RC27]
 gi|297579440|ref|ZP_06941368.1| ATP-dependent Clp protease [Vibrio cholerae RC385]
 gi|298498040|ref|ZP_07007847.1| clp protease [Vibrio cholerae MAK 757]
 gi|121629881|gb|EAX62295.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae V52]
 gi|229332826|gb|EEN98312.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           12129(1)]
 gi|229337523|gb|EEO02540.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae bv.
           albensis VL426]
 gi|229343607|gb|EEO08582.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           RC9]
 gi|229348013|gb|EEO12972.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae TMA
           21]
 gi|229351746|gb|EEO16687.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           B33]
 gi|229355487|gb|EEO20408.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae BX
           330286]
 gi|229370183|gb|ACQ60606.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           MJ-1236]
 gi|254844715|gb|EET23129.1| ATP-dependent Clp protease [Vibrio cholerae MO10]
 gi|255737149|gb|EET92545.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholera CIRS
           101]
 gi|262023611|gb|EEY42312.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           RC27]
 gi|262030221|gb|EEY48865.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           INDRE 91/1]
 gi|297537034|gb|EFH75867.1| ATP-dependent Clp protease [Vibrio cholerae RC385]
 gi|297542373|gb|EFH78423.1| clp protease [Vibrio cholerae MAK 757]
 gi|327484465|gb|AEA78872.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           LMA3894-4]
          Length = 208

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 129/210 (61%), Positives = 165/210 (78%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +F  LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPIFDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK +LN +  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKNKLNRLLAEHTGQPIEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ MSA +A ++G+VD VL  R +
Sbjct: 179 ERDTDRDNFMSADQAVEYGLVDAVLKHRGE 208


>gi|89070383|ref|ZP_01157690.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Oceanicola
           granulosus HTCC2516]
 gi|89044030|gb|EAR50205.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Oceanicola
           granulosus HTCC2516]
          Length = 209

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 130/202 (64%), Positives = 171/202 (84%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D  + ++ LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D MA+LI AQL+ LE
Sbjct: 1   MHDPIETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMASLIVAQLIHLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G++IYDTMQ+IKPP+ST  +GQAASMGSLLL+ GEKGMR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLSIYDTMQYIKPPVSTLVIGQAASMGSLLLAGGEKGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
            +LPN+RI++HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYVK+ G+T ++VE  L+RD
Sbjct: 121 LSLPNSRIMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQTLKKVEAALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + MS  EA DWG++D++  +R 
Sbjct: 181 NFMSPEEAKDWGLIDEIFENRA 202


>gi|27363512|ref|NP_759040.1| ATP-dependent Clp protease proteolytic subunit [Vibrio vulnificus
           CMCP6]
 gi|37679288|ref|NP_933897.1| ATP-dependent Clp protease proteolytic subunit [Vibrio vulnificus
           YJ016]
 gi|320156969|ref|YP_004189348.1| ATP-dependent Clp protease proteolytic subunit [Vibrio vulnificus
           MO6-24/O]
 gi|27359628|gb|AAO08567.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           vulnificus CMCP6]
 gi|37198031|dbj|BAC93868.1| ATP-dependent Clp protease, proteolytic subunit [Vibrio vulnificus
           YJ016]
 gi|319932281|gb|ADV87145.1| ATP-dependent Clp protease proteolytic subunit [Vibrio vulnificus
           MO6-24/O]
          Length = 208

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 128/209 (61%), Positives = 164/209 (78%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPIIDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK +LN++  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKTKLNKLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  DRD+ MSA +A ++G+VD VL  R 
Sbjct: 179 ERDTDRDNFMSADQAVEYGLVDAVLTHRS 207


>gi|255261268|ref|ZP_05340610.1| Clp protease [Thalassiobium sp. R2A62]
 gi|255103603|gb|EET46277.1| Clp protease [Thalassiobium sp. R2A62]
          Length = 209

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 127/208 (61%), Positives = 170/208 (81%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D  + ++ LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M+ LI AQLL LE
Sbjct: 1   MNDPVETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSQLIVAQLLHLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGEKGMR
Sbjct: 61  AENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEKGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+R+++HQPSGG+ GQA+DI  HA +  K+K RLN IYV++ G+T ++VE  L+RD
Sbjct: 121 FSLPNSRVMVHQPSGGYQGQATDIMIHAAETQKLKDRLNSIYVRHTGQTLKKVEAALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKS 215
           + MSA +A DWG++D+++ +R   ++  
Sbjct: 181 NFMSAEDAKDWGLIDEIVENRNKEDDAK 208


>gi|291085757|ref|ZP_06571180.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Citrobacter
           youngae ATCC 29220]
 gi|291069764|gb|EFE07873.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Citrobacter
           youngae ATCC 29220]
          Length = 243

 Score =  249 bits (636), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 174/209 (83%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFMTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA ++G+VD +L  R 
Sbjct: 215 ERDTERDRFLSASEAVEYGLVDSILTHRN 243


>gi|170727453|ref|YP_001761479.1| ATP-dependent Clp protease proteolytic subunit [Shewanella woodyi
           ATCC 51908]
 gi|226706474|sp|B1KLT7|CLPP_SHEWM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|169812800|gb|ACA87384.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           woodyi ATCC 51908]
          Length = 203

 Score =  249 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 127/202 (62%), Positives = 158/202 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +   E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFL
Sbjct: 1   MQNAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP +EISLYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G KG 
Sbjct: 61  ESENPDQEISLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASD   HAQ+I+ IK +LN I  ++ G+  E +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDFAIHAQEILGIKNKLNNILAEHTGQPLEVIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MSA++A ++G+VD V   R
Sbjct: 181 DNFMSAAQAAEYGLVDSVFEQR 202


>gi|16759428|ref|NP_455045.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16763829|ref|NP_459444.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29142800|ref|NP_806142.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|162139608|ref|YP_215477.2| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|168237562|ref|ZP_02662620.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168261116|ref|ZP_02683089.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168465541|ref|ZP_02699423.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|194443946|ref|YP_002039691.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194451357|ref|YP_002044483.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194734455|ref|YP_002113479.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|204930575|ref|ZP_03221505.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|207855928|ref|YP_002242579.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|213025962|ref|ZP_03340409.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213419494|ref|ZP_03352560.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213425858|ref|ZP_03358608.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213646005|ref|ZP_03376058.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
 gi|213853068|ref|ZP_03382600.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|238911421|ref|ZP_04655258.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|60391923|sp|P0A1D7|CLPP_SALTY RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|60391924|sp|P0A1D8|CLPP_SALTI RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|67460140|sp|Q57SB5|CLPP_SALCH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|226706468|sp|B5QTJ6|CLPP_SALEP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706469|sp|B4T9E3|CLPP_SALHS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706470|sp|B4SWU1|CLPP_SALNS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706472|sp|B4TMC6|CLPP_SALSV RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|25289858|pir||AC0558 ATP-dependent clp protease proteolytic chain [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|7594816|dbj|BAA94668.1| serine protease subunit [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|16418955|gb|AAL19403.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|16501719|emb|CAD08907.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29138432|gb|AAO70002.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|194402609|gb|ACF62831.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194409661|gb|ACF69880.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194709957|gb|ACF89178.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195631923|gb|EDX50443.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197289522|gb|EDY28885.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|204320509|gb|EDZ05712.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205350070|gb|EDZ36701.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|206707731|emb|CAR32016.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|261245731|emb|CBG23528.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267992163|gb|ACY87048.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157059|emb|CBW16543.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312911481|dbj|BAJ35455.1| ATP-dependent Clp protease proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|320084722|emb|CBY94513.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322614726|gb|EFY11655.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322618832|gb|EFY15720.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322623539|gb|EFY20378.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322629162|gb|EFY25941.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322631883|gb|EFY28637.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322637380|gb|EFY34082.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322642065|gb|EFY38675.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322647884|gb|EFY44359.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322652562|gb|EFY48916.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322653276|gb|EFY49609.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660575|gb|EFY56811.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322664727|gb|EFY60920.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322669220|gb|EFY65370.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322670765|gb|EFY66898.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322678996|gb|EFY75051.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322682025|gb|EFY78050.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322685146|gb|EFY81143.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323192960|gb|EFZ78183.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323196958|gb|EFZ82100.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323203943|gb|EFZ88960.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323206972|gb|EFZ91925.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323214175|gb|EFZ98933.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323214501|gb|EFZ99252.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323223058|gb|EGA07401.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323227007|gb|EGA11188.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323230175|gb|EGA14295.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323233913|gb|EGA18002.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323238393|gb|EGA22451.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323244080|gb|EGA28089.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323246241|gb|EGA30224.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323251867|gb|EGA35730.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323257864|gb|EGA41543.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323261123|gb|EGA44715.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323264947|gb|EGA48446.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323272510|gb|EGA55917.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 207

 Score =  249 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHRN 207


>gi|56414396|ref|YP_151471.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363316|ref|YP_002142953.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|67460194|sp|Q5PFN4|CLPP_SALPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|226706471|sp|B5BD83|CLPP_SALPK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56128653|gb|AAV78159.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197094793|emb|CAR60326.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 207

 Score =  249 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 128/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAG++IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGISIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHRN 207


>gi|62290024|ref|YP_221817.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 1 str. 9-941]
 gi|82699951|ref|YP_414525.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           biovar Abortus 2308]
 gi|161619061|ref|YP_001592948.1| ATP-dependent Clp protease proteolytic subunit [Brucella canis ATCC
           23365]
 gi|163843378|ref|YP_001627782.1| ATP-dependent Clp protease proteolytic subunit [Brucella suis ATCC
           23445]
 gi|189024264|ref|YP_001935032.1| Clp protease [Brucella abortus S19]
 gi|254689336|ref|ZP_05152590.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 6 str. 870]
 gi|254693820|ref|ZP_05155648.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697469|ref|ZP_05159297.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254701854|ref|ZP_05163682.1| ATP-dependent Clp protease proteolytic subunit [Brucella suis bv. 5
           str. 513]
 gi|254706705|ref|ZP_05168533.1| ATP-dependent Clp protease proteolytic subunit [Brucella
           pinnipedialis M163/99/10]
 gi|254710187|ref|ZP_05171998.1| ATP-dependent Clp protease proteolytic subunit [Brucella
           pinnipedialis B2/94]
 gi|254714185|ref|ZP_05175996.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti
           M644/93/1]
 gi|254717620|ref|ZP_05179431.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti
           M13/05/1]
 gi|254719174|ref|ZP_05180985.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. 83/13]
 gi|254730366|ref|ZP_05188944.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 4 str. 292]
 gi|256031681|ref|ZP_05445295.1| ATP-dependent Clp protease proteolytic subunit [Brucella
           pinnipedialis M292/94/1]
 gi|256061193|ref|ZP_05451345.1| ATP-dependent Clp protease proteolytic subunit [Brucella neotomae
           5K33]
 gi|256159837|ref|ZP_05457570.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti
           M490/95/1]
 gi|256255083|ref|ZP_05460619.1| ATP-dependent Clp protease proteolytic subunit [Brucella ceti
           B1/94]
 gi|256257582|ref|ZP_05463118.1| ATP-dependent Clp protease proteolytic subunit [Brucella abortus
           bv. 9 str. C68]
 gi|260168815|ref|ZP_05755626.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. F5/99]
 gi|260546576|ref|ZP_05822315.1| clp protease [Brucella abortus NCTC 8038]
 gi|260566355|ref|ZP_05836825.1| clp protease [Brucella suis bv. 4 str. 40]
 gi|260754852|ref|ZP_05867200.1| endopeptidase Clp [Brucella abortus bv. 6 str. 870]
 gi|260758069|ref|ZP_05870417.1| endopeptidase Clp [Brucella abortus bv. 4 str. 292]
 gi|260761893|ref|ZP_05874236.1| endopeptidase Clp [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883864|ref|ZP_05895478.1| ClpP [Brucella abortus bv. 9 str. C68]
 gi|261214103|ref|ZP_05928384.1| endopeptidase Clp [Brucella abortus bv. 3 str. Tulya]
 gi|261219456|ref|ZP_05933737.1| ATP-dependent Clp protease [Brucella ceti M13/05/1]
 gi|261222276|ref|ZP_05936557.1| ClpP [Brucella ceti B1/94]
 gi|261314167|ref|ZP_05953364.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317744|ref|ZP_05956941.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321952|ref|ZP_05961149.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261325200|ref|ZP_05964397.1| ClpP [Brucella neotomae 5K33]
 gi|261752415|ref|ZP_05996124.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Brucella suis
           bv. 5 str. 513]
 gi|261758300|ref|ZP_06002009.1| clp protease [Brucella sp. F5/99]
 gi|265984170|ref|ZP_06096905.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265988775|ref|ZP_06101332.1| ClpP [Brucella pinnipedialis M292/94/1]
 gi|265998240|ref|ZP_06110797.1| ClpP [Brucella ceti M490/95/1]
 gi|294852448|ref|ZP_06793121.1| Clp protease [Brucella sp. NVSL 07-0026]
 gi|306838166|ref|ZP_07471022.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. NF
           2653]
 gi|306841836|ref|ZP_07474518.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. BO2]
 gi|306843974|ref|ZP_07476569.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. BO1]
 gi|18203228|sp|Q9L7X6|CLPP_BRUAB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90101403|sp|Q2YPX1|CLPP_BRUA2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082449|sp|A9M5C2|CLPP_BRUC2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082450|sp|B0CGR1|CLPP_BRUSI RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706442|sp|B2S5W1|CLPP_BRUA1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|6942106|gb|AAF32318.1|AF218420_1 ClpP [Brucella abortus]
 gi|62196156|gb|AAX74456.1| ClpP, ATP-dependent Clp protease, proteolytic subunit ClpP
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616052|emb|CAJ11088.1| Clp protease [Brucella melitensis biovar Abortus 2308]
 gi|161335872|gb|ABX62177.1| ATP-dependent Clp protease proteolytic subunit [Brucella canis ATCC
           23365]
 gi|163674101|gb|ABY38212.1| ATP-dependent Clp protease proteolytic subunit [Brucella suis ATCC
           23445]
 gi|189019836|gb|ACD72558.1| Clp protease [Brucella abortus S19]
 gi|260095626|gb|EEW79503.1| clp protease [Brucella abortus NCTC 8038]
 gi|260155873|gb|EEW90953.1| clp protease [Brucella suis bv. 4 str. 40]
 gi|260668387|gb|EEX55327.1| endopeptidase Clp [Brucella abortus bv. 4 str. 292]
 gi|260672325|gb|EEX59146.1| endopeptidase Clp [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674960|gb|EEX61781.1| endopeptidase Clp [Brucella abortus bv. 6 str. 870]
 gi|260873392|gb|EEX80461.1| ClpP [Brucella abortus bv. 9 str. C68]
 gi|260915710|gb|EEX82571.1| endopeptidase Clp [Brucella abortus bv. 3 str. Tulya]
 gi|260920860|gb|EEX87513.1| ClpP [Brucella ceti B1/94]
 gi|260924545|gb|EEX91113.1| ATP-dependent Clp protease [Brucella ceti M13/05/1]
 gi|261294642|gb|EEX98138.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296967|gb|EEY00464.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301180|gb|EEY04677.1| ClpP [Brucella neotomae 5K33]
 gi|261303193|gb|EEY06690.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261738284|gb|EEY26280.1| clp protease [Brucella sp. F5/99]
 gi|261742168|gb|EEY30094.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Brucella suis
           bv. 5 str. 513]
 gi|262552708|gb|EEZ08698.1| ClpP [Brucella ceti M490/95/1]
 gi|264660972|gb|EEZ31233.1| ClpP [Brucella pinnipedialis M292/94/1]
 gi|264662762|gb|EEZ33023.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294821037|gb|EFG38036.1| Clp protease [Brucella sp. NVSL 07-0026]
 gi|306275729|gb|EFM57453.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. BO1]
 gi|306288063|gb|EFM59460.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. BO2]
 gi|306406756|gb|EFM62979.1| ATP-dependent Clp protease proteolytic subunit [Brucella sp. NF
           2653]
          Length = 209

 Score =  249 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 148/209 (70%), Positives = 183/209 (87%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLE
Sbjct: 1   MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R
Sbjct: 61  AENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           +ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRD
Sbjct: 121 YALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA ++G++DKV+ +R    ++SK
Sbjct: 181 HFMTAQEALEFGLIDKVVEARDVSADESK 209


>gi|227328849|ref|ZP_03832873.1| ATP-dependent Clp protease proteolytic subunit [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 207

 Score =  249 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 130/208 (62%), Positives = 170/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++  +   + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+ED+MA L+ 
Sbjct: 1   MSYSGEQER--QAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDYMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R  LPN+R+++HQP GGF GQA+DIE HA++I+K+K ++NE+  K+ G+  E +
Sbjct: 119 AGAKGKRICLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKAKMNELMAKHTGQPLEAI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SASEA D+G+VD V  +R
Sbjct: 179 ERDTERDRFLSASEAVDYGLVDSVFTNR 206


>gi|317123029|ref|YP_004103032.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Thermaerobacter marianensis DSM 12885]
 gi|315593009|gb|ADU52305.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Thermaerobacter marianensis DSM 12885]
          Length = 199

 Score =  249 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 102/195 (52%), Positives = 147/195 (75%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQTNRGER+YDIYSRLLK+RIVF+   I+D +A  + AQLLFL+ ++P ++I
Sbjct: 1   MNLVPYVIEQTNRGERAYDIYSRLLKDRIVFIGTPIDDVVANSVIAQLLFLQTDDPDRDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG V +G+AIYDTMQ IKP ++T+C+G AASMG++LL+ G KG R+ALP++RI
Sbjct: 61  SIYINSPGGSVDSGLAIYDTMQHIKPDVATYCVGLAASMGAILLAGGTKGKRYALPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP     G ASD++ +A  ++K+++  NEI  K+ G+  E +E+  +RD  M+A EA
Sbjct: 121 MIHQPHSQVGGTASDVKIYADQLLKLRQVANEILAKHTGQPLERIERDTERDFFMTAEEA 180

Query: 196 CDWGVVDKVLMSRID 210
             +G++D VL  R  
Sbjct: 181 KAYGIIDHVLEPRTK 195


>gi|163868071|ref|YP_001609275.1| ATP-dependent Clp protease proteolytic subunit [Bartonella
           tribocorum CIP 105476]
 gi|189082448|sp|A9ISA4|CLPP_BART1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|161017722|emb|CAK01280.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella
           tribocorum CIP 105476]
          Length = 210

 Score =  249 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 152/209 (72%), Positives = 180/209 (86%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D     L LVPMV+EQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLE
Sbjct: 1   MSDPMKTALSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDGMAMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEISLYINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG KG R
Sbjct: 61  AENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYV++ G+ YE +E+TLDRD
Sbjct: 121 FALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQGYEVIERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA  +G+VD V+  R + E++ K
Sbjct: 181 HFMTAEEAKAFGLVDDVIHYRAETEKEEK 209


>gi|194471774|ref|ZP_03077758.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|197249758|ref|YP_002145429.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|205357584|ref|ZP_02571531.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205358475|ref|ZP_02656494.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205358901|ref|ZP_02665206.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|289827300|ref|ZP_06545983.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|194458138|gb|EDX46977.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|197213461|gb|ACH50858.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|205331008|gb|EDZ17772.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334088|gb|EDZ20852.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205340153|gb|EDZ26917.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|321226026|gb|EFX51077.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
          Length = 243

 Score =  249 bits (635), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 37  MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 94

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 95  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 154

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 155 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 214

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 215 ERDTERDRFLSAPEAVEYGLVDSILTHRN 243


>gi|240850274|ref|YP_002971667.1| ATP-dependent Clp protease proteolytic subunit ClpP [Bartonella
           grahamii as4aup]
 gi|240267397|gb|ACS50985.1| ATP-dependent Clp protease proteolytic subunit ClpP [Bartonella
           grahamii as4aup]
          Length = 210

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 151/209 (72%), Positives = 179/209 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D     L LVPMV+EQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLE
Sbjct: 1   MSDPMKTALSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDGMAMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEISLYINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG KG R
Sbjct: 61  AENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYV++ G+ YE +E+TLDRD
Sbjct: 121 FTLPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQDYEIIERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA  +G+VD V+  R + E++ K
Sbjct: 181 HFMTAEEAKAFGLVDDVIQYRAETEKEEK 209


>gi|319943618|ref|ZP_08017899.1| ATP-dependent Clp protease proteolytic subunit [Lautropia mirabilis
           ATCC 51599]
 gi|319742851|gb|EFV95257.1| ATP-dependent Clp protease proteolytic subunit [Lautropia mirabilis
           ATCC 51599]
          Length = 262

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 113/200 (56%), Positives = 157/200 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VP+V+EQ+ RGER+YDIYSRLL+ER+VF+ G + D  A L  AQ+L+LE+ENP K+I
Sbjct: 58  LGMVPIVIEQSGRGERAYDIYSRLLRERVVFLVGPVMDQSANLAVAQMLYLESENPDKDI 117

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG V+AG+ I+DTMQF+KP +ST C+G AASMG+ LL+AG KG R +LPN+RI
Sbjct: 118 HFYINSPGGSVSAGLGIFDTMQFVKPDVSTLCIGFAASMGAFLLAAGAKGKRHSLPNSRI 177

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDIE HA++I+ +++RLN+I     G+  E +E+  +RD+ MSA EA
Sbjct: 178 MIHQPSGGAQGQASDIEIHAKEIIYLRKRLNQILADRTGQPLERIERDTERDNFMSADEA 237

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
            ++G++DKV+ SR +   K+
Sbjct: 238 LEYGLIDKVMTSRTEATAKA 257


>gi|85704731|ref|ZP_01035832.1| Protease subunit of ATP-dependent Clp protease [Roseovarius sp.
           217]
 gi|85670549|gb|EAQ25409.1| Protease subunit of ATP-dependent Clp protease [Roseovarius sp.
           217]
          Length = 210

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 130/210 (61%), Positives = 176/210 (83%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D+++  LVPMVVEQT+RGER+YDI+SRLLKERI+F++G + D M++LI AQLL L
Sbjct: 1   MKDPMDIYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLSGPVHDGMSSLIVAQLLHL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GM
Sbjct: 61  EAENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVVGQAASMGSLLLTAGEPGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGG+ GQA+DI  HA++  K+K RLNEIYV++ G+T ++VE+ L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGYQGQATDIMIHARETQKLKDRLNEIYVRHTGQTLKKVEEALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           D+ MS  EA  WG++D+++ +R  ++E  K
Sbjct: 181 DNFMSPDEAKAWGLIDEIVANRDKVDEAKK 210


>gi|254485779|ref|ZP_05098984.1| Clp protease [Roseobacter sp. GAI101]
 gi|214042648|gb|EEB83286.1| Clp protease [Roseobacter sp. GAI101]
          Length = 215

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 174/209 (83%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             D  + ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F++G + D M++LI AQLL L
Sbjct: 1   MNDPYETYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLSGPVHDGMSSLIVAQLLHL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL AGEKGM
Sbjct: 61  EAENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLQAGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGG+ GQA+DI  HAQ+  K+K RLNEIYVK+ G++ E+VE  L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGYQGQATDIMIHAQETQKLKTRLNEIYVKHTGQSLEKVEAALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ MS  EA DWG++D+++ +R  +++ S
Sbjct: 181 DNFMSPEEAKDWGLIDEIVENRGKMDDPS 209


>gi|15800167|ref|NP_286179.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 EDL933]
 gi|15829745|ref|NP_308518.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. Sakai]
 gi|16128422|ref|NP_414971.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K-12 substr. MG1655]
 gi|26246448|ref|NP_752487.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           CFT073]
 gi|30061939|ref|NP_836110.1| ATP-dependent Clp protease proteolytic subunit [Shigella flexneri
           2a str. 2457T]
 gi|56479658|ref|NP_706331.2| ATP-dependent Clp protease proteolytic subunit [Shigella flexneri
           2a str. 301]
 gi|74311012|ref|YP_309431.1| ATP-dependent Clp protease proteolytic subunit [Shigella sonnei
           Ss046]
 gi|82542925|ref|YP_406872.1| ATP-dependent Clp protease proteolytic subunit [Shigella boydii
           Sb227]
 gi|82775656|ref|YP_402003.1| ATP-dependent Clp protease proteolytic subunit [Shigella
           dysenteriae Sd197]
 gi|89107307|ref|AP_001087.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K-12 substr. W3110]
 gi|91209511|ref|YP_539497.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           UTI89]
 gi|110640698|ref|YP_668426.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           536]
 gi|110804465|ref|YP_687985.1| ATP-dependent Clp protease proteolytic subunit [Shigella flexneri 5
           str. 8401]
 gi|117622697|ref|YP_851610.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           APEC O1]
 gi|157158299|ref|YP_001461624.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           E24377A]
 gi|157159964|ref|YP_001457282.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           HS]
 gi|168754541|ref|ZP_02779548.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4401]
 gi|168768391|ref|ZP_02793398.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4486]
 gi|168778128|ref|ZP_02803135.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4196]
 gi|168778929|ref|ZP_02803936.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4076]
 gi|168786287|ref|ZP_02811294.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC869]
 gi|170021190|ref|YP_001726144.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           ATCC 8739]
 gi|170080023|ref|YP_001729343.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K-12 substr. DH10B]
 gi|170683276|ref|YP_001742581.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           SMS-3-5]
 gi|187731303|ref|YP_001879148.1| ATP-dependent Clp protease proteolytic subunit [Shigella boydii CDC
           3083-94]
 gi|188492597|ref|ZP_02999867.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 53638]
 gi|191174674|ref|ZP_03036146.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli F11]
 gi|193064129|ref|ZP_03045213.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli E22]
 gi|195938496|ref|ZP_03083878.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. EC4024]
 gi|208809540|ref|ZP_03251877.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4206]
 gi|208815859|ref|ZP_03257038.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4045]
 gi|208822964|ref|ZP_03263282.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4042]
 gi|209917654|ref|YP_002291738.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           SE11]
 gi|215485518|ref|YP_002327949.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217326412|ref|ZP_03442496.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. TW14588]
 gi|218549895|ref|YP_002383686.1| ATP-dependent Clp protease proteolytic subunit [Escherichia
           fergusonii ATCC 35469]
 gi|218553004|ref|YP_002385917.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           IAI1]
 gi|218557347|ref|YP_002390260.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           S88]
 gi|218688301|ref|YP_002396513.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           ED1a]
 gi|218693900|ref|YP_002401567.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           55989]
 gi|218698651|ref|YP_002406280.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           IAI39]
 gi|218703721|ref|YP_002411240.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           UMN026]
 gi|227884552|ref|ZP_04002357.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           83972]
 gi|238899725|ref|YP_002925521.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli BW2952]
 gi|253774574|ref|YP_003037405.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160506|ref|YP_003043614.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli B
           str. REL606]
 gi|254791621|ref|YP_003076458.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. TW14359]
 gi|256020408|ref|ZP_05434273.1| ATP-dependent Clp protease proteolytic subunit [Shigella sp. D9]
 gi|256023945|ref|ZP_05437810.1| ATP-dependent Clp protease proteolytic subunit [Escherichia sp.
           4_1_40B]
 gi|260842638|ref|YP_003220416.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O103:H2 str. 12009]
 gi|260853660|ref|YP_003227551.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O26:H11 str. 11368]
 gi|260866598|ref|YP_003233000.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O111:H- str. 11128]
 gi|261223919|ref|ZP_05938200.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256367|ref|ZP_05948900.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281344|ref|YP_003498162.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O55:H7 str. CB9615]
 gi|293403558|ref|ZP_06647649.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           FVEC1412]
 gi|293408587|ref|ZP_06652426.1| Clp protease [Escherichia coli B354]
 gi|297516115|ref|ZP_06934501.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           OP50]
 gi|298379170|ref|ZP_06989051.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           FVEC1302]
 gi|300818231|ref|ZP_07098442.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 107-1]
 gi|300820317|ref|ZP_07100469.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 119-7]
 gi|300903295|ref|ZP_07121223.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 84-1]
 gi|300918180|ref|ZP_07134787.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 115-1]
 gi|300930260|ref|ZP_07145673.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 187-1]
 gi|300947910|ref|ZP_07162058.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 116-1]
 gi|301025667|ref|ZP_07189185.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 196-1]
 gi|301330696|ref|ZP_07223298.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 78-1]
 gi|306813096|ref|ZP_07447289.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           NC101]
 gi|307137081|ref|ZP_07496437.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           H736]
 gi|307312185|ref|ZP_07591821.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli W]
 gi|309794830|ref|ZP_07689251.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 145-7]
 gi|331640957|ref|ZP_08342092.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H736]
 gi|331645613|ref|ZP_08346717.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli M605]
 gi|331651375|ref|ZP_08352400.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli M718]
 gi|331656494|ref|ZP_08357456.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA206]
 gi|331661818|ref|ZP_08362741.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA143]
 gi|331666792|ref|ZP_08367666.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA271]
 gi|331671984|ref|ZP_08372780.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA280]
 gi|331676109|ref|ZP_08376821.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H591]
 gi|331681832|ref|ZP_08382465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H299]
 gi|62288033|sp|P0A6G7|CLPP_ECOLI RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Caseinolytic protease; AltName:
           Full=Endopeptidase Clp; AltName: Full=Heat shock protein
           F21.5; AltName: Full=Protease Ti; Flags: Precursor
 gi|62288034|sp|P0A6G8|CLPP_ECOL6 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|62288035|sp|P0A6G9|CLPP_ECO57 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|62288036|sp|P0A6H0|CLPP_SHIFL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90183183|sp|Q325G4|CLPP_SHIBS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90183184|sp|Q32JJ3|CLPP_SHIDS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|110816465|sp|Q3Z4W6|CLPP_SHISS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|116243134|sp|Q0TKK4|CLPP_ECOL5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|116243136|sp|Q1RF98|CLPP_ECOUT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp; Flags: Precursor
 gi|122957620|sp|Q0T7E6|CLPP_SHIF8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201821|sp|A1A8A6|CLPP_ECOK1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167008648|sp|A7ZIJ5|CLPP_ECO24 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167008649|sp|A7ZX95|CLPP_ECOHS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082457|sp|B1J011|CLPP_ECOLC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|310942734|pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942735|pdb|3MT6|S Chain S, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942736|pdb|3MT6|T Chain T, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942737|pdb|3MT6|U Chain U, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942738|pdb|3MT6|O Chain O, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942739|pdb|3MT6|P Chain P, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942740|pdb|3MT6|Q Chain Q, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942741|pdb|3MT6|Y Chain Y, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942742|pdb|3MT6|Z Chain Z, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942743|pdb|3MT6|AA Chain a, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942744|pdb|3MT6|BB Chain b, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942745|pdb|3MT6|V Chain V, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942746|pdb|3MT6|W Chain W, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942747|pdb|3MT6|X Chain X, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942748|pdb|3MT6|M Chain M, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942749|pdb|3MT6|L Chain L, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942750|pdb|3MT6|K Chain K, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942751|pdb|3MT6|J Chain J, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942752|pdb|3MT6|I Chain I, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942753|pdb|3MT6|H Chain H, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942754|pdb|3MT6|N Chain N, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942755|pdb|3MT6|F Chain F, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942756|pdb|3MT6|E Chain E, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942757|pdb|3MT6|D Chain D, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942758|pdb|3MT6|C Chain C, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942759|pdb|3MT6|B Chain B, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942760|pdb|3MT6|A Chain A, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|310942761|pdb|3MT6|G Chain G, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 gi|12513299|gb|AAG54787.1|AE005223_2 ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Escherichia coli O157:H7 str.
           EDL933]
 gi|26106846|gb|AAN79031.1|AE016756_214 ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           CFT073]
 gi|145556|gb|AAA23588.1| ATP-dependent protease (clpP) [Escherichia coli]
 gi|1773121|gb|AAB40193.1| ATP-dependent Clp proteinase [Escherichia coli]
 gi|1786641|gb|AAC73540.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K-12 substr. MG1655]
 gi|13359948|dbj|BAB33914.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli O157:H7 str. Sakai]
 gi|30040183|gb|AAP15916.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Shigella flexneri 2a str.
           2457T]
 gi|56383209|gb|AAN42038.2| ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Shigella flexneri 2a str. 301]
 gi|73854489|gb|AAZ87196.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease
           [Shigella sonnei Ss046]
 gi|81239804|gb|ABB60514.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease
           [Shigella dysenteriae Sd197]
 gi|81244336|gb|ABB65044.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease
           [Shigella boydii Sb227]
 gi|85674577|dbj|BAE76217.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K12 substr. W3110]
 gi|91071085|gb|ABE05966.1| ATP-dependent proteolytic subunit of clpA-ClpP serine protease,
           heat shock protein F21.5 [Escherichia coli UTI89]
 gi|110342290|gb|ABG68527.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           536]
 gi|110614013|gb|ABF02680.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease
           [Shigella flexneri 5 str. 8401]
 gi|115511821|gb|ABI99895.1| ATP-dependent proteolytic subunit of ClpA-ClpP serine protease
           [Escherichia coli APEC O1]
 gi|157065644|gb|ABV04899.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli HS]
 gi|157080329|gb|ABV20037.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli E24377A]
 gi|169756118|gb|ACA78817.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli ATCC 8739]
 gi|169887858|gb|ACB01565.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli str. K-12 substr. DH10B]
 gi|170520994|gb|ACB19172.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli SMS-3-5]
 gi|187428295|gb|ACD07569.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           boydii CDC 3083-94]
 gi|187766815|gb|EDU30659.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4196]
 gi|188487796|gb|EDU62899.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 53638]
 gi|189003087|gb|EDU72073.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4076]
 gi|189358046|gb|EDU76465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4401]
 gi|189362475|gb|EDU80894.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4486]
 gi|189373600|gb|EDU92016.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC869]
 gi|190905047|gb|EDV64714.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli F11]
 gi|192929158|gb|EDV82768.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli E22]
 gi|208729341|gb|EDZ78942.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4206]
 gi|208732507|gb|EDZ81195.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4045]
 gi|208737157|gb|EDZ84841.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. EC4042]
 gi|209743854|gb|ACI70234.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli]
 gi|209743856|gb|ACI70235.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli]
 gi|209743858|gb|ACI70236.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli]
 gi|209743860|gb|ACI70237.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli]
 gi|209743862|gb|ACI70238.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease ClpP
           [Escherichia coli]
 gi|209910913|dbj|BAG75987.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           SE11]
 gi|215263590|emb|CAS07920.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli O127:H6 str. E2348/69]
 gi|217322633|gb|EEC31057.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli O157:H7 str. TW14588]
 gi|218350632|emb|CAU96324.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli 55989]
 gi|218357436|emb|CAQ90075.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia fergusonii ATCC 35469]
 gi|218359772|emb|CAQ97313.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli IAI1]
 gi|218364116|emb|CAR01781.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli S88]
 gi|218368637|emb|CAR16376.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli IAI39]
 gi|218425865|emb|CAR06671.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli ED1a]
 gi|218430818|emb|CAR11692.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli UMN026]
 gi|222032232|emb|CAP74971.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           LF82]
 gi|227838638|gb|EEJ49104.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           83972]
 gi|238863325|gb|ACR65323.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli BW2952]
 gi|242376218|emb|CAQ30909.1| clpP, subunit of ClpP serine protease, ClpAP, ClpXP and ClpAXP
           [Escherichia coli BL21(DE3)]
 gi|253325618|gb|ACT30220.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972407|gb|ACT38078.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli B
           str. REL606]
 gi|253976617|gb|ACT42287.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           BL21(DE3)]
 gi|254591021|gb|ACT70382.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli O157:H7 str. TW14359]
 gi|257752309|dbj|BAI23811.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O26:H11 str. 11368]
 gi|257757785|dbj|BAI29282.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O103:H2 str. 12009]
 gi|257762954|dbj|BAI34449.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O111:H- str. 11128]
 gi|260450376|gb|ACX40798.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli DH1]
 gi|281177608|dbj|BAI53938.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           SE15]
 gi|281599777|gb|ADA72761.1| ATP-dependent Clp protease proteolytic subunit [Shigella flexneri
           2002017]
 gi|284920247|emb|CBG33306.1| ATP-dependent clp protease proteolytic subunit [Escherichia coli
           042]
 gi|290761217|gb|ADD55178.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O55:H7 str. CB9615]
 gi|291429411|gb|EFF02431.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           FVEC1412]
 gi|291471765|gb|EFF14248.1| Clp protease [Escherichia coli B354]
 gi|294492533|gb|ADE91289.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli IHE3034]
 gi|298280283|gb|EFI21787.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           FVEC1302]
 gi|299880021|gb|EFI88232.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 196-1]
 gi|300404590|gb|EFJ88128.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 84-1]
 gi|300414631|gb|EFJ97941.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 115-1]
 gi|300452510|gb|EFK16130.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 116-1]
 gi|300461832|gb|EFK25325.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 187-1]
 gi|300527102|gb|EFK48171.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 119-7]
 gi|300529122|gb|EFK50184.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 107-1]
 gi|300843357|gb|EFK71117.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 78-1]
 gi|305853859|gb|EFM54298.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           NC101]
 gi|306907687|gb|EFN38189.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli W]
 gi|307552344|gb|ADN45119.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           ABU 83972]
 gi|307628093|gb|ADN72397.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           UM146]
 gi|308121483|gb|EFO58745.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 145-7]
 gi|309700698|emb|CBI99994.1| ATP-dependent clp protease proteolytic subunit [Escherichia coli
           ETEC H10407]
 gi|312945015|gb|ADR25842.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|315059717|gb|ADT74044.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Escherichia coli W]
 gi|315135119|dbj|BAJ42278.1| conserved hypothetical protein [Escherichia coli DH1]
 gi|320173743|gb|EFW48926.1| ATP-dependent Clp protease proteolytic subunit [Shigella
           dysenteriae CDC 74-1112]
 gi|320178281|gb|EFW53255.1| ATP-dependent Clp protease proteolytic subunit [Shigella boydii
           ATCC 9905]
 gi|320186067|gb|EFW60812.1| ATP-dependent Clp protease proteolytic subunit [Shigella flexneri
           CDC 796-83]
 gi|320192853|gb|EFW67493.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. EC1212]
 gi|320197089|gb|EFW71708.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           WV_060327]
 gi|320201681|gb|EFW76257.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           EC4100B]
 gi|320638432|gb|EFX08146.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. G5101]
 gi|320643812|gb|EFX12935.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H- str. 493-89]
 gi|320649163|gb|EFX17741.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H- str. H 2687]
 gi|320656056|gb|EFX23972.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320661206|gb|EFX28637.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320665182|gb|EFX32275.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323379718|gb|ADX51986.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli KO11]
 gi|323938623|gb|EGB34872.1| Clp protease [Escherichia coli E1520]
 gi|323943244|gb|EGB39400.1| Clp protease [Escherichia coli E482]
 gi|323945342|gb|EGB41398.1| Clp protease [Escherichia coli H120]
 gi|323952951|gb|EGB48819.1| Clp protease [Escherichia coli H252]
 gi|323958630|gb|EGB54333.1| Clp protease [Escherichia coli H263]
 gi|323963427|gb|EGB58989.1| Clp protease [Escherichia coli H489]
 gi|323965124|gb|EGB60583.1| Clp protease [Escherichia coli M863]
 gi|323972291|gb|EGB67501.1| Clp protease [Escherichia coli TA007]
 gi|323976078|gb|EGB71171.1| Clp protease [Escherichia coli TW10509]
 gi|324114664|gb|EGC08632.1| Clp protease [Escherichia fergusonii B253]
 gi|324116925|gb|EGC10838.1| Clp protease [Escherichia coli E1167]
 gi|326341201|gb|EGD64993.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. 1044]
 gi|326346024|gb|EGD69763.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           O157:H7 str. 1125]
 gi|330910231|gb|EGH38741.1| ATP-dependent Clp protease proteolytic subunit [Escherichia coli
           AA86]
 gi|331037755|gb|EGI09975.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H736]
 gi|331045775|gb|EGI17901.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli M605]
 gi|331051116|gb|EGI23168.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli M718]
 gi|331054742|gb|EGI26751.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA206]
 gi|331060240|gb|EGI32204.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA143]
 gi|331066016|gb|EGI37900.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA271]
 gi|331070973|gb|EGI42332.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli TA280]
 gi|331076167|gb|EGI47449.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H591]
 gi|331081034|gb|EGI52199.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli H299]
          Length = 207

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHRN 207


>gi|325292625|ref|YP_004278489.1| ATP-dependent Clp protease, proteolytic subunit [Agrobacterium sp.
           H13-3]
 gi|325060478|gb|ADY64169.1| ATP-dependent Clp protease, proteolytic subunit [Agrobacterium sp.
           H13-3]
          Length = 210

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 159/205 (77%), Positives = 185/205 (90%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            K+  D  + LVPMVVEQTNRGERSYDI+SRLLKERI+F+TG +ED MA+L+CAQLLFLE
Sbjct: 1   MKNPVDTAMALVPMVVEQTNRGERSYDIFSRLLKERIIFLTGPVEDQMASLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVTAGMAIYDTMQFI+P +ST C+GQAASMGSLLL+AGEKGMR
Sbjct: 61  AENPKKEIALYINSPGGVVTAGMAIYDTMQFIRPAVSTLCVGQAASMGSLLLAAGEKGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+T EEVEKTLDRD
Sbjct: 121 FATPNARIMVHQPSGGFQGQASDIERHARDIIKMKRRLNEVYVKHTGRTLEEVEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIE 212
           H M A EA DWGV+DK+L SR ++E
Sbjct: 181 HFMDADEAKDWGVIDKILTSRQEME 205


>gi|330446593|ref|ZP_08310245.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490784|dbj|GAA04742.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 207

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 165/209 (78%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPILDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G KG R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK+RLN +  ++ G+  E +
Sbjct: 119 GGAKGKRYCLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQRLNGLLAEHTGQPLEII 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  DRD+ MSA +A ++G+VD VL  R 
Sbjct: 179 ERDTDRDNFMSADQAVEYGLVDAVLSKRD 207


>gi|238751006|ref|ZP_04612502.1| ATP-dependent Clp protease proteolytic subunit [Yersinia rohdei
           ATCC 43380]
 gi|238710696|gb|EEQ02918.1| ATP-dependent Clp protease proteolytic subunit [Yersinia rohdei
           ATCC 43380]
          Length = 207

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAHHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA +A ++G+VD V   R 
Sbjct: 179 ERDTERDRFLSAEQAVEYGLVDSVFTRRD 207


>gi|15888588|ref|NP_354269.1| ATP-dependent Clp protease proteolytic subunit [Agrobacterium
           tumefaciens str. C58]
 gi|21759066|sp|Q8UFY6|CLPP2_AGRT5 RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|15156306|gb|AAK87054.1| ATP-dependent Clp protease, proteolytic subunit [Agrobacterium
           tumefaciens str. C58]
          Length = 210

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 159/205 (77%), Positives = 185/205 (90%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            K+  D  + LVPMVVEQTNRGERSYDI+SRLLKERI+F+TG +ED MA+L+CAQLLFLE
Sbjct: 1   MKNPVDTAMALVPMVVEQTNRGERSYDIFSRLLKERIIFLTGPVEDQMASLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVTAGMAIYDTMQFI+P +ST C+GQAASMGSLLL+AGEKGMR
Sbjct: 61  AENPKKEIALYINSPGGVVTAGMAIYDTMQFIRPAVSTLCVGQAASMGSLLLAAGEKGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+T EEVEKTLDRD
Sbjct: 121 FATPNARIMVHQPSGGFQGQASDIERHARDIIKMKRRLNEVYVKHTGRTLEEVEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIE 212
           H M A EA DWGV+DK+L SR ++E
Sbjct: 181 HFMDADEAKDWGVIDKILTSRQEME 205


>gi|313887837|ref|ZP_07821517.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312846180|gb|EFR33561.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 194

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 121/193 (62%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLK+RI+F++G++ D MA LI AQLLFLEAE+P K+I
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKDRIIFLSGEVNDTMADLIVAQLLFLEAEDPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG AIYDTM +IKP +ST C+G AASMG+ LL++G KG RFALPN+ I
Sbjct: 61  QLYINSPGGSVSAGFAIYDTMNYIKPDVSTICIGMAASMGAFLLASGAKGKRFALPNSDI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+ +A+ I+KI+ +LNEI  +  G+  E++EK  DRD+ +++ EA
Sbjct: 121 MIHQPSGGAQGQASDIQINAEKILKIRHKLNEILAERTGQDLEKIEKDTDRDYWLNSQEA 180

Query: 196 CDWGVVDKVLMSR 208
            D+G++DKV+  R
Sbjct: 181 KDYGLIDKVIEKR 193


>gi|149201013|ref|ZP_01877988.1| Protease subunit of ATP-dependent Clp protease [Roseovarius sp.
           TM1035]
 gi|149145346|gb|EDM33372.1| Protease subunit of ATP-dependent Clp protease [Roseovarius sp.
           TM1035]
          Length = 210

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 131/210 (62%), Positives = 176/210 (83%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D+++  LVPMVVEQT+RGER+YDI+SRLLKERI+F++G + D M++LI AQLL L
Sbjct: 1   MKDPMDIYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLSGPVHDGMSSLIVAQLLHL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GM
Sbjct: 61  EAENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVVGQAASMGSLLLTAGEPGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGG+ GQA+DI  HA++  K+K RLNEIYVK+ G+T ++VE+ L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGYQGQATDIMIHARETQKLKDRLNEIYVKHTGQTLKKVEEALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           D+ MS  EA  WG++D+++ +R   +E +K
Sbjct: 181 DNFMSPEEAKAWGLIDEIVANRDKGDEAAK 210


>gi|146341127|ref|YP_001206175.1| ATP-dependent Clp protease proteolytic subunit [Bradyrhizobium sp.
           ORS278]
 gi|146193933|emb|CAL77950.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Bradyrhizobium sp. ORS278]
          Length = 210

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 136/203 (66%), Positives = 172/203 (84%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED MATLI AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMATLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI++YINSPGGVVT+G+AIYDTMQFI+P +ST C GQAASMGSLLL AG K MR
Sbjct: 61  AENPKKEIAMYINSPGGVVTSGLAIYDTMQFIRPAVSTLCTGQAASMGSLLLCAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+ Y+ +E  L+RD
Sbjct: 121 FSLPNSRIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQPYKAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRID 210
             ++A  A ++G++DKVL  R +
Sbjct: 181 KFLTAEAAQEFGLIDKVLDKRPE 203


>gi|225848210|ref|YP_002728373.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644423|gb|ACN99473.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 202

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 120/199 (60%), Positives = 160/199 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           + +   LVP+V+EQT RGER+YDIYSRLLK+RI+ +   I+DH+A LI AQLLFLEAE+P
Sbjct: 2   DKILNQLVPIVIEQTPRGERAYDIYSRLLKDRIILLGTPIDDHVANLIVAQLLFLEAEDP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I +YINSPGGVVTAG AIYDTM +IKP + T C+GQAASMG+ LLSAG KG R++LP
Sbjct: 62  EKDIYMYINSPGGVVTAGFAIYDTMNYIKPDVVTICIGQAASMGAFLLSAGAKGKRYSLP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           NARI++HQP GGF GQA+DIE HA++I+++KR LNE   K+ G+  E++E   +RD+ MS
Sbjct: 122 NARIMIHQPLGGFQGQATDIEIHAREILRLKRMLNEYLAKHTGQPIEKIEADTERDYFMS 181

Query: 192 ASEACDWGVVDKVLMSRID 210
           A EA ++G++DKV+  R +
Sbjct: 182 AEEAKEYGLIDKVIYKRGE 200


>gi|114777030|ref|ZP_01452050.1| ATP-dependent Clp protease proteolytic subunit [Mariprofundus
           ferrooxydans PV-1]
 gi|114552551|gb|EAU55011.1| ATP-dependent Clp protease proteolytic subunit [Mariprofundus
           ferrooxydans PV-1]
          Length = 207

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 119/195 (61%), Positives = 162/195 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP VVEQT+RGER+YDI+SRLLKERIVF+ GQ++DH A LI AQLLFLE+E P K+I
Sbjct: 1   MNLVPTVVEQTSRGERAYDIFSRLLKERIVFLNGQVDDHTANLIIAQLLFLESEGPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVT+G+AIYDTMQ+I+  +ST C+GQAASMG+ LL++G  G RF+LPN+RI
Sbjct: 61  YMYINSPGGVVTSGLAIYDTMQYIRCDVSTLCIGQAASMGAHLLASGAPGKRFSLPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+ +K RLNE+  K+ G+  E++   ++RD+ ++A +A
Sbjct: 121 MIHQPLGGFQGQATDIEIHAREILSLKNRLNEMMAKHTGQPIEKLADDVERDYFLTADQA 180

Query: 196 CDWGVVDKVLMSRID 210
           C++G+VDKVL SR +
Sbjct: 181 CEYGLVDKVLSSRAE 195


>gi|120610146|ref|YP_969824.1| ATP-dependent Clp protease proteolytic subunit [Acidovorax citrulli
           AAC00-1]
 gi|326316315|ref|YP_004233987.1| ATP-dependent Clp protease proteolytic subunit [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|166201794|sp|A1TM62|CLPP_ACIAC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|120588610|gb|ABM32050.1| ATP-dependent Clp protease proteolytic subunit ClpP [Acidovorax
           citrulli AAC00-1]
 gi|323373151|gb|ADX45420.1| ATP-dependent Clp protease proteolytic subunit [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 202

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 118/202 (58%), Positives = 156/202 (77%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
               E   LG++PMV+EQ+ RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFLE
Sbjct: 1   MSALETQALGMIPMVIEQSGRGERSYDIYSRLLKERIVFLIGEVNDQTANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+IS YINSPGG VTAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AG KG R
Sbjct: 61  SENPDKDISFYINSPGGSVTAGMAIYDTMQFIKPDVSTMCLGFAASMGAFLLAAGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN++I++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD
Sbjct: 121 FSLPNSKIMIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPLEKVKADTERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + ++A EA ++G+VD+V+  R 
Sbjct: 181 YFLTADEAKEYGLVDQVVTQRP 202


>gi|254507754|ref|ZP_05119885.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus 16]
 gi|219549279|gb|EED26273.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus 16]
          Length = 208

 Score =  248 bits (634), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 127/210 (60%), Positives = 166/210 (79%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPILDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ M+A +A ++G+VD VL  R +
Sbjct: 179 ERDTDRDNFMAAEQAVEYGLVDAVLSHRGE 208


>gi|153839648|ref|ZP_01992315.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AQ3810]
 gi|260902813|ref|ZP_05911208.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AQ4037]
 gi|149746838|gb|EDM57826.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AQ3810]
 gi|308108649|gb|EFO46189.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AQ4037]
 gi|328473326|gb|EGF44174.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           parahaemolyticus 10329]
          Length = 208

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 128/208 (61%), Positives = 164/208 (78%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +
Sbjct: 119 GGAAGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNNLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  DRD+ MSA +A ++G+VD VL  R
Sbjct: 179 ERDTDRDNFMSAEQAVEYGIVDAVLSHR 206


>gi|153835695|ref|ZP_01988362.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           harveyi HY01]
 gi|156973712|ref|YP_001444619.1| ATP-dependent Clp protease proteolytic subunit [Vibrio harveyi ATCC
           BAA-1116]
 gi|269961045|ref|ZP_06175414.1| ATP-dependent Clp protease proteolytic subunit [Vibrio harveyi
           1DA3]
 gi|226706635|sp|A7MV87|CLPP_VIBHB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|148867676|gb|EDL66952.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           harveyi HY01]
 gi|156525306|gb|ABU70392.1| hypothetical protein VIBHAR_01417 [Vibrio harveyi ATCC BAA-1116]
 gi|269834264|gb|EEZ88354.1| ATP-dependent Clp protease proteolytic subunit [Vibrio harveyi
           1DA3]
          Length = 208

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 128/210 (60%), Positives = 165/210 (78%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPIIDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNNLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ MSA +A ++G+VD VL  R +
Sbjct: 179 ERDTDRDNFMSADQAVEYGIVDAVLSHRGE 208


>gi|260776382|ref|ZP_05885277.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607605|gb|EEX33870.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 208

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 127/210 (60%), Positives = 166/210 (79%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPILDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ M+A +A ++G+VD VL  R +
Sbjct: 179 ERDTDRDNFMAADQAVEYGLVDAVLTHRGE 208


>gi|146310565|ref|YP_001175639.1| ATP-dependent Clp protease proteolytic subunit [Enterobacter sp.
           638]
 gi|145317441|gb|ABP59588.1| ATP-dependent Clp protease proteolytic subunit ClpP [Enterobacter
           sp. 638]
          Length = 207

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 174/209 (83%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYNG--ERDNIAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSILTHRN 207


>gi|224367556|ref|YP_002601719.1| ClpP1 [Desulfobacterium autotrophicum HRM2]
 gi|259585947|sp|C0QGT0|CLPP_DESAH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|223690272|gb|ACN13555.1| ClpP1 [Desulfobacterium autotrophicum HRM2]
          Length = 205

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 115/200 (57%), Positives = 162/200 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQ+NRGER+YDIYSRLLK+RI+F+   ++D +A LI AQLLFLE+E+P+K+I
Sbjct: 1   MPLIPMVVEQSNRGERAYDIYSRLLKDRIIFLGSAMDDEVANLIVAQLLFLESEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGGVVTAGMA+YDTMQ+IKP ++T C+GQAASMG+LLL+AG KG RF+LPN+RI
Sbjct: 61  NFYINSPGGVVTAGMAVYDTMQYIKPDVATVCIGQAASMGALLLAAGAKGKRFSLPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI+  A +I+++K  L+ I  K+ G+ ++++ +  DRD  MS  +A
Sbjct: 121 MIHQPLGGAQGQASDIKIQANEILRMKEVLSGILSKHTGQNFDKISEDTDRDFFMSGDQA 180

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
            ++G+VD V+ SR ++E+  
Sbjct: 181 KEYGLVDHVVASRDELEKAE 200


>gi|91228617|ref|ZP_01262535.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           alginolyticus 12G01]
 gi|254229904|ref|ZP_04923307.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio sp.
           Ex25]
 gi|262394815|ref|YP_003286669.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. Ex25]
 gi|269965580|ref|ZP_06179694.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           alginolyticus 40B]
 gi|91187849|gb|EAS74163.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           alginolyticus 12G01]
 gi|151937540|gb|EDN56395.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio sp.
           Ex25]
 gi|262338409|gb|ACY52204.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sp. Ex25]
 gi|269829805|gb|EEZ84040.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           alginolyticus 40B]
          Length = 208

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 127/210 (60%), Positives = 166/210 (79%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ MS+ +A ++G+VD VL  R +
Sbjct: 179 ERDTDRDNFMSSEQAVEYGIVDAVLSHRGE 208


>gi|332141945|ref|YP_004427683.1| ATP-dependent Clp protease proteolytic subunit [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327551967|gb|AEA98685.1| ATP-dependent Clp protease proteolytic subunit [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 209

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 164/209 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
                 D    LVPMVVEQT++GERSYDIYSRLLKE ++F+ GQ+EDHMA LI AQ+LFL
Sbjct: 1   MTNTPFDPMNALVPMVVEQTSKGERSYDIYSRLLKENVIFLVGQVEDHMANLIVAQMLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+K+I LYINSPGG VTAGMAIYDTM+FIKP +ST CMGQAASMG+ LLSAG KG 
Sbjct: 61  EAENPEKDIFLYINSPGGSVTAGMAIYDTMRFIKPDVSTVCMGQAASMGAFLLSAGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ LPN+R+++HQP GGF GQASD E HA++I+ IK +LN +   + G+ YE+V +  DR
Sbjct: 121 RYCLPNSRVMIHQPLGGFQGQASDFEIHAKEILSIKEKLNRLLADHTGQDYEKVARDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ +SA+EA ++G+VD+VL +R D+    
Sbjct: 181 DNFLSATEAKEYGLVDQVLANRSDVAATK 209


>gi|326626794|gb|EGE33137.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 246

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 171/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G    D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 40  MSYSGEL--DNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 97

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 98  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 157

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 158 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 217

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 218 ERDTERDRFLSAPEAVEYGLVDSILTHRN 246


>gi|158522703|ref|YP_001530573.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfococcus
           oleovorans Hxd3]
 gi|259585950|sp|A8ZXB7|CLPP_DESOH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|158511529|gb|ABW68496.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfococcus
           oleovorans Hxd3]
          Length = 205

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 114/201 (56%), Positives = 154/201 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMV+EQT+RGER++DIYSRLLK+RIVF+   I+D  A L+ AQLLFLE+E+P K+I
Sbjct: 1   MPLIPMVIEQTSRGERAFDIYSRLLKDRIVFIGSAIDDETANLLIAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGG V+AGMAIYDTMQ+IK  I+T C+G AASMG+ LL+AG KG RF+LPN+RI
Sbjct: 61  NFYINSPGGKVSAGMAIYDTMQYIKSDIATVCIGHAASMGAFLLAAGAKGKRFSLPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI   A++I+++K  LN+I   + GK  E+++   DRD  MS  EA
Sbjct: 121 MIHQPMGGAQGQASDIAIQAKEILRMKDILNQILAHHTGKPLEQIQVDTDRDFFMSGEEA 180

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
             +G+VD V+  R D+++  K
Sbjct: 181 KAYGIVDHVITDRSDLDKLEK 201


>gi|170767754|ref|ZP_02902207.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           albertii TW07627]
 gi|170123242|gb|EDS92173.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           albertii TW07627]
          Length = 207

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHRN 207


>gi|49474139|ref|YP_032181.1| ATP-dependent Clp protease proteolytic subunit [Bartonella quintana
           str. Toulouse]
 gi|67460275|sp|Q6G178|CLPP_BARQU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|49239643|emb|CAF26003.1| ATP-dependent clp protease proteolytic subunit [Bartonella quintana
           str. Toulouse]
          Length = 210

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 150/209 (71%), Positives = 179/209 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             +     L LVPMV+EQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLE
Sbjct: 1   MSNPMKTALSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDSMAMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEISLYINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG KG R
Sbjct: 61  AENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYV++ G+ YE +E+TLDRD
Sbjct: 121 FTLPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQDYEVIERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA  +G+VD V+  R + E++ K
Sbjct: 181 HFMTAEEAKQFGLVDDVIQYRAETEKEEK 209


>gi|157962502|ref|YP_001502536.1| ATP-dependent Clp protease proteolytic subunit [Shewanella pealeana
           ATCC 700345]
 gi|189082466|sp|A8H614|CLPP_SHEPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|157847502|gb|ABV88001.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           pealeana ATCC 700345]
          Length = 203

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 126/202 (62%), Positives = 159/202 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             K  E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFL
Sbjct: 1   MHKAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G +G 
Sbjct: 61  ESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNTMLAEHTGQPLEVIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MSA+EA ++G+VD V+  R
Sbjct: 181 DNFMSATEAAEYGLVDSVIAKR 202


>gi|212636027|ref|YP_002312552.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           piezotolerans WP3]
 gi|226706473|sp|B8CRF7|CLPP_SHEPW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|212557511|gb|ACJ29965.1| Peptidase S14, ClpP [Shewanella piezotolerans WP3]
          Length = 203

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 127/202 (62%), Positives = 158/202 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             K  E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFL
Sbjct: 1   MHKAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G +G 
Sbjct: 61  ESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNTMLAEHTGQPIEVIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MSA EA ++G+VD VL  R
Sbjct: 181 DNFMSADEAAEYGLVDSVLAKR 202


>gi|159043937|ref|YP_001532731.1| ATP-dependent Clp protease proteolytic subunit [Dinoroseobacter
           shibae DFL 12]
 gi|189082456|sp|A8LJA8|CLPP_DINSH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|157911697|gb|ABV93130.1| endopeptidase Clp [Dinoroseobacter shibae DFL 12]
          Length = 208

 Score =  248 bits (633), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 172/209 (82%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D  D ++ LVPMVVEQT+RGER+YDI+SRLLKERIVFV G + D M+ L+ AQLL LE
Sbjct: 1   MHDPVDTYMNLVPMVVEQTSRGERAYDIFSRLLKERIVFVNGPVHDGMSQLVVAQLLHLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGEKGMR
Sbjct: 61  AENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVVGQAASMGSLLLTAGEKGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPSGG+ GQA+DI  HAQ+  K+K RLN+IYVK+ G+  ++V   L+RD
Sbjct: 121 FSLPNSRIMVHQPSGGYQGQATDIMIHAQETQKLKDRLNQIYVKHTGQPLKKVVDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           + M A +A +WG++D+++ SR + E+ SK
Sbjct: 181 NFMDAEQAKEWGLIDEIVESRAN-EDTSK 208


>gi|167624686|ref|YP_001674980.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           halifaxensis HAW-EB4]
 gi|189082465|sp|B0TLU9|CLPP_SHEHH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167354708|gb|ABZ77321.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           halifaxensis HAW-EB4]
          Length = 203

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 126/203 (62%), Positives = 159/203 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             K  E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFL
Sbjct: 1   MHKAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G +G 
Sbjct: 61  ESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNTMLAEHTGQPLEVIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRI 209
           D+ MSA+EA ++G+VD V+  R 
Sbjct: 181 DNFMSATEAAEYGLVDSVIAKRS 203


>gi|23501987|ref|NP_698114.1| ATP-dependent Clp protease proteolytic subunit [Brucella suis 1330]
 gi|38257636|sp|Q8G0I4|CLPP_BRUSU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|23347937|gb|AAN30029.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Brucella suis
           1330]
          Length = 209

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 148/209 (70%), Positives = 182/209 (87%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLE
Sbjct: 1   MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R
Sbjct: 61  AENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           +ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRD
Sbjct: 121 YALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA ++G++DKV+  R    ++SK
Sbjct: 181 HFMTAQEALEFGLIDKVVEVRDVSADESK 209


>gi|251790648|ref|YP_003005369.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dickeya zeae
           Ech1591]
 gi|247539269|gb|ACT07890.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dickeya zeae
           Ech1591]
          Length = 207

 Score =  248 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 134/209 (64%), Positives = 172/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--EQEKLAPHMALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G+  E +
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKARMNELMAKHTGQPLEMI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA+EA D+G+VD VL  R 
Sbjct: 179 ERDTERDRFLSAAEAVDYGLVDSVLTHRE 207


>gi|15641924|ref|NP_231556.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|147674197|ref|YP_001217455.1| ATP-dependent Clp protease proteolytic subunit [Vibrio cholerae
           O395]
 gi|153824129|ref|ZP_01976796.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae B33]
 gi|153826398|ref|ZP_01979065.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae MZO-2]
 gi|227082052|ref|YP_002810603.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae M66-2]
 gi|254286858|ref|ZP_04961810.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae AM-19226]
 gi|18203199|sp|Q9KQS6|CLPP_VIBCH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|172047646|sp|A5F6X0|CLPP_VIBC3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763808|sp|C3LNM6|CLPP_VIBCM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|9656458|gb|AAF95070.1| ATP-dependent Clp protease, proteolytic subunit [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|126518348|gb|EAZ75571.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae B33]
 gi|146316080|gb|ABQ20619.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae O395]
 gi|149739876|gb|EDM54067.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae MZO-2]
 gi|150423008|gb|EDN14957.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae AM-19226]
 gi|227009940|gb|ACP06152.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae M66-2]
 gi|227013820|gb|ACP10030.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae O395]
          Length = 200

 Score =  248 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 126/199 (63%), Positives = 160/199 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
             +F  LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP
Sbjct: 2   SPIFDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LP
Sbjct: 62  DKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDI+ HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ MS
Sbjct: 122 NSRVMIHQPLGGFQGQASDIQIHAQEILTIKNKLNRLLAEHTGQPIEVIERDTDRDNFMS 181

Query: 192 ASEACDWGVVDKVLMSRID 210
           A +A ++G+VD VL  R +
Sbjct: 182 ADQAVEYGLVDAVLKHRGE 200


>gi|49475380|ref|YP_033421.1| ATP-dependent Clp protease proteolytic subunit [Bartonella henselae
           str. Houston-1]
 gi|67460276|sp|Q6G3Z3|CLPP_BARHE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|49238186|emb|CAF27396.1| ATP-dependent clp protease proteolytic subunit [Bartonella henselae
           str. Houston-1]
          Length = 210

 Score =  248 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 149/209 (71%), Positives = 179/209 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D     L LVPMV+EQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLE
Sbjct: 1   MSDPIKTALSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDGMAMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEISLYINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG KG R
Sbjct: 61  AENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPNARI++HQPSGGF GQASDIERHAQDI+K+K+RLNEIYV++ G+ Y+ +E+TLDRD
Sbjct: 121 FTLPNARIMVHQPSGGFQGQASDIERHAQDIIKMKQRLNEIYVQHTGQNYDVIERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA  +G+VD V+  R + E++ K
Sbjct: 181 HFMTAEEAKQFGLVDDVIQYRAETEKEEK 209


>gi|114567171|ref|YP_754325.1| ATP-dependent Clp protease proteolytic subunit [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|122317850|sp|Q0AWF0|CLPP_SYNWW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|114338106|gb|ABI68954.1| ATP-dependent Clp protease proteolytic subunit ClpP [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
          Length = 200

 Score =  248 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 118/200 (59%), Positives = 157/200 (78%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQTNRGERSYDIYSRLLK+RI+F+   I+D +A L+ AQLLFLEAE+P K+
Sbjct: 1   MSYLVPMVVEQTNRGERSYDIYSRLLKDRIIFLGSGIDDTVANLVIAQLLFLEAEDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           ISLYINSPGG +TAGMAIYDT+Q+I+P +ST C+G AASMG+ LL+AG+KG R+ALPNA 
Sbjct: 61  ISLYINSPGGSITAGMAIYDTLQYIRPDVSTICVGLAASMGAFLLAAGKKGKRYALPNAE 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP+GG  GQA+DIE HA+ I+ +K  LN+I  +  G+  E ++K  DRD+ M+A E
Sbjct: 121 IMIHQPAGGTQGQATDIEIHARRIMNMKESLNKILAERTGQPLERIQKDTDRDYFMTAQE 180

Query: 195 ACDWGVVDKVLMSRIDIEEK 214
           A ++G++D+V+       +K
Sbjct: 181 AKEYGIIDEVISHPKKTSKK 200


>gi|237745591|ref|ZP_04576071.1| ATP-dependent Clp protease [Oxalobacter formigenes HOxBLS]
 gi|229376942|gb|EEO27033.1| ATP-dependent Clp protease [Oxalobacter formigenes HOxBLS]
          Length = 207

 Score =  248 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 121/198 (61%), Positives = 160/198 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           +   LG++PMV+EQ+ RGER++DIYSRLLKERI+F+ G + D  A LI AQLLFLE+ENP
Sbjct: 10  DTSMLGMIPMVIEQSGRGERAFDIYSRLLKERIIFLVGPVTDQNANLIVAQLLFLESENP 69

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+ISLYINSPGG V+AGMAIYDTMQFI+P +ST C G AASMG+ LL+AG KG RF+LP
Sbjct: 70  EKDISLYINSPGGSVSAGMAIYDTMQFIRPQVSTLCTGLAASMGAFLLAAGAKGKRFSLP 129

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+RI++HQPSGG  GQA+DIE HA++I+ ++ RLN I  +N GK  E++ +  +RD+ MS
Sbjct: 130 NSRIMIHQPSGGAQGQATDIEIHAREILYLRERLNGILAENTGKPVEQIARDTERDNFMS 189

Query: 192 ASEACDWGVVDKVLMSRI 209
           A+EA D+G++D+VL  R 
Sbjct: 190 AAEAKDYGLIDEVLTRRN 207


>gi|260773194|ref|ZP_05882110.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           metschnikovii CIP 69.14]
 gi|260612333|gb|EEX37536.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           metschnikovii CIP 69.14]
          Length = 208

 Score =  248 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 125/210 (59%), Positives = 164/210 (78%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLK+R++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPIIDALVPMVVEQTSRGERSYDIYSRLLKDRVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTLCVGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK +LN +  ++ G+  + +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILSIKNKLNTLLAEHTGQPLDVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ MSA +A D+G+VD +L  R +
Sbjct: 179 ERDTDRDNFMSAQQAVDYGIVDAILTHRGE 208


>gi|260222837|emb|CBA32804.1| ATP-dependent Clp protease proteolytic subunit [Curvibacter
           putative symbiont of Hydra magnipapillata]
          Length = 220

 Score =  248 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 116/209 (55%), Positives = 159/209 (76%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M+ +       E   LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ 
Sbjct: 12  MNVKYGMSGAMETQALGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDQTANLVV 71

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+IS YINSPGG V+AGMAIYDTM FIKP +ST C G AASMG+ LL+
Sbjct: 72  AQLLFLESENPDKDISFYINSPGGSVSAGMAIYDTMNFIKPDVSTLCTGMAASMGAFLLA 131

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF+LPN+++++HQP GG  GQA++IE HA++I+K + +LN+I  +  G+  E++
Sbjct: 132 AGAKGKRFSLPNSKVMIHQPLGGTQGQATEIEIHAREILKTREQLNKILAERTGQPLEKI 191

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD+ +SA EA ++G+VD+V+  R 
Sbjct: 192 ERDTERDYYLSADEAKEYGLVDQVIAKRP 220


>gi|254361750|ref|ZP_04977885.1| S14 family endopeptidase ClpP [Mannheimia haemolytica PHL213]
 gi|153093285|gb|EDN74281.1| S14 family endopeptidase ClpP [Mannheimia haemolytica PHL213]
          Length = 197

 Score =  248 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 125/196 (63%), Positives = 162/196 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT++GERSYDIYSRLLKERI+F+ GQ+ED+MA LI AQLLFLEAE+P+K+I
Sbjct: 1   MALVPMVVEQTSKGERSYDIYSRLLKERIIFLNGQVEDNMANLIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQAASMG+ LLSAG KG RFALP+ARI
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQAASMGAFLLSAGAKGKRFALPHARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  A++I+++K  L     ++ G++YE+V    +RD+ MSA EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAEEILRLKATLTRRMAEHSGQSYEKVLADTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G++DKVL SR ++
Sbjct: 181 AEYGLIDKVLTSRSEV 196


>gi|31340017|sp|Q8DG26|CLPP_VIBVU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|60389705|sp|Q7MMG7|CLPP_VIBVY RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 200

 Score =  248 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 125/193 (64%), Positives = 158/193 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 7   ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 66

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LPN+R++
Sbjct: 67  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLPNSRVM 126

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HAQ+I+ IK +LN++  ++ G+  E +E+  DRD+ MSA +A 
Sbjct: 127 IHQPLGGFQGQASDIQIHAQEILTIKTKLNKLLAEHTGQPLEVIERDTDRDNFMSADQAV 186

Query: 197 DWGVVDKVLMSRI 209
           ++G+VD VL  R 
Sbjct: 187 EYGLVDAVLTHRS 199


>gi|194595677|gb|ACF77120.1| ATP-dependent Clp protease proteolytic subunit [Azospirillum
           brasilense]
          Length = 210

 Score =  248 bits (632), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 126/200 (63%), Positives = 164/200 (82%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D E     LVPMV+EQTNRGER+YDIYSRLLKERI+F+ G + D +A+LIC+QLLFLE+E
Sbjct: 3   DFEPKMNALVPMVIEQTNRGERAYDIYSRLLKERIIFLIGGVNDAVASLICSQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I+LYINSPGG V+AG+AIYDTMQ+I+P +ST CMGQAASMGSLLL+AG  G RF+
Sbjct: 63  NPSKDIALYINSPGGYVSAGLAIYDTMQYIRPQVSTVCMGQAASMGSLLLAAGAPGKRFS 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+RI++HQPSGG  GQASDIE  AQ+I+K++ RLN+IYVK+ G++ + +E  ++RD  
Sbjct: 123 LPNSRIMIHQPSGGAQGQASDIEIQAQEILKLRSRLNDIYVKHTGQSLDTIEAAMERDKF 182

Query: 190 MSASEACDWGVVDKVLMSRI 209
           MS  EA  +G++D+V+  R 
Sbjct: 183 MSPEEAKAFGLIDEVVEKRP 202


>gi|325294216|ref|YP_004280730.1| ATP-dependent Clp protease proteolytic subunit [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064664|gb|ADY72671.1| ATP-dependent Clp protease proteolytic subunit [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 200

 Score =  248 bits (632), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 123/199 (61%), Positives = 164/199 (82%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E++    VP+V+EQT RGER+YDIYSRLLK+RI+ +   I+DH+A LI AQLLFLEAE+P
Sbjct: 2   EEILNQFVPIVIEQTGRGERAYDIYSRLLKDRIIMLGTPIDDHVANLIVAQLLFLEAEDP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I LYINSPGGVVTAG+AIYDTMQ+IKP + T C+GQAASMG++LL+AG KG RFALP
Sbjct: 62  EKDIYLYINSPGGVVTAGLAIYDTMQYIKPDVVTICLGQAASMGAVLLAAGAKGKRFALP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           +ARI++HQP GGF GQA+DIE HA++I+++K+ LNEI  K+ G++  ++EK  +RD+ MS
Sbjct: 122 HARIMIHQPLGGFQGQATDIEIHAKEILRLKKMLNEILSKHTGQSLRKIEKDTERDYFMS 181

Query: 192 ASEACDWGVVDKVLMSRID 210
           A EA  +G++DKVL  R +
Sbjct: 182 AEEAQKYGLIDKVLTRRGE 200


>gi|261253459|ref|ZP_05946032.1| ATP-dependent Clp protease proteolytic subunit [Vibrio orientalis
           CIP 102891]
 gi|260936850|gb|EEX92839.1| ATP-dependent Clp protease proteolytic subunit [Vibrio orientalis
           CIP 102891]
          Length = 208

 Score =  248 bits (632), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 127/210 (60%), Positives = 166/210 (79%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNTMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ M+A +A ++G+VD VL  R +
Sbjct: 179 ERDTDRDNFMAADQAVEYGLVDAVLTHRGE 208


>gi|54309798|ref|YP_130818.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium
           profundum SS9]
 gi|46914236|emb|CAG21016.1| putative gi|27363512|ref|NP_759040.1| ATP-dependent Clp protease,
           proteolytic subunit [Vibrio vulnificus CMCP6]
           [Photobacterium profundum SS9]
          Length = 207

 Score =  248 bits (632), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 163/209 (77%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   +     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--ERNAMSPITDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+ IK RLN +  K+ G+  E V
Sbjct: 119 GGAKGKRYCLPNSRVMIHQPLGGFQGQASDIQIHAKEILTIKHRLNSLLAKHTGQPLEVV 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E   DRD+ MSA +A ++G+VD VL  R 
Sbjct: 179 EGDTDRDNFMSADQAVEYGLVDSVLTQRD 207


>gi|271499597|ref|YP_003332622.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dickeya
           dadantii Ech586]
 gi|270343152|gb|ACZ75917.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dickeya
           dadantii Ech586]
          Length = 207

 Score =  248 bits (632), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+ED+MA LI 
Sbjct: 1   MSYSG--EQEKLAPHMALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDYMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G++ + +
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKARMNELMAKHTGQSLDVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA+EA ++G+VD VL  R 
Sbjct: 179 ERDTERDRFLSAAEAVEYGLVDSVLTHRE 207


>gi|323498276|ref|ZP_08103278.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sinaloensis
           DSM 21326]
 gi|323316704|gb|EGA69713.1| ATP-dependent Clp protease proteolytic subunit [Vibrio sinaloensis
           DSM 21326]
          Length = 208

 Score =  248 bits (632), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 127/210 (60%), Positives = 166/210 (79%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPILDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN++  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNKLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ M+A +A ++G+VD VL  R +
Sbjct: 179 ERDTDRDNFMAADQAVEYGLVDAVLSHRGE 208


>gi|119384010|ref|YP_915066.1| endopeptidase Clp [Paracoccus denitrificans PD1222]
 gi|119373777|gb|ABL69370.1| ATP-dependent Clp protease proteolytic subunit ClpP [Paracoccus
           denitrificans PD1222]
          Length = 209

 Score =  247 bits (631), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 133/209 (63%), Positives = 173/209 (82%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  + ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F++G + D MATLI AQLLFL
Sbjct: 1   MQDPAEFYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLSGPVHDGMATLISAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP K+IS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL AG+ G 
Sbjct: 61  EAENPTKDISMYINSPGGVVTSGLSIYDTMQYIKPRVSTLVVGQAASMGSLLLCAGQPGQ 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGGF GQA+DI  HA++  K+KRRLNEIYVK+ G+T EEVE+ L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGFQGQATDILIHARETEKLKRRLNEIYVKHTGRTLEEVEQALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D  MS  EA +WG++D++L++R   E   
Sbjct: 181 DRFMSPEEAKEWGLIDEILVARGKAEPDK 209


>gi|163759316|ref|ZP_02166402.1| ATP-dependent Clp protease proteolytic subunit [Hoeflea
           phototrophica DFL-43]
 gi|162283720|gb|EDQ34005.1| ATP-dependent Clp protease proteolytic subunit [Hoeflea
           phototrophica DFL-43]
          Length = 210

 Score =  247 bits (631), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 157/209 (75%), Positives = 184/209 (88%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             +  D  + LVPMVVEQTNRGERSYDI+SRLLKERI+F+TG +EDHMATL+CAQLLFLE
Sbjct: 1   MTNPVDTAMALVPMVVEQTNRGERSYDIFSRLLKERIIFITGPVEDHMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP IST C+GQAASMGSLLL AGEKGMR
Sbjct: 61  AENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAISTLCVGQAASMGSLLLCAGEKGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNAR+++HQPSGGF GQASDIERHAQDI+K+KRRLNE+YVK+ G+ YE VEKTLDRD
Sbjct: 121 FATPNARVMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEVYVKHTGQDYETVEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA ++G++D+V   R +IE  ++
Sbjct: 181 HFMTAEEALEFGLIDRVFDKRENIEAPAE 209


>gi|317492909|ref|ZP_07951333.1| Clp protease [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919031|gb|EFV40366.1| Clp protease [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 206

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 133/208 (63%), Positives = 168/208 (80%), Gaps = 3/208 (1%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G          + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSGERDLAP---HMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIV 57

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 58  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 117

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ GK  EE+
Sbjct: 118 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKARMNELMAKHSGKPLEEI 177

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  +SA EA ++G+VD V+  R
Sbjct: 178 ERDTERDRFLSADEAVEYGLVDSVMTHR 205


>gi|311280666|ref|YP_003942897.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Enterobacter
           cloacae SCF1]
 gi|308749861|gb|ADO49613.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Enterobacter
           cloacae SCF1]
          Length = 207

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 128/209 (61%), Positives = 172/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G++  ++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQSLAQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E   +RD  +SA EA ++G+VD +L  R 
Sbjct: 179 ESDTERDRFLSAPEAVEYGLVDSILTHRK 207


>gi|91793847|ref|YP_563498.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           denitrificans OS217]
 gi|123356647|sp|Q12LA1|CLPP_SHEDO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|91715849|gb|ABE55775.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella
           denitrificans OS217]
          Length = 203

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 128/203 (63%), Positives = 161/203 (79%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             K  E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFL
Sbjct: 1   MHKAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G KG 
Sbjct: 61  ESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++  ++ G+  E +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNQMLAEHTGQPLEVIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRI 209
           D+ MSA++A D+G+VD +L SR 
Sbjct: 181 DNFMSATQAMDYGLVDSLLTSRS 203


>gi|121605848|ref|YP_983177.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Polaromonas
           naphthalenivorans CJ2]
 gi|120594817|gb|ABM38256.1| ATP-dependent Clp protease proteolytic subunit ClpP [Polaromonas
           naphthalenivorans CJ2]
          Length = 216

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 125/207 (60%), Positives = 158/207 (76%)

Query: 3   FEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQ 62
           +        E   LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ AQ
Sbjct: 10  YNSPQAASQEIQGLGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDQTANLVVAQ 69

Query: 63  LLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAG 122
           LLFLE+ENP K+IS YINSPGG VTAGMAIYDTMQFIKP +ST C+G AASMG+ LLS+G
Sbjct: 70  LLFLESENPDKDISFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCVGMAASMGAFLLSSG 129

Query: 123 EKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK 182
            KG RF+LPN+R+++HQPSGG  GQASDIE HA+DI+K + +LN I   N G+T E++E+
Sbjct: 130 TKGKRFSLPNSRVMIHQPSGGAQGQASDIEIHARDILKTRDQLNRILAHNTGQTVEKIER 189

Query: 183 TLDRDHIMSASEACDWGVVDKVLMSRI 209
             +RD+ M A EA  +GVVD+V+  R 
Sbjct: 190 DTERDYFMFADEAKAYGVVDQVISKRP 216


>gi|319405542|emb|CBI79161.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella sp. AR
           15-3]
          Length = 210

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 148/209 (70%), Positives = 180/209 (86%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D     L LVPMV+EQTNRGER+YDI+SRLLKERI+F+ G +ED+MA L+CAQLLFLE
Sbjct: 1   MRDPTKKVLSLVPMVIEQTNRGERAYDIFSRLLKERIIFINGPVEDNMAMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGG+VT+GMAIYDTMQFI+P +ST CMGQAASMGSLLL+AG  G R
Sbjct: 61  AENPKKEINLYINSPGGMVTSGMAIYDTMQFIRPSVSTLCMGQAASMGSLLLTAGAAGRR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYV++ G+ YE +EKTLDRD
Sbjct: 121 FALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQNYEVIEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA  +G++D V+  R + E++ K
Sbjct: 181 HFMTAEEAKQFGLIDDVIQYRAETEKEEK 209


>gi|293392545|ref|ZP_06636865.1| ATP-dependent Clp protease proteolytic subunit [Serratia odorifera
           DSM 4582]
 gi|291424947|gb|EFE98156.1| ATP-dependent Clp protease proteolytic subunit [Serratia odorifera
           DSM 4582]
          Length = 207

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 172/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--EQDQFAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAE+P+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAESPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G++ E++
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           ++  +RD  M+A E+ ++G+VD +L  R 
Sbjct: 179 DRDTERDRFMTAEESVEYGLVDGILTHRS 207


>gi|119774361|ref|YP_927101.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           amazonensis SB2B]
 gi|171704645|sp|A1S4X5|CLPP_SHEAM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|119766861|gb|ABL99431.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella
           amazonensis SB2B]
          Length = 202

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 130/202 (64%), Positives = 161/202 (79%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
                E VF  LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFL
Sbjct: 1   MHNAPESVFNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP KEI LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQA SMG+ LL+ GEKGM
Sbjct: 61  ESENPDKEIYLYINSPGGSVTAGMAIYDTMQFIKPKVSTVCIGQACSMGAFLLAGGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++   + G+  E +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNQMLSHHTGQPMEVIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MSA++A ++G++D VL SR
Sbjct: 181 DNFMSATQAVEYGLIDSVLTSR 202


>gi|60389653|sp|Q6LNW0|CLPP_PHOPR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 199

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 128/193 (66%), Positives = 157/193 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP K+I 
Sbjct: 7   ALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENPDKDIF 66

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG R+ LPN+R++
Sbjct: 67  LYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAKGKRYCLPNSRVM 126

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDI+ HA++I+ IK RLN +  K+ G+  E VE   DRD+ MSA +A 
Sbjct: 127 IHQPLGGFQGQASDIQIHAKEILTIKHRLNSLLAKHTGQPLEVVEGDTDRDNFMSADQAV 186

Query: 197 DWGVVDKVLMSRI 209
           ++G+VD VL  R 
Sbjct: 187 EYGLVDSVLTQRD 199


>gi|238764860|ref|ZP_04625801.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           kristensenii ATCC 33638]
 gi|238696967|gb|EEP89743.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           kristensenii ATCC 33638]
          Length = 207

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 170/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAREILKVKSRMNELMALHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA +A ++G+VD V   R 
Sbjct: 179 ERDTERDRFLSAEQAVEYGLVDSVFTRRD 207


>gi|261494048|ref|ZP_05990551.1| S14 family endopeptidase ClpP [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496191|ref|ZP_05992597.1| S14 family endopeptidase ClpP [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261308143|gb|EEY09440.1| S14 family endopeptidase ClpP [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310214|gb|EEY11414.1| S14 family endopeptidase ClpP [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 197

 Score =  247 bits (631), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 125/196 (63%), Positives = 162/196 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT++GERSYDIYSRLLKERI+F+ GQ+ED+MA LI AQLLFLEAE+P+K+I
Sbjct: 1   MALVPMVVEQTSKGERSYDIYSRLLKERIIFLNGQVEDNMANLIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQAASMG+ LLSAG KG RFALP+ARI
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQAASMGAFLLSAGAKGKRFALPHARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  A++I+++K  L     ++ G++YE+V    +RD+ MSA EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAEEILRLKATLTHRMAEHSGQSYEKVLADTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G++DKVL SR ++
Sbjct: 181 AEYGLIDKVLTSRSEV 196


>gi|319789118|ref|YP_004150751.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermovibrio
           ammonificans HB-1]
 gi|317113620|gb|ADU96110.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermovibrio
           ammonificans HB-1]
          Length = 200

 Score =  247 bits (631), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 126/197 (63%), Positives = 163/197 (82%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E++    VP+V+EQT RGER+YDIYSRLLK+RIV +   I+DH+A LI AQLLFLEAE+P
Sbjct: 2   EEILNQFVPIVIEQTGRGERAYDIYSRLLKDRIVMLGTPIDDHVANLIVAQLLFLEAEDP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+I LYINSPGGVVTAG+AIYDTMQ+IKP + T CMGQAASMG++LL+AG KG RFALP
Sbjct: 62  EKDIYLYINSPGGVVTAGLAIYDTMQYIKPDVVTICMGQAASMGAVLLAAGAKGKRFALP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           +ARI++HQP GGF GQA+DIE HA++I+++KR LNEI  K+  +  E+VE+  +RD+ MS
Sbjct: 122 HARIMIHQPLGGFQGQATDIEIHAKEILRLKRMLNEILAKHTRQPVEKVEQDTERDYFMS 181

Query: 192 ASEACDWGVVDKVLMSR 208
           A EA ++G++DKVL  R
Sbjct: 182 AEEAKEYGLIDKVLTRR 198


>gi|241764198|ref|ZP_04762232.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acidovorax
           delafieldii 2AN]
 gi|241366475|gb|EER60979.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acidovorax
           delafieldii 2AN]
          Length = 202

 Score =  247 bits (631), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 115/202 (56%), Positives = 156/202 (77%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
               E   LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE
Sbjct: 1   MSALETQGLGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+IS YINSPGG VTAGM+IYDTMQFIKP +ST C+G AASMG+ LL+AG KG R
Sbjct: 61  SENPDKDISFYINSPGGSVTAGMSIYDTMQFIKPDVSTLCVGFAASMGAFLLAAGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+++++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD
Sbjct: 121 FSLPNSKVMIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPLEKVKADTERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + ++A EA D+G++D+V+  R 
Sbjct: 181 YFLTADEAKDYGIIDQVIHKRP 202


>gi|205351759|ref|YP_002225560.1| ATP-dependent Clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205271540|emb|CAR36358.1| ATP-dependent clp protease proteolytic subunit [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
          Length = 207

 Score =  247 bits (631), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 171/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G    D+    + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSGEL--DNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSAPEAVEYGLVDSILTHRN 207


>gi|310816210|ref|YP_003964174.1| Protease subunit of ATP-dependent Clp protease [Ketogulonicigenium
           vulgare Y25]
 gi|308754945|gb|ADO42874.1| Protease subunit of ATP-dependent Clp protease [Ketogulonicigenium
           vulgare Y25]
          Length = 207

 Score =  247 bits (631), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 131/207 (63%), Positives = 174/207 (84%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQT+RGER+YDI+SRLLKERI+FV+G +ED M+ LI AQLL LE
Sbjct: 1   MRDPVETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFVSGVVEDGMSQLIVAQLLHLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AGE GMR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLAAGEAGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           ++LPN+R+++HQPSGGF GQ +DI  HA++  K+KRRLNEIYVK+ G++YE VE  L+RD
Sbjct: 121 YSLPNSRVMVHQPSGGFQGQVTDIMIHARESEKLKRRLNEIYVKHTGQSYEAVEAALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEK 214
           +  SA EA ++G++D++L  R +  EK
Sbjct: 181 NFKSAEEAKEFGLIDEILEKRGETPEK 207


>gi|163731525|ref|ZP_02138972.1| Clp protease, putative [Roseobacter litoralis Och 149]
 gi|161394979|gb|EDQ19301.1| Clp protease, putative [Roseobacter litoralis Och 149]
          Length = 208

 Score =  247 bits (631), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 128/207 (61%), Positives = 171/207 (82%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            KD  + ++ LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LE
Sbjct: 1   MKDPIETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           A+NP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMR
Sbjct: 61  ADNPAKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPSGG+ GQA+DI  HA +  K+K RLNEIYVK+ G+T ++VE  L+RD
Sbjct: 121 FSLPNSRIMVHQPSGGYQGQATDIMIHAAETQKLKDRLNEIYVKHTGQTLKKVENALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEK 214
           + MS  EA D+G++D+++ +R   + +
Sbjct: 181 NFMSPEEAKDFGLIDEIVENRSKDDAE 207


>gi|114563762|ref|YP_751275.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           frigidimarina NCIMB 400]
 gi|122299288|sp|Q07ZX8|CLPP_SHEFN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|114335055|gb|ABI72437.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella
           frigidimarina NCIMB 400]
          Length = 203

 Score =  247 bits (631), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 125/202 (61%), Positives = 160/202 (79%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
                E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFL
Sbjct: 1   MHNAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST CMGQAASMG+ LL+ G KG 
Sbjct: 61  ESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCMGQAASMGAFLLAGGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HA++I+ IK +LN++  ++ G+  + +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDIAIHAKEILGIKNKLNQMLAEHTGQPLDIIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MSA++A ++G+VD +L SR
Sbjct: 181 DNFMSATQAVEYGIVDSLLTSR 202


>gi|294141768|ref|YP_003557746.1| ATP-dependent Clp protease, proteolytic subunit [Shewanella
           violacea DSS12]
 gi|293328237|dbj|BAJ02968.1| ATP-dependent Clp protease, proteolytic subunit [Shewanella
           violacea DSS12]
          Length = 203

 Score =  247 bits (631), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 123/201 (61%), Positives = 157/201 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +   E V   LVPMVVEQT +GERSYDIYSRLLKERI+F+ G +E+HMA L+ AQLLFL
Sbjct: 1   MQNAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERIIFLVGPVEEHMANLVVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G  G 
Sbjct: 61  ESESPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPDVSTVCIGQAASMGAFLLAGGAAGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LNE+  ++ G+  E +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNEMLAEHTGQPLEVIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMS 207
           D+ MSA++A ++G+VD V+  
Sbjct: 181 DNFMSAAQAAEYGLVDSVMSK 201


>gi|260887080|ref|ZP_05898343.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Selenomonas
           sputigena ATCC 35185]
 gi|330839143|ref|YP_004413723.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Selenomonas
           sputigena ATCC 35185]
 gi|260863142|gb|EEX77642.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Selenomonas
           sputigena ATCC 35185]
 gi|329746907|gb|AEC00264.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Selenomonas
           sputigena ATCC 35185]
          Length = 206

 Score =  247 bits (630), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 114/205 (55%), Positives = 161/205 (78%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
                  VPMVVE++NRGER+YDIYSRLLK+RIVFV G I+D++A ++ AQLLFLE+E+P
Sbjct: 2   NSYMNSYVPMVVERSNRGERAYDIYSRLLKDRIVFVGGPIDDNVANVVVAQLLFLESEDP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGGVVTAG+AIYDTMQ+I+P +ST C+GQAASMGSLLL+AG KG R+ALP
Sbjct: 62  DKDIHLYINSPGGVVTAGLAIYDTMQYIRPDVSTICIGQAASMGSLLLTAGAKGKRYALP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
            ARI++HQP GG  GQ++DI+  A++I++++   N+I  K+ G+  E++    +RD+ M+
Sbjct: 122 LARIMIHQPLGGAQGQSTDIQIQAKEILRLREVGNDILAKHTGQPREKLIADTERDNFMT 181

Query: 192 ASEACDWGVVDKVLMSRIDIEEKSK 216
           A EA ++G++D+V+   + IE+  +
Sbjct: 182 AEEAKEYGLIDEVITRPVKIEKPKE 206


>gi|91977364|ref|YP_570023.1| endopeptidase Clp [Rhodopseudomonas palustris BisB5]
 gi|123721781|sp|Q135W7|CLPP_RHOPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|91683820|gb|ABE40122.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Rhodopseudomonas palustris BisB5]
          Length = 214

 Score =  247 bits (630), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 136/203 (66%), Positives = 174/203 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED M+TL+ AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYV + G+TY+ +E  L+RD
Sbjct: 121 FSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRID 210
             ++A  A ++G+VDKV+  R +
Sbjct: 181 KFLTAEMAREFGIVDKVIDKRAE 203


>gi|238023189|ref|ZP_04603615.1| hypothetical protein GCWU000324_03115 [Kingella oralis ATCC 51147]
 gi|237865572|gb|EEP66712.1| hypothetical protein GCWU000324_03115 [Kingella oralis ATCC 51147]
          Length = 206

 Score =  247 bits (630), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 117/202 (57%), Positives = 158/202 (78%), Gaps = 2/202 (0%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
            +     L+P V+EQ+ RGER++DIYSRLLKERI+F+ G + DH A L+ AQLLFLE+EN
Sbjct: 3   PDIQNNTLIPTVIEQSGRGERAFDIYSRLLKERIIFLVGPVNDHTANLVVAQLLFLESEN 62

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I  YINSPGG VTAGM+IYDTM+FIKP + T C+GQAASMG+ LLSAG KG RFAL
Sbjct: 63  PDKDIYFYINSPGGSVTAGMSIYDTMKFIKPDVQTLCLGQAASMGAFLLSAGTKGKRFAL 122

Query: 131 PNARILLHQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           PN+R+++HQP       GQASDIE HA++++K+K +LN++  ++ GK+ E++E+  DRD+
Sbjct: 123 PNSRVMIHQPLISGGLGGQASDIEIHARELLKLKEKLNQMLAEHTGKSLEQIERDTDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSRID 210
            MSA EA D+G++DKV+ +R D
Sbjct: 183 FMSAQEAADYGLIDKVITTRAD 204


>gi|209885039|ref|YP_002288896.1| Clp protease [Oligotropha carboxidovorans OM5]
 gi|226706464|sp|B6JGU7|CLPP_OLICO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|209873235|gb|ACI93031.1| Clp protease [Oligotropha carboxidovorans OM5]
          Length = 210

 Score =  247 bits (630), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 139/203 (68%), Positives = 178/203 (87%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED M+TLI AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AGEK MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGEKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G++Y+ +E  L+RD
Sbjct: 121 FSLPNSRIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQSYQAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRID 210
           + ++A +A D+G+VDKV+  R +
Sbjct: 181 NFLTAEKARDFGIVDKVIDKRPE 203


>gi|28897691|ref|NP_797296.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|260898290|ref|ZP_05906786.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus Peru-466]
 gi|308094762|ref|ZP_05891792.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AN-5034]
 gi|31340006|sp|Q87R80|CLPP_VIBPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|28805904|dbj|BAC59180.1| ATP-dependent Clp protease, proteolytic subunit [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308088425|gb|EFO38120.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus Peru-466]
 gi|308093191|gb|EFO42886.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           parahaemolyticus AN-5034]
          Length = 200

 Score =  247 bits (630), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 125/197 (63%), Positives = 159/197 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
             +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP
Sbjct: 2   SPIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LP
Sbjct: 62  DKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAAGKRYVLP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +E+  DRD+ MS
Sbjct: 122 NSRVMIHQPLGGFQGQASDIQIHAQEILTIKQKLNNLLAEHTGQPLEVIERDTDRDNFMS 181

Query: 192 ASEACDWGVVDKVLMSR 208
           A +A ++G+VD VL  R
Sbjct: 182 AEQAVEYGIVDAVLSHR 198


>gi|254492068|ref|ZP_05105244.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylophaga
           thiooxidans DMS010]
 gi|224462732|gb|EEF79005.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylophaga
           thiooxydans DMS010]
          Length = 212

 Score =  247 bits (630), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 119/199 (59%), Positives = 156/199 (78%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +   LVP+VVEQT+RGERSYDIYSRLLKER++F+ G +ED MA LI AQLLFLE+ENP K
Sbjct: 13  IQNALVPIVVEQTSRGERSYDIYSRLLKERVIFLVGPVEDQMANLIVAQLLFLESENPDK 72

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I LYINSPGG VTAGMAIYDTMQF+KP +ST C+GQAASMG++LL+ G +G R  LPN+
Sbjct: 73  DIHLYINSPGGAVTAGMAIYDTMQFVKPNVSTLCIGQAASMGAVLLAGGAEGKRHCLPNS 132

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           RI++HQP GGF GQASD + HA++I+ I+ RLN I   + G+  E + +  DRD+ M+  
Sbjct: 133 RIMVHQPLGGFQGQASDFDIHAKEILSIRDRLNGILAHHTGQDIEAIRRDTDRDNFMNGE 192

Query: 194 EACDWGVVDKVLMSRIDIE 212
           +A ++G++D VL SR + +
Sbjct: 193 QALEYGLIDSVLTSRPEEK 211


>gi|85058649|ref|YP_454351.1| ATP-dependent Clp protease proteolytic subunit [Sodalis
           glossinidius str. 'morsitans']
 gi|84779169|dbj|BAE73946.1| ATP-dependent Clp protease proteolytic subunit [Sodalis
           glossinidius str. 'morsitans']
          Length = 207

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 135/209 (64%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D+    + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--EQDNFAPHMALVPMVVEQTSRGERSYDIFSRLLKERIIFMTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ++FLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +STFCMGQAASMG+ LL+
Sbjct: 59  AQMMFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTFCMGQAASMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G+  E +
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAREILKVKARMNELMAKHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA D+G+VD VL  R 
Sbjct: 179 ERDTERDRFLSAPEAVDYGLVDSVLSQRT 207


>gi|300721991|ref|YP_003711271.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Xenorhabdus nematophila ATCC 19061]
 gi|297628488|emb|CBJ89055.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Xenorhabdus nematophila ATCC 19061]
          Length = 207

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 170/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  K+D     + LVPMVVEQT RGER++DIYSRLLK+RI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--KQDQYAPNMSLVPMVVEQTARGERAFDIYSRLLKDRIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG +G RF LPN+R+++HQP GGF GQA+DI+ HAQ+I+K+K R+NE+  K+ G+  +++
Sbjct: 119 AGAEGKRFCLPNSRVMIHQPLGGFQGQATDIQIHAQEILKVKARMNELMAKHTGQPLDKI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA D+G+VD +   R 
Sbjct: 179 EEDTERDRFLSASEAVDYGLVDSIFTQRN 207


>gi|83949690|ref|ZP_00958423.1| Protease subunit of ATP-dependent Clp protease [Roseovarius
           nubinhibens ISM]
 gi|83837589|gb|EAP76885.1| Protease subunit of ATP-dependent Clp protease [Roseovarius
           nubinhibens ISM]
          Length = 203

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 128/202 (63%), Positives = 170/202 (84%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++L+ AQLL LEAENP KE
Sbjct: 1   MNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLVVAQLLHLEAENPSKE 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           IS+YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AG KGMR++LPN+R
Sbjct: 61  ISMYINSPGGVVTSGLSIYDTMQYIRPAVSTLVIGQAASMGSLLLTAGAKGMRYSLPNSR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYVK+ G+T ++VE+ L+RD+ MS  E
Sbjct: 121 IMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQTLKKVEEALERDNFMSPEE 180

Query: 195 ACDWGVVDKVLMSRIDIEEKSK 216
           A  WG++D+++ SR   +E  K
Sbjct: 181 AKSWGLIDEIVESRGKADEDDK 202


>gi|99081368|ref|YP_613522.1| ATP-dependent Clp protease proteolytic subunit [Ruegeria sp.
           TM1040]
 gi|99037648|gb|ABF64260.1| ATP-dependent Clp protease proteolytic subunit ClpP [Ruegeria sp.
           TM1040]
          Length = 218

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 126/213 (59%), Positives = 174/213 (81%), Gaps = 1/213 (0%)

Query: 4   EGCAKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQ 62
           +     D  + ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQ
Sbjct: 5   QAGPMIDPTETYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQ 64

Query: 63  LLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAG 122
           LL LEAENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AG
Sbjct: 65  LLHLEAENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAG 124

Query: 123 EKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK 182
           E GMRF+LPN+R+++HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYVK+ G+ Y+ +EK
Sbjct: 125 EAGMRFSLPNSRVMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQDYDTIEK 184

Query: 183 TLDRDHIMSASEACDWGVVDKVLMSRIDIEEKS 215
            L+RD+ MS  +A ++G++D+++ +R   ++  
Sbjct: 185 ALERDNFMSPEQAKEFGLIDEIVENRSKADDAE 217


>gi|330814219|ref|YP_004358458.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327487314|gb|AEA81719.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 204

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 123/203 (60%), Positives = 164/203 (80%), Gaps = 1/203 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D+++  LVPMVVEQT RGER+YDIYSRLLKERI+F+ G I   +++LI AQLLFL
Sbjct: 1   MKDPIDIYMNTLVPMVVEQTPRGERAYDIYSRLLKERIIFLVGPINSQVSSLISAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+EN  KEI +YINSPGG+VT G+AIYDTMQ+IKP ++T C+GQA SMGS LL+AGEKG 
Sbjct: 61  ESENNSKEIFMYINSPGGIVTDGLAIYDTMQYIKPAVATLCIGQACSMGSFLLAAGEKGQ 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R +LPN+R+++HQPS GF GQA+DIE HA +I++ K++LNEIY K+ G++ E++++ L+R
Sbjct: 121 RMSLPNSRVMVHQPSAGFQGQATDIEIHANEIMQTKKKLNEIYSKHTGQSVEKIKEALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRI 209
           D  MSA EA  +G++DKV+  R 
Sbjct: 181 DKFMSAEEAKAFGLIDKVVEKRP 203


>gi|300715591|ref|YP_003740394.1| ATP-dependent Clp protease proteolytic subunit [Erwinia billingiae
           Eb661]
 gi|299061427|emb|CAX58539.1| ATP-dependent Clp protease proteolytic subunit [Erwinia billingiae
           Eb661]
          Length = 215

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 133/209 (63%), Positives = 174/209 (83%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 9   MSYSG--EREQTAPHMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIV 66

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+
Sbjct: 67  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLT 126

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ALPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ GKT EE+
Sbjct: 127 AGTKGKRYALPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAEHTGKTLEEI 186

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA ++G+VD VL  R 
Sbjct: 187 ERDTERDRFLSASEAVEYGLVDSVLTHRT 215


>gi|126741244|ref|ZP_01756923.1| Protease subunit of ATP-dependent Clp protease [Roseobacter sp.
           SK209-2-6]
 gi|126717649|gb|EBA14372.1| Protease subunit of ATP-dependent Clp protease [Roseobacter sp.
           SK209-2-6]
          Length = 210

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 128/209 (61%), Positives = 172/209 (82%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             D  + ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL L
Sbjct: 1   MTDPRETYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GM
Sbjct: 61  EAENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGGF GQA+DI  HA++ +K+KRRLNEIYVK+ G+  ++VE  L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGFQGQATDIMIHAEETLKLKRRLNEIYVKHTGQELDKVEAALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ MS  EA ++G++D+++ +R   E + 
Sbjct: 181 DNFMSPEEAKEFGLIDEIVENRAKGEGED 209


>gi|148255923|ref|YP_001240508.1| ATP-dependent Clp protease proteolytic subunit ClpP [Bradyrhizobium
           sp. BTAi1]
 gi|166201801|sp|A5EKA8|CLPP_BRASB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|146408096|gb|ABQ36602.1| ATP-dependent Clp protease proteolytic subunit ClpP [Bradyrhizobium
           sp. BTAi1]
          Length = 210

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 135/203 (66%), Positives = 173/203 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED MATLI AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMATLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI++YINSPGGVVT+G+AIYDTMQFI+P +ST C GQAASMGSLLL AG K MR
Sbjct: 61  AENPKKEIAMYINSPGGVVTSGLAIYDTMQFIRPAVSTLCTGQAASMGSLLLCAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G++Y+ +E  L+RD
Sbjct: 121 FSLPNSRIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQSYKAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRID 210
             ++A  A ++G++DKV+  R +
Sbjct: 181 KFLTAEAAAEFGLIDKVIDKRPE 203


>gi|329120061|ref|ZP_08248731.1| ATP-dependent Clp protease, protease subunit [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327463592|gb|EGF09910.1| ATP-dependent Clp protease, protease subunit [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 211

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 113/205 (55%), Positives = 157/205 (76%), Gaps = 2/205 (0%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
            E     L+P V+EQ+ RGER++DIYSRLLKERI+F+ G + DH A L+ AQ+LFLE+EN
Sbjct: 3   PEISNNTLIPTVIEQSGRGERAFDIYSRLLKERIIFLIGPVNDHTANLVVAQMLFLESEN 62

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I  YINSPGG VTAGM+++DTM FIKP +ST C+GQAASMG+ LLSAG KG RFAL
Sbjct: 63  PDKDIFFYINSPGGSVTAGMSVFDTMNFIKPDVSTLCLGQAASMGAFLLSAGAKGKRFAL 122

Query: 131 PNARILLHQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           P++R+++HQP       GQASDIE HA++++K+K+ LNE+  K+ G+  E++E+  DRD+
Sbjct: 123 PHSRVMIHQPLISGGLGGQASDIEIHARELIKLKQTLNELLAKHTGQPIEKIERDTDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSRIDIEE 213
            MSA  A ++G++D+V+ +R D  +
Sbjct: 183 FMSAQAAKEYGLIDQVIATRADAAK 207


>gi|239995517|ref|ZP_04716041.1| ATP-dependent Clp protease proteolytic subunit [Alteromonas
           macleodii ATCC 27126]
          Length = 209

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 164/209 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
                 D    LVPMVVEQT++GERSYDIYSRLLKE ++F+ GQ+EDHMA LI AQ+LFL
Sbjct: 1   MTNTPFDPMNALVPMVVEQTSKGERSYDIYSRLLKENVIFLVGQVEDHMANLIVAQMLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+K+I LYINSPGG VTAGMAIYDTM+FIKP +ST CMGQAASMG+ LLSAG KG 
Sbjct: 61  EAENPEKDIFLYINSPGGSVTAGMAIYDTMKFIKPDVSTVCMGQAASMGAFLLSAGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ LPN+R+++HQP GGF GQASD E HA++I+ IK +LN +   + G+ YE+V +  DR
Sbjct: 121 RYCLPNSRVMIHQPLGGFQGQASDFEIHAKEILSIKEKLNRLMADHTGQDYEKVARDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ +SA+EA ++G+VD+VL +R D+    
Sbjct: 181 DNFLSATEAKEYGLVDQVLANRSDVAATK 209


>gi|145589117|ref|YP_001155714.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047523|gb|ABP34150.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 209

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 120/209 (57%), Positives = 160/209 (76%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M+      ++ E   LGLVPMV+E + RGER+YDIYSRLL+ER+VF+ G++ D  A L+ 
Sbjct: 1   MNQNHFQSENLEPKGLGLVPMVIETSGRGERAYDIYSRLLRERVVFLVGEVNDQTANLVI 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+ISLYINSPGG V+AG+AIYDTMQFIKP +ST CMG AASMG+ LL 
Sbjct: 61  AQLLFLESENPDKDISLYINSPGGSVSAGLAIYDTMQFIKPHVSTLCMGMAASMGAFLLC 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AGEKG R+ALPN+R+++HQP GG  GQASDIE  A++I+ ++ RLN+I     G++ + +
Sbjct: 121 AGEKGKRYALPNSRVMIHQPLGGARGQASDIEIQAREILYLRERLNKILADRTGQSIDTI 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
            K  DRD+ MSA +A ++G++DKV+  R 
Sbjct: 181 AKDTDRDNFMSAEQAREYGLIDKVIEKRP 209


>gi|237807855|ref|YP_002892295.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Tolumonas
           auensis DSM 9187]
 gi|237500116|gb|ACQ92709.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Tolumonas
           auensis DSM 9187]
          Length = 207

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 126/201 (62%), Positives = 157/201 (78%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
                    LVP+VVEQT RGERSYDIYSRLLKER++F+TGQ+ED MA LI AQLLFLE+
Sbjct: 7   DQISSPLNSLVPIVVEQTARGERSYDIYSRLLKERVIFLTGQVEDQMANLIVAQLLFLES 66

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP K+I +YINSPGG VTAGMAIYDT++FIKP +ST CMGQA SMG+ LLSAG KG RF
Sbjct: 67  ENPDKDIYIYINSPGGSVTAGMAIYDTLKFIKPDVSTVCMGQACSMGAFLLSAGTKGKRF 126

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
            LP+AR+++HQP GGF GQASDI+ HA +I+KIK RLN +  ++ G+  E +E+  DRD+
Sbjct: 127 CLPSARVMIHQPLGGFQGQASDIQIHAMEILKIKERLNNLLAEHTGQPLERIERDTDRDN 186

Query: 189 IMSASEACDWGVVDKVLMSRI 209
            MSA +A ++G+VD +L  R 
Sbjct: 187 FMSADQAVEYGLVDAILKKRA 207


>gi|255589435|ref|XP_002534960.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus
           communis]
 gi|223524291|gb|EEF27423.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus
           communis]
          Length = 435

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 122/208 (58%), Positives = 159/208 (76%)

Query: 4   EGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           +G  ++  E   LG +PMV+EQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ AQL
Sbjct: 228 KGMMQQRMEPQGLGYIPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDMTANLVVAQL 287

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           LFLEAENP K+ISLYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+AG 
Sbjct: 288 LFLEAENPDKDISLYINSPGGSVTAGMSIYDTMQFIKPDVSTLCIGQAASMGAFLLTAGA 347

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
           KG RF LPN+R+++HQP GGF GQASDIE HA++I+ +K +LN I   + G+  + +   
Sbjct: 348 KGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILYLKDKLNGIMAHHTGQNIDTIAND 407

Query: 184 LDRDHIMSASEACDWGVVDKVLMSRIDI 211
            DRD+ MSA  A  +G+VD+V+ +R  +
Sbjct: 408 TDRDNFMSADAAKAYGLVDQVIAARSAV 435


>gi|163857103|ref|YP_001631401.1| ATP-dependent Clp protease proteolytic subunit [Bordetella petrii
           DSM 12804]
 gi|226706441|sp|A9IR54|CLPP_BORPD RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|163260831|emb|CAP43133.1| ATP-dependent Clp protease proteolytic subunit [Bordetella petrii]
          Length = 217

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 119/195 (61%), Positives = 154/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D+ A LI AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLIVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V AGMAIYDTMQF+KP +ST C G AASMG+ LL+AG+KG RF LPN+RI
Sbjct: 82  SLYINSPGGSVYAGMAIYDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  +N G+  E +    +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILDLRERLNRILAENTGQPVERIAVDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSRID 210
             +G+VDKVL SR +
Sbjct: 202 VSYGLVDKVLASRSE 216


>gi|242240292|ref|YP_002988473.1| ATP-dependent Clp protease proteolytic subunit ClpP [Dickeya
           dadantii Ech703]
 gi|242132349|gb|ACS86651.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dickeya
           dadantii Ech703]
          Length = 207

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++ +   + LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+ED+MA LI 
Sbjct: 1   MSYSG--EQEKQTPHMALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDYMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G++ + +
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKARMNELMAKHTGQSLDII 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA ++G+VD VL  R 
Sbjct: 179 ERDTERDRFLSAGEAVEYGLVDSVLTHRE 207


>gi|302390303|ref|YP_003826124.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Thermosediminibacter oceani DSM 16646]
 gi|302200931|gb|ADL08501.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Thermosediminibacter oceani DSM 16646]
          Length = 200

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 116/199 (58%), Positives = 157/199 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+V+EQTNRGER+YDIYSRLLK+RIVF+   I+D +A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MSLVPIVIEQTNRGERAYDIYSRLLKDRIVFIGTPIDDSIASLVIAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG+AIYDTMQ+IKP +ST C+G AASMG++LL+ G  G R ALPN+RI
Sbjct: 61  YLYINSPGGSVTAGLAIYDTMQYIKPDVSTICIGMAASMGAVLLAGGAPGKRLALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  G+A DIE HA++I++++  LNEI VK+  +  E +E+  +RD+ MSA EA
Sbjct: 121 MIHQPWGGVQGRALDIETHAKEILRLREVLNEILVKHTKQPLERIERDTERDYFMSAVEA 180

Query: 196 CDWGVVDKVLMSRIDIEEK 214
             +G++D+V+  R    EK
Sbjct: 181 KQYGLIDEVIYKRTKAGEK 199


>gi|110633522|ref|YP_673730.1| ATP-dependent Clp protease proteolytic subunit [Mesorhizobium sp.
           BNC1]
 gi|116243101|sp|Q11J60|CLPP1_MESSB RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|110284506|gb|ABG62565.1| ATP-dependent Clp protease proteolytic subunit ClpP [Chelativorans
           sp. BNC1]
          Length = 210

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 150/205 (73%), Positives = 180/205 (87%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            K+  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED MATL+CAQLLFLE
Sbjct: 1   MKNPVETAMNLVPMVVEQTNRGERAYDIFSRLLKERIIFITGPVEDGMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVT+GMAIYDTMQFI+PP+ST C+GQAASMGSLLL AG K MR
Sbjct: 61  AENPKKEIALYINSPGGVVTSGMAIYDTMQFIQPPVSTLCIGQAASMGSLLLCAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNAR+++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRD
Sbjct: 121 FATPNARVMVHQPSGGFQGQASDIERHAQDIIKLKRRLNEIYVKHTGQDYDTIERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIE 212
           H M+A EA  +G+VD+V+  R  IE
Sbjct: 181 HFMTADEAQAFGLVDRVISEREAIE 205


>gi|83943111|ref|ZP_00955571.1| Protease subunit of ATP-dependent Clp protease [Sulfitobacter sp.
           EE-36]
 gi|83846119|gb|EAP83996.1| Protease subunit of ATP-dependent Clp protease [Sulfitobacter sp.
           EE-36]
          Length = 211

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 129/201 (64%), Positives = 167/201 (83%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KE
Sbjct: 1   MNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKE 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           IS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL AGEKGMRF+LPN+R
Sbjct: 61  ISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLQAGEKGMRFSLPNSR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           +++HQPSGG+ GQA+DI  HAQ+  K+K RLNEIYVK+ G+  E+VE  L+RD+ MS  E
Sbjct: 121 VMVHQPSGGYQGQATDIMIHAQETQKLKTRLNEIYVKHTGQPLEKVEAALERDNFMSPEE 180

Query: 195 ACDWGVVDKVLMSRIDIEEKS 215
           A DWG++D+++ +R  +++  
Sbjct: 181 AKDWGLIDEIVENRGKMDDPD 201


>gi|259416932|ref|ZP_05740852.1| Clp protease [Silicibacter sp. TrichCH4B]
 gi|259348371|gb|EEW60148.1| Clp protease [Silicibacter sp. TrichCH4B]
          Length = 218

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 127/213 (59%), Positives = 176/213 (82%), Gaps = 1/213 (0%)

Query: 4   EGCAKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQ 62
           +     D  + ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQ
Sbjct: 5   QAGPMIDPTETYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQ 64

Query: 63  LLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAG 122
           LL LEAENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AG
Sbjct: 65  LLHLEAENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAG 124

Query: 123 EKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK 182
           E GMRF+LPN+R+++HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYVK+ G+ Y+ +EK
Sbjct: 125 EAGMRFSLPNSRVMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQDYDTIEK 184

Query: 183 TLDRDHIMSASEACDWGVVDKVLMSRIDIEEKS 215
            L+RD+ MS  +A ++G++D+++ +R+  E++ 
Sbjct: 185 ALERDNFMSPEQAKEFGLIDEIVENRVKAEDEE 217


>gi|153006264|ref|YP_001380589.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Anaeromyxobacter sp. Fw109-5]
 gi|166201797|sp|A7HFV9|CLPP_ANADF RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|152029837|gb|ABS27605.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Anaeromyxobacter sp. Fw109-5]
          Length = 204

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 115/202 (56%), Positives = 159/202 (78%), Gaps = 2/202 (0%)

Query: 16  LGLVPM--VVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +  +PM  VVEQT+RGERSYDIYSRLLK+RIVF+   I+D +A ++ AQLLFLE+E+P K
Sbjct: 1   MPYIPMPYVVEQTHRGERSYDIYSRLLKDRIVFLGTPIDDDVANVVIAQLLFLESEDPDK 60

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +ISLYINSPGG VT+G+AIYDTMQ++KP +ST C+GQAASMG+ LL+ G  G RFA+PNA
Sbjct: 61  DISLYINSPGGSVTSGLAIYDTMQYVKPQVSTICLGQAASMGAFLLAGGAAGKRFAVPNA 120

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           RI++HQP GGF GQA+DI+  A++I+++K +LN+I  K+  +  E +EK  DRD+ M A 
Sbjct: 121 RIMIHQPMGGFQGQATDIDIQAREILRLKAKLNDILAKHTKQPLERIEKDTDRDYFMGAG 180

Query: 194 EACDWGVVDKVLMSRIDIEEKS 215
           EA ++G++D+V++ +    EK 
Sbjct: 181 EAKEYGLIDEVIVHKPKATEKK 202


>gi|227821606|ref|YP_002825576.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium
           fredii NGR234]
 gi|227340605|gb|ACP24823.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium
           fredii NGR234]
          Length = 210

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 160/209 (76%), Positives = 187/209 (89%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLE
Sbjct: 1   MRNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDHMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YV++CG+TYEEVE+TLDRD
Sbjct: 121 FATPNARIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVRHCGRTYEEVEQTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H MS+ EA DWG++DKV+ SR  IE   +
Sbjct: 181 HFMSSDEALDWGLIDKVITSREAIEGGEQ 209


>gi|256369536|ref|YP_003107046.1| ATP-dependent Clp protease proteolytic subunit [Brucella microti
           CCM 4915]
 gi|255999698|gb|ACU48097.1| ATP-dependent Clp protease proteolytic subunit [Brucella microti
           CCM 4915]
          Length = 209

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 148/209 (70%), Positives = 182/209 (87%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLE
Sbjct: 1   MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R
Sbjct: 61  AENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           +ALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E TLDRD
Sbjct: 121 YALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIECTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA ++G++DKV+ +R    ++SK
Sbjct: 181 HFMTAQEALEFGLIDKVVEARDVSADESK 209


>gi|206901598|ref|YP_002250810.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dictyoglomus
           thermophilum H-6-12]
 gi|206740701|gb|ACI19759.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dictyoglomus
           thermophilum H-6-12]
          Length = 194

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 115/193 (59%), Positives = 156/193 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+V+EQT RGER+YDIYSRLLK RIVF+   I D +A L+ AQLLFLE+E+P+K+I L
Sbjct: 2   LVPIVIEQTPRGERAYDIYSRLLKSRIVFLGTAINDEVANLVVAQLLFLESEDPEKDIYL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V+AG+AIYDTM+ IKP ++T C+GQAASM ++LL+AG+KG R+ALP++R+++
Sbjct: 62  YINSPGGEVSAGLAIYDTMRHIKPKVATVCVGQAASMAAILLAAGDKGKRYALPHSRVMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  G A+DIE H ++I+KIKR LNEI   + G+  E++E+  DRD  MSA EA +
Sbjct: 122 HQPLGGAYGPAADIEIHTREILKIKRVLNEILAHHTGQPIEKIERDTDRDFFMSAYEAKE 181

Query: 198 WGVVDKVLMSRID 210
           +G+VD+VL S+ +
Sbjct: 182 YGIVDEVLESKKE 194


>gi|15895898|ref|NP_349247.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           acetobutylicum ATCC 824]
 gi|18202304|sp|P58276|CLPP_CLOAB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|15025667|gb|AAK80587.1|AE007761_6 Protease subunits of ATP-dependent protease, ClpP [Clostridium
           acetobutylicum ATCC 824]
 gi|325510050|gb|ADZ21686.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           acetobutylicum EA 2018]
          Length = 193

 Score =  246 bits (629), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 116/192 (60%), Positives = 154/192 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+R++F+  ++ D  A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRVIFLGEEVNDTTASLVVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GMAIYDTMQ++KP +ST C+G AASMGS LL+AG  G RFALPN+ I
Sbjct: 61  YLYINSPGGSITSGMAIYDTMQYVKPDVSTICIGMAASMGSFLLTAGAPGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HAQ I++IK++LN IY +  GK  E +EK  DRDH +SA EA
Sbjct: 121 MIHQPLGGFKGQATDIGIHAQRILEIKKKLNSIYSERTGKPIEVIEKDTDRDHFLSAEEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+V+  
Sbjct: 181 KEYGLIDEVITK 192


>gi|322834046|ref|YP_004214073.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rahnella sp.
           Y9602]
 gi|321169247|gb|ADW74946.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rahnella sp.
           Y9602]
          Length = 207

 Score =  246 bits (628), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 170/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--EREQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAE+P+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAESPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG +G RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ GK+ EE+
Sbjct: 119 AGAEGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAKHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA  +G+VD V   R 
Sbjct: 179 ERDTERDRFLSADEAVQYGLVDSVFTHRA 207


>gi|317047175|ref|YP_004114823.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pantoea sp.
           At-9b]
 gi|316948792|gb|ADU68267.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pantoea sp.
           At-9b]
          Length = 207

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 173/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G   ++     + LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--DREFTAPHMALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K+R+NE+  ++ GK+ E++
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKQRMNELMAEHTGKSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSILTHRQ 207


>gi|290474663|ref|YP_003467543.1| clpA-clpP ATP-dependent serine protease proteolytic subunit
           [Xenorhabdus bovienii SS-2004]
 gi|289173976|emb|CBJ80763.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Xenorhabdus bovienii SS-2004]
          Length = 207

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 169/209 (80%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  K+D     + LVPMVVEQT RGER++DIYSRLLK+RI+F+TG +EDHMA LI 
Sbjct: 1   MSYSG--KQDKYAPNMSLVPMVVEQTARGERAFDIYSRLLKDRIIFLTGPVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I+LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDINLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HAQ+I+K+K R+NE+  K+ GK  E++
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAQEILKVKARMNELMAKHTGKPLEKI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
            +  +RD  +SA+E+ ++G+VD +   R 
Sbjct: 179 VEDTERDRFLSAAESVEYGLVDSIFTQRN 207


>gi|33592842|ref|NP_880486.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           pertussis Tohama I]
 gi|33596622|ref|NP_884265.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           parapertussis 12822]
 gi|33601237|ref|NP_888797.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           bronchiseptica RB50]
 gi|67460369|sp|Q7VXI7|CLPP_BORPE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|67460372|sp|Q7W8X2|CLPP_BORPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|67460374|sp|Q7WK83|CLPP_BORBR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|33572490|emb|CAE42062.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           pertussis Tohama I]
 gi|33573323|emb|CAE37306.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           parapertussis]
 gi|33575672|emb|CAE32750.1| ATP-dependent Clp protease proteolytic subunit [Bordetella
           bronchiseptica RB50]
          Length = 217

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 118/196 (60%), Positives = 152/196 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D+ A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V AGMAIYDTMQFIKP +ST C G AASMG+ LL+AG+KG RF LPN+RI
Sbjct: 82  SFYINSPGGSVYAGMAIYDTMQFIKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  +N G+  E +    +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILDLRERLNRILAENTGQPVERIAVDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSRIDI 211
             +G+VDKVL SR   
Sbjct: 202 VSYGLVDKVLTSRAQT 217


>gi|39936026|ref|NP_948302.1| endopeptidase Clp [Rhodopseudomonas palustris CGA009]
 gi|192291681|ref|YP_001992286.1| Endopeptidase Clp [Rhodopseudomonas palustris TIE-1]
 gi|67460293|sp|Q6N5L3|CLPP_RHOPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706467|sp|B3Q7P5|CLPP_RHOPT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|39649880|emb|CAE28402.1| ATP-dependent Clp protease proteolytic subunit [Rhodopseudomonas
           palustris CGA009]
 gi|192285430|gb|ACF01811.1| Endopeptidase Clp [Rhodopseudomonas palustris TIE-1]
          Length = 212

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 138/203 (67%), Positives = 174/203 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED M+TLI AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYV + G+TY+ +E  L+RD
Sbjct: 121 FSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRID 210
             ++A  A ++G+VDKV+  R +
Sbjct: 181 KFLTAEMAREFGIVDKVIEKRPE 203


>gi|126733145|ref|ZP_01748892.1| Clp protease, putative [Roseobacter sp. CCS2]
 gi|126716011|gb|EBA12875.1| Clp protease, putative [Roseobacter sp. CCS2]
          Length = 206

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 125/206 (60%), Positives = 169/206 (82%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQT RGER+YDI+SRLLKERI+FV G + D M+ LI AQLL LE
Sbjct: 1   MQDPTETYMNLVPMVVEQTARGERAYDIFSRLLKERIIFVNGPVHDGMSQLIVAQLLHLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP+KEIS+YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AG +GMR
Sbjct: 61  SENPKKEISMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGSEGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+R+++HQPSGG+ GQA+DI  HA +  K+K RLNEIYVK+ G T ++VE  L+RD
Sbjct: 121 FSLPNSRVMVHQPSGGYQGQATDIMIHAAETQKLKTRLNEIYVKHTGNTLKKVEAALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEE 213
           + MS  EA +WG++D+++ +R   ++
Sbjct: 181 NFMSPEEAKEWGLIDEIVENRTKSDD 206


>gi|118444381|ref|YP_878863.1| ATP-dependent Clp protease proteolytic subunit [Clostridium novyi
           NT]
 gi|166201817|sp|A0Q2L1|CLPP_CLONN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|118134837|gb|ABK61881.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           novyi NT]
          Length = 195

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 119/195 (61%), Positives = 154/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+F+  ++ D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIFLGEEVNDVTASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  YLYINSPGGSITAGMAIYDTMQYIKPDVSTICIGMAASMGAFLLTAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA  I+KIK +LN I  +  G+  E ++K ++RD+ M A EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHANRILKIKDKLNSILSERTGQPLEVIKKDVERDNFMEAEEA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D V+ SR  
Sbjct: 181 KEYGLIDDVITSRKK 195


>gi|238783609|ref|ZP_04627630.1| ATP-dependent Clp protease proteolytic subunit [Yersinia bercovieri
           ATCC 43970]
 gi|238715487|gb|EEQ07478.1| ATP-dependent Clp protease proteolytic subunit [Yersinia bercovieri
           ATCC 43970]
          Length = 207

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 133/209 (63%), Positives = 169/209 (80%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAREILKVKSRMNELMALHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA EA  +G+VD V   R 
Sbjct: 179 ERDTERDRFLSAEEAVGYGLVDSVFTRRD 207


>gi|254460423|ref|ZP_05073839.1| Clp protease [Rhodobacterales bacterium HTCC2083]
 gi|206677012|gb|EDZ41499.1| Clp protease [Rhodobacteraceae bacterium HTCC2083]
          Length = 210

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 127/209 (60%), Positives = 171/209 (81%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             D  D ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL L
Sbjct: 1   MNDPIDTYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AGEK M
Sbjct: 61  EAENPSKEISMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEKDM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGG+ GQA+DI  HAQ+  K+K RLNEIYV++ G+T ++VE  L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGYQGQATDIMIHAQETQKLKTRLNEIYVQHTGQTLKKVEAALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ MS  EA ++G++D++L +R    ++ 
Sbjct: 181 DNFMSPEEAKEFGLIDEILQTRPKTGDEE 209


>gi|168186116|ref|ZP_02620751.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum C str. Eklund]
 gi|169296133|gb|EDS78266.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum C str. Eklund]
          Length = 195

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 120/195 (61%), Positives = 155/195 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+F+  ++ D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIFLGEEVNDVSASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  YLYINSPGGSITAGMAIYDTMQYIKPDVSTICIGMAASMGAFLLTAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA  I+KIK +LN+I  +  GK  E ++K ++RD+ M A EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHANRILKIKDKLNKILSERTGKPLEVIKKDVERDNFMEAEEA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D V+ SR  
Sbjct: 181 KEYGLIDDVITSRKK 195


>gi|147677139|ref|YP_001211354.1| protease subunit of ATP-dependent Clp proteases [Pelotomaculum
           thermopropionicum SI]
 gi|259585961|sp|A5D447|CLPP_PELTS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|146273236|dbj|BAF58985.1| protease subunit of ATP-dependent Clp proteases [Pelotomaculum
           thermopropionicum SI]
          Length = 194

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 117/194 (60%), Positives = 160/194 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGER+YDIYSRLLK+RI+F+ G I+D+ A LI AQ+LFLEAE+P+K+I
Sbjct: 1   MNLVPIVVEQTNRGERAYDIYSRLLKDRIIFLGGPIDDNTANLIIAQMLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGGVVTAGMAIYDTMQ+++ P++T C+GQAASM SLLL+AG KG R++LP ARI
Sbjct: 61  QFYINSPGGVVTAGMAIYDTMQYVRSPVATICIGQAASMASLLLAAGAKGKRYSLPYARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           L+HQP GG  GQA+DIE HA++I+++++ LNEI  ++ G+  E++ +  +RD+ MSA EA
Sbjct: 121 LIHQPLGGVQGQATDIEIHAKEILRMRQFLNEILSRHTGQPIEKIARDTERDYFMSAQEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V   R 
Sbjct: 181 KEYGIIDEVYDVRK 194


>gi|316933821|ref|YP_004108803.1| endopeptidase Clp [Rhodopseudomonas palustris DX-1]
 gi|315601535|gb|ADU44070.1| Endopeptidase Clp [Rhodopseudomonas palustris DX-1]
          Length = 212

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 138/206 (66%), Positives = 174/206 (84%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED M+TLI AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYV + G+TY+ +E  L+RD
Sbjct: 121 FSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEE 213
             ++A  A ++G+VDKV+  R +   
Sbjct: 181 KFLTAEMAREFGIVDKVIDKRPEDPS 206


>gi|222148264|ref|YP_002549221.1| ATP-dependent Clp protease proteolytic subunit [Agrobacterium vitis
           S4]
 gi|221735252|gb|ACM36215.1| ATP-dependent Clp protease proteolytic subunit ClpP [Agrobacterium
           vitis S4]
          Length = 210

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 156/205 (76%), Positives = 186/205 (90%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMA+L+CAQLLFLE
Sbjct: 1   MRNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDHMASLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI++YINSPGGVVTAGMAIYDTMQFI+P +ST C+GQAASMGSLLL+AGEKGMR
Sbjct: 61  AENPKKEIAIYINSPGGVVTAGMAIYDTMQFIRPAVSTLCVGQAASMGSLLLAAGEKGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+T EEVE TLDRD
Sbjct: 121 FATPNARIMVHQPSGGFQGQASDIERHARDIIKMKRRLNEVYVKHTGRTLEEVEHTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIE 212
           H M ++EA DWG++DK+L +R +IE
Sbjct: 181 HFMESTEAKDWGLIDKILTTRSEIE 205


>gi|121593621|ref|YP_985517.1| ATP-dependent Clp protease proteolytic subunit [Acidovorax sp.
           JS42]
 gi|166201795|sp|A1W5B6|CLPP_ACISJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|120605701|gb|ABM41441.1| ATP-dependent Clp protease proteolytic subunit ClpP [Acidovorax sp.
           JS42]
          Length = 202

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 117/202 (57%), Positives = 155/202 (76%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
               E   LG++PMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE
Sbjct: 1   MSALETQALGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+IS YINSPGG VTAGMAIYDTMQFIKP +ST C G AASMG+ LL+AG KG R
Sbjct: 61  SENPDKDISFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCCGFAASMGAFLLAAGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           ++LPN++I++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD
Sbjct: 121 YSLPNSKIMIHQVLGGARGQATDIEIHARDILRTKEQMNRILAERTGQPIEKVKADTERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + M+A EA D+G+VD+V+  R 
Sbjct: 181 YFMTADEAKDYGIVDQVIAKRP 202


>gi|126173838|ref|YP_001049987.1| ATP-dependent Clp protease proteolytic subunit [Shewanella baltica
           OS155]
 gi|153000122|ref|YP_001365803.1| ATP-dependent Clp protease proteolytic subunit [Shewanella baltica
           OS185]
 gi|160874744|ref|YP_001554060.1| ATP-dependent Clp protease proteolytic subunit [Shewanella baltica
           OS195]
 gi|217973910|ref|YP_002358661.1| ATP-dependent Clp protease proteolytic subunit [Shewanella baltica
           OS223]
 gi|304409711|ref|ZP_07391331.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS183]
 gi|307304067|ref|ZP_07583820.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica BA175]
 gi|166214708|sp|A3D305|CLPP_SHEB5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214709|sp|A6WLQ1|CLPP_SHEB8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082464|sp|A9KWH7|CLPP_SHEB9 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763799|sp|B8E5E9|CLPP_SHEB2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|125997043|gb|ABN61118.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella
           baltica OS155]
 gi|151364740|gb|ABS07740.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS185]
 gi|160860266|gb|ABX48800.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS195]
 gi|217499045|gb|ACK47238.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS223]
 gi|304352229|gb|EFM16627.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS183]
 gi|306912965|gb|EFN43388.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica BA175]
 gi|315266986|gb|ADT93839.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           baltica OS678]
          Length = 202

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 125/201 (62%), Positives = 162/201 (80%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             ++ D+   LVPMV+EQT +GERSYDIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE
Sbjct: 1   MHNASDIQSALVPMVIEQTAKGERSYDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG R
Sbjct: 61  SESPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
             LPN+R+++HQP GGF GQASDI  HA++I+ IK +LN++  ++ G+  E VE+  DRD
Sbjct: 121 HCLPNSRVMIHQPLGGFQGQASDIAIHAKEILGIKNKLNQMLAEHTGQPLEVVERDTDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + MSA++A ++G+VD V+  R
Sbjct: 181 NFMSATQAVEYGLVDSVMTKR 201


>gi|254480762|ref|ZP_05094009.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine gamma
           proteobacterium HTCC2148]
 gi|214039345|gb|EEB80005.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine gamma
           proteobacterium HTCC2148]
          Length = 213

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 125/208 (60%), Positives = 162/208 (77%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M ++   +       LGLVPMVVEQT+RGERSYDIYSRLLKER++FV GQ+EDHMA LI 
Sbjct: 1   MPYQPDGRNSQTIDNLGLVPMVVEQTSRGERSYDIYSRLLKERVIFVVGQVEDHMANLIV 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAG++IYDTMQFIKP +ST C+GQAASMG+ LL 
Sbjct: 61  AQLLFLESENPDKDIHLYINSPGGSVTAGLSIYDTMQFIKPDVSTMCLGQAASMGAFLLC 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G KG R+ LPNAR ++HQPSGG  GQA+DIE  A++I+ I+ +LN++  ++ G+  E +
Sbjct: 121 GGAKGKRYCLPNARTMIHQPSGGAQGQATDIEIQAKEILIIREKLNQLMAEHTGQPLEVI 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
           E+  +RD  M+A E+  +G+VD+V+ SR
Sbjct: 181 ERDTERDRFMNAEESTAYGLVDEVVTSR 208


>gi|6685315|sp|Q9X6W8|CLPP_AZOBR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|5002357|gb|AAD37435.1|AF150957_2 heat-shock protein ClpP [Azospirillum brasilense]
          Length = 210

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 126/200 (63%), Positives = 163/200 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D E     LVPMV+EQTNRGER YDIYSRLLKERI+F+ G + D +A+LIC+QLLFLE+E
Sbjct: 3   DFEPKMNALVPMVIEQTNRGERGYDIYSRLLKERIIFLIGGVNDAVASLICSQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I+LYINSPGG V+AG+AIYDTMQ+I+P +ST CMGQAASMGSLLL+AG  G RF+
Sbjct: 63  NPSKDIALYINSPGGYVSAGLAIYDTMQYIRPQVSTVCMGQAASMGSLLLAAGAPGKRFS 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+RI++HQPSGG  GQASDIE  AQ+I+K++ RLN+IYVK+ G++ + +E  ++RD  
Sbjct: 123 LPNSRIMIHQPSGGAQGQASDIEIQAQEILKLRSRLNDIYVKHTGQSLDTIEAXMERDKF 182

Query: 190 MSASEACDWGVVDKVLMSRI 209
           MS  EA  +G++D+V+  R 
Sbjct: 183 MSPEEAKAFGLIDEVVEKRP 202


>gi|237755491|ref|ZP_04584113.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237692355|gb|EEP61341.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 201

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 118/199 (59%), Positives = 160/199 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           + +   L+P+V+EQT RGER+YDIYSRLLK+RI+ +   I+DH+A L+ AQLLFLE+E+P
Sbjct: 2   DKILNQLIPIVIEQTPRGERAYDIYSRLLKDRIILLGTPIDDHIANLVVAQLLFLESEDP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I +YINSPGGVVTAG+AIYDTM +IKP + T CMGQAASMG+ LLSAG KG R++LP
Sbjct: 62  DKDIYMYINSPGGVVTAGLAIYDTMNYIKPDVVTICMGQAASMGAFLLSAGAKGKRYSLP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           NARI++HQP GGF GQA+DIE HA++I+++KR LNE   K+ G+  E++E   +RD+ MS
Sbjct: 122 NARIMIHQPLGGFQGQATDIEIHAKEILRLKRMLNEYLAKHTGQPIEKIEADTERDYFMS 181

Query: 192 ASEACDWGVVDKVLMSRID 210
           A EA ++G++DKV+  R +
Sbjct: 182 AEEAKEYGLIDKVIYKRGE 200


>gi|222110341|ref|YP_002552605.1| ATP-dependent clp protease proteolytic subunit [Acidovorax ebreus
           TPSY]
 gi|254763789|sp|B9MG14|CLPP_DIAST RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|221729785|gb|ACM32605.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acidovorax
           ebreus TPSY]
          Length = 202

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 117/202 (57%), Positives = 155/202 (76%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
               E   LG++PMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE
Sbjct: 1   MSALETQALGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+IS YINSPGG VTAGMAIYDTMQFIKP +ST C G AASMG+ LL+AG KG R
Sbjct: 61  SENPDKDISFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCCGFAASMGAFLLAAGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           ++LPN++I++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD
Sbjct: 121 YSLPNSKIMIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPIEKVKADTERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + M+A EA D+G+VD+V+  R 
Sbjct: 181 YFMTADEAKDYGIVDQVIAKRP 202


>gi|223042116|ref|ZP_03612288.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           minor 202]
 gi|240950344|ref|ZP_04754614.1| ATP-dependent Clp protease proteolytic subunit ClpP [Actinobacillus
           minor NM305]
 gi|223017093|gb|EEF15533.1| ATP-dependent Clp protease proteolytic subunit [Actinobacillus
           minor 202]
 gi|240295155|gb|EER45974.1| ATP-dependent Clp protease proteolytic subunit ClpP [Actinobacillus
           minor NM305]
          Length = 197

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 122/196 (62%), Positives = 160/196 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQT++GERSYDIYSRLLKERI+F+ GQ+ED+MA LI AQLLFLEAE+P+K+I
Sbjct: 1   MALIPMVVEQTSKGERSYDIYSRLLKERIIFLNGQVEDNMANLIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQA SMG+ LLS G KG RFALPNAR+
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQACSMGAFLLSGGAKGKRFALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  AQ+I+K+K  L     ++ G+++++V    +RD+ MSA EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAQEILKLKEMLTRKMAEHSGQSFDKVAADTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G++DKVL SR ++
Sbjct: 181 KEYGLIDKVLTSRGEV 196


>gi|308050308|ref|YP_003913874.1| ATP-dependent Clp protease proteolytic subunit ClpP [Ferrimonas
           balearica DSM 9799]
 gi|307632498|gb|ADN76800.1| ATP-dependent Clp protease proteolytic subunit ClpP [Ferrimonas
           balearica DSM 9799]
          Length = 207

 Score =  246 bits (627), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 125/207 (60%), Positives = 159/207 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +   +     L+PMVVEQT +GERSYDIYSRLLKER++F+TG +EDHMA L+ AQLLFL
Sbjct: 1   MQHLLDSPLNALIPMVVEQTAKGERSYDIYSRLLKERVIFLTGPVEDHMANLVVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+ G KG 
Sbjct: 61  ESENPDKDIYLYINSPGGSVTAGMSIYDTMQFIKPDVSTVCMGQAASMGAFLLAGGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DR
Sbjct: 121 RHVLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNLLLAEHTGQPMEVIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEE 213
           D+ MSA++A ++G+VD VL  R    E
Sbjct: 181 DNFMSATDAVEYGLVDSVLTRRAADAE 207


>gi|253990891|ref|YP_003042247.1| ATP-dependent Clp protease proteolytic subunit [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782341|emb|CAQ85505.1| ATP-dependent proteolytic subunit of clpA-ClpP serine protease,
           heat shock protein F21.5 [Photorhabdus asymbiotica]
          Length = 207

 Score =  245 bits (626), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 133/202 (65%), Positives = 167/202 (82%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           K+D     + LVPMV+EQT RGERS+DIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLE
Sbjct: 6   KRDQYVPHMALVPMVIEQTARGERSFDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLE 65

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG +G R
Sbjct: 66  AENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAEGKR 125

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GGF GQASDIE HAQ+I+K+K R+N +  K+ GK+ EE+EK  +RD
Sbjct: 126 FCLPNSRVMIHQPLGGFQGQASDIEIHAQEILKVKGRMNSLMAKHTGKSLEEIEKDTERD 185

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
             +SASEA ++G+VDK+   R 
Sbjct: 186 RFLSASEAVEYGLVDKIFTHRD 207


>gi|161511142|ref|NP_539791.2| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|225852610|ref|YP_002732843.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           ATCC 23457]
 gi|256044767|ref|ZP_05447671.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256113666|ref|ZP_05454477.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 3 str. Ether]
 gi|256263897|ref|ZP_05466429.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260565631|ref|ZP_05836115.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|265991190|ref|ZP_06103747.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265995026|ref|ZP_06107583.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 3 str. Ether]
 gi|21759068|sp|Q8YHC8|CLPP_BRUME RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763784|sp|C0RJ81|CLPP_BRUMB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|225640975|gb|ACO00889.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           ATCC 23457]
 gi|260151699|gb|EEW86793.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|262766139|gb|EEZ11928.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 3 str. Ether]
 gi|263001974|gb|EEZ14549.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263094029|gb|EEZ17963.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           bv. 2 str. 63/9]
 gi|326409129|gb|ADZ66194.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           M28]
 gi|326538837|gb|ADZ87052.1| ATP-dependent Clp protease proteolytic subunit [Brucella melitensis
           M5-90]
          Length = 209

 Score =  245 bits (626), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 147/209 (70%), Positives = 182/209 (87%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  +  + LVPMVVEQTNRGER+YDI+SRLLKERI+FV G +ED M+ L+CAQLLFLE
Sbjct: 1   MRDPIETVMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVNGPVEDGMSMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI++YINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG  G R
Sbjct: 61  AENPKKEINMYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGATGHR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           +AL NARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYVK+ G+ Y+ +E+TLDRD
Sbjct: 121 YALLNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA ++G++DKV+ +R    ++SK
Sbjct: 181 HFMTAQEALEFGLIDKVVEARDVSADESK 209


>gi|260768947|ref|ZP_05877881.1| ATP-dependent Clp protease proteolytic subunit [Vibrio furnissii
           CIP 102972]
 gi|260616977|gb|EEX42162.1| ATP-dependent Clp protease proteolytic subunit [Vibrio furnissii
           CIP 102972]
 gi|315180643|gb|ADT87557.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           furnissii NCTC 11218]
          Length = 208

 Score =  245 bits (626), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 126/210 (60%), Positives = 163/210 (77%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLK+R++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNVMSPIIDALVPMVVEQTSRGERSYDIYSRLLKDRVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTLCIGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK +LN +   + G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKNKLNRLLADHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ MSA +A D+G+VD +L  R +
Sbjct: 179 ERDTDRDNFMSAQQAVDYGLVDALLTHRGE 208


>gi|312880128|ref|ZP_07739928.1| ATP-dependent Clp protease proteolytic subunit ClpP [Aminomonas
           paucivorans DSM 12260]
 gi|310783419|gb|EFQ23817.1| ATP-dependent Clp protease proteolytic subunit ClpP [Aminomonas
           paucivorans DSM 12260]
          Length = 201

 Score =  245 bits (626), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 120/201 (59%), Positives = 155/201 (77%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D       LVP VVEQT RGER+YDIYSRLLK+RIVF+  +IE+HMA L+ AQLLFLE
Sbjct: 1   MRDVPASRAALVPYVVEQTGRGERTYDIYSRLLKDRIVFLGEEIEEHMANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +E+P+K++ LYINSPGGVVTAGMAIYDTMQ+IK P+ST C GQAASM ++LL+ G KG R
Sbjct: 61  SEDPEKDVYLYINSPGGVVTAGMAIYDTMQYIKCPVSTICTGQAASMAAVLLAGGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
            ALP+ARI++HQP GG  GQA+DIE  A++I++++  LN+I V + G+  E ++   DRD
Sbjct: 121 IALPHARIMIHQPLGGAQGQATDIEIQAKEILRLREVLNQILVDHTGQPVERIKADTDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSR 208
             MSA EA  +G+VDKV+  R
Sbjct: 181 FFMSAPEAVAYGLVDKVIDKR 201


>gi|304437034|ref|ZP_07396997.1| ATP-dependent Clp protease proteolytic subunit [Selenomonas sp.
           oral taxon 149 str. 67H29BP]
 gi|304369985|gb|EFM23647.1| ATP-dependent Clp protease proteolytic subunit [Selenomonas sp.
           oral taxon 149 str. 67H29BP]
          Length = 203

 Score =  245 bits (626), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 114/202 (56%), Positives = 157/202 (77%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
               VPMVVE + RGER+YDIYSRLLKERI+F+ G I+D +A +I AQ+LFLE+E+P K+
Sbjct: 1   MSYYVPMVVETSGRGERAYDIYSRLLKERIIFLGGPIDDSVANVIVAQMLFLESEDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGGVVTAG+AIYDTMQ+IKP +ST C+GQAASMGS+LL+AG KG R+ALP+AR
Sbjct: 61  IHLYINSPGGVVTAGLAIYDTMQYIKPDVSTICVGQAASMGSILLTAGAKGKRYALPHAR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQ++DI+  A++I++++   NEI   + G+  E++    +RD+ MSA E
Sbjct: 121 IMIHQPLGGAQGQSTDIQIQAKEILRLREVGNEILAHHTGQDTEKINVDTERDNFMSAEE 180

Query: 195 ACDWGVVDKVLMSRIDIEEKSK 216
           A ++G++D+V++   D    SK
Sbjct: 181 AKEYGLIDEVVLRPKDTSADSK 202


>gi|153829246|ref|ZP_01981913.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae 623-39]
 gi|148875284|gb|EDL73419.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           cholerae 623-39]
          Length = 200

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 125/199 (62%), Positives = 159/199 (79%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
             +F   VPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP
Sbjct: 2   SPIFDAXVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G  G R+ LP
Sbjct: 62  DKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLAGGAPGKRYVLP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDI+ HAQ+I+ IK +LN +  ++ G+  E +E+  DRD+ MS
Sbjct: 122 NSRVMIHQPLGGFQGQASDIQIHAQEILTIKNKLNRLLAEHTGQPIEVIERDTDRDNFMS 181

Query: 192 ASEACDWGVVDKVLMSRID 210
           A +A ++G+VD VL  R +
Sbjct: 182 ADQAVEYGLVDAVLKHRGE 200


>gi|146277488|ref|YP_001167647.1| ATP-dependent Clp protease proteolytic subunit [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166214703|sp|A4WSH8|CLPP_RHOS5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|145555729|gb|ABP70342.1| Endopeptidase Clp [Rhodobacter sphaeroides ATCC 17025]
          Length = 210

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 132/210 (62%), Positives = 178/210 (84%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D+++  LVPMVVEQT+RGER+YDI+SR+LKERI+F++G + D M++LICAQLLFL
Sbjct: 1   MKDPIDLYMNTLVPMVVEQTSRGERAYDIFSRMLKERIIFLSGPVHDGMSSLICAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEI++YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AGEKGM
Sbjct: 61  EAENPSKEIAMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGG+ GQA+DI  HA++  K+KRRLNEIYVK+ G+  + VE  L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGYQGQATDIMIHARETEKLKRRLNEIYVKHTGQDLDTVEAALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           D+ MSA +A  WG++D++L SR   ++ +K
Sbjct: 181 DNFMSAEDAKAWGLIDEILESRGKTDDTAK 210


>gi|253575671|ref|ZP_04853007.1| clp protease [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845009|gb|EES73021.1| clp protease [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 196

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 118/192 (61%), Positives = 155/192 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLK+RI+F++  I+D +A L+ AQLLFL AE+P+K+I
Sbjct: 1   MSLVPMVVEQTNRGERSYDIYSRLLKDRIIFLSNAIDDEVANLVIAQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGM IYDTMQ+IKP +ST C+G AASMGSLLL+AG  G R+ALPN+ +
Sbjct: 61  HLYINSPGGSVTAGMGIYDTMQYIKPDVSTICVGMAASMGSLLLTAGAPGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA  I+K +++LN+IYV+  G+  E++E+  DRD  MSA EA
Sbjct: 121 MIHQPLGGVRGQATDIKIHADWIIKTRQKLNQIYVERTGQPLEKIERDTDRDFFMSAEEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++D+V+  
Sbjct: 181 KAYGIIDQVISK 192


>gi|37527729|ref|NP_931074.1| ATP-dependent Clp protease proteolytic subunit [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|60389709|sp|Q7N0L3|CLPP_PHOLL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|36787165|emb|CAE16241.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 (Endopeptidase Clp)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 207

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 131/202 (64%), Positives = 164/202 (81%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           K+D     + LVPMVVEQT RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ AQ+LFLE
Sbjct: 6   KRDQYAPHMALVPMVVEQTTRGERSYDIYSRLLKERIIFLTGQVEDHMANLVAAQMLFLE 65

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG R
Sbjct: 66  AENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKR 125

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
             LPN+R+++HQP GGF GQA+DIE HAQ+I+K+K R+NE+  K+ G+  EE+ K  +RD
Sbjct: 126 ICLPNSRVMIHQPLGGFQGQATDIEIHAQEILKVKSRMNELMAKHTGRPIEEIAKDTERD 185

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
             +SA EA ++G+VDK+   R 
Sbjct: 186 RFLSADEAVEYGLVDKIFTHRD 207


>gi|163751869|ref|ZP_02159083.1| ATP-dependent Clp protease proteolytic subunit [Shewanella benthica
           KT99]
 gi|161328219|gb|EDP99383.1| ATP-dependent Clp protease proteolytic subunit [Shewanella benthica
           KT99]
          Length = 203

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 122/201 (60%), Positives = 159/201 (79%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +   E VF  LVPMVVEQT +GERSYDIYSRLLKERI+F+ G +E+HMA L+ AQLLFL
Sbjct: 1   MQNAPESVFNALVPMVVEQTAKGERSYDIYSRLLKERIIFLVGPVEEHMANLVVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G  G 
Sbjct: 61  ESESPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPDVSTVCIGQAASMGAFLLAGGAAGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++  ++ G++ E +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKDKLNQMLAEHTGQSLEVIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMS 207
           D+ MSA++A ++G++D V+  
Sbjct: 181 DNFMSAAQAAEYGLIDSVMSK 201


>gi|332041211|gb|EGI77575.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Hylemonella
           gracilis ATCC 19624]
          Length = 194

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 113/194 (58%), Positives = 157/194 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +G+VP+V+EQ+ RGERSYDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP KEI
Sbjct: 1   MGMVPIVIEQSGRGERSYDIYSRLLRERVIFLVGPVNDQTANLVVAQLLFLESENPDKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGM+I+DTM FIKP +ST C+G AASMG+ LL+AG KG RF+LPN++I
Sbjct: 61  SLYINSPGGSVSAGMSIFDTMNFIKPDVSTLCIGMAASMGAFLLAAGAKGKRFSLPNSKI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE HA++I+K + +LN+I  +  G+  E++E+  +RD+ +SA EA
Sbjct: 121 MIHQPLGGAQGQATEIEIHAREILKTREQLNKILAERTGQPLEKIERDTERDYYLSADEA 180

Query: 196 CDWGVVDKVLMSRI 209
            D+G+VD+V+  R 
Sbjct: 181 KDYGLVDQVIAKRP 194


>gi|148259928|ref|YP_001234055.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acidiphilium
           cryptum JF-5]
 gi|146401609|gb|ABQ30136.1| ATP-dependent Clp protease proteolytic subunit ClpP [Acidiphilium
           cryptum JF-5]
          Length = 211

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 131/210 (62%), Positives = 173/210 (82%), Gaps = 1/210 (0%)

Query: 6   CAKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLL 64
              +D  ++++  LVPMVVEQT RGERSYDI+SRLLKERI+F+TG + D + +LI AQLL
Sbjct: 2   PMDRDPTEIYMNSLVPMVVEQTARGERSYDIFSRLLKERIIFLTGPVYDQVGSLIAAQLL 61

Query: 65  FLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEK 124
           FLE+ENP KEI+ YINSPGGVV+AG+AIYDTMQ+IK P+ST C+GQAASMGSLLL+AGEK
Sbjct: 62  FLESENPSKEIAFYINSPGGVVSAGLAIYDTMQYIKSPVSTVCIGQAASMGSLLLAAGEK 121

Query: 125 GMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL 184
           G RFALPN+RI++HQPSGG  GQASDIE  A++I+ ++RRLN+IYV + G++ E +E+ L
Sbjct: 122 GKRFALPNSRIMVHQPSGGAQGQASDIEIQAREILTLRRRLNDIYVTHTGQSLEAIEQAL 181

Query: 185 DRDHIMSASEACDWGVVDKVLMSRIDIEEK 214
           +RD  MSA+EA ++G+VD+V+  +   + K
Sbjct: 182 ERDRFMSANEAQEFGLVDEVVEKKPAKDSK 211


>gi|188996270|ref|YP_001930521.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931337|gb|ACD65967.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 201

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 118/199 (59%), Positives = 160/199 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           + +   L+P+V+EQT RGER+YDIYSRLLK+RI+ +   I+DH+A L+ AQLLFLE+E+P
Sbjct: 2   DKILNQLIPIVIEQTPRGERAYDIYSRLLKDRIILLGTPIDDHIANLVVAQLLFLESEDP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I +YINSPGGVVTAG+AIYDTM +IKP + T CMGQAASMG+ LLSAG KG R++LP
Sbjct: 62  DKDIYMYINSPGGVVTAGLAIYDTMNYIKPDVVTICMGQAASMGAFLLSAGAKGKRYSLP 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           NARI++HQP GGF GQA+DIE HA++I+++KR LNE   K+ G+  E++E   +RD+ MS
Sbjct: 122 NARIMIHQPLGGFQGQATDIEIHAREILRLKRMLNEYLAKHTGQPIEKIEADTERDYFMS 181

Query: 192 ASEACDWGVVDKVLMSRID 210
           A EA ++G++DKV+  R +
Sbjct: 182 AEEAKEYGLIDKVIYKRGE 200


>gi|294788594|ref|ZP_06753836.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Simonsiella
           muelleri ATCC 29453]
 gi|294483471|gb|EFG31156.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Simonsiella
           muelleri ATCC 29453]
          Length = 206

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 114/203 (56%), Positives = 155/203 (76%), Gaps = 2/203 (0%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
            E     L+P V+EQ+ RGER++DIYSRLLKERI+F+ G + DH A L+ AQLLFLE+EN
Sbjct: 3   PEIQNNTLIPTVIEQSGRGERAFDIYSRLLKERIIFLVGPVNDHTANLVVAQLLFLESEN 62

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I  YINSPGG V+AGM+I+DTM FIKP + T C+GQAASMG+ LLSAG KG RFAL
Sbjct: 63  PDKDIYFYINSPGGSVSAGMSIFDTMNFIKPDVQTLCLGQAASMGAFLLSAGAKGKRFAL 122

Query: 131 PNARILLHQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           PN+RI++HQP       GQASDIE HA++++K+K +LN +  K+ G+  E++E+  DRD+
Sbjct: 123 PNSRIMIHQPLISGGLGGQASDIEIHARELIKLKEKLNNLLAKHTGQPLEKIERDTDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSRIDI 211
            MSA  A ++G++DKV+ +R ++
Sbjct: 183 FMSAQTAMEYGLIDKVITNREEV 205


>gi|221068424|ref|ZP_03544529.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Comamonas
           testosteroni KF-1]
 gi|220713447|gb|EED68815.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Comamonas
           testosteroni KF-1]
          Length = 202

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 117/194 (60%), Positives = 155/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGMAI+DTM FIKP +ST C G AASMG+ LLSAG KG R+ALPNA++
Sbjct: 69  SFYINSPGGSVTAGMAIFDTMNFIKPDVSTLCTGMAASMGAFLLSAGAKGKRYALPNAQV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE HA++I+K + RLN+I  +  G+  E+++   +RD+ +SA EA
Sbjct: 129 MIHQPLGGARGQATEIEIHAREILKTRERLNKILAERTGQPLEKIQNDTERDYFLSADEA 188

Query: 196 CDWGVVDKVLMSRI 209
            D+G+VD+V+  R 
Sbjct: 189 KDYGLVDQVISKRS 202


>gi|183601061|ref|ZP_02962554.1| hypothetical protein PROSTU_04684 [Providencia stuartii ATCC 25827]
 gi|188019401|gb|EDU57441.1| hypothetical protein PROSTU_04684 [Providencia stuartii ATCC 25827]
          Length = 206

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 131/208 (62%), Positives = 169/208 (81%), Gaps = 2/208 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +  +    + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYFGGQENLASQ--MALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAENPEKDIQLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DI+ HAQ+I+K+K R+NE+   + GK+ EE+
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGYQGQATDIQIHAQEILKVKTRMNELMALHTGKSVEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSR 208
            +  +RD  +SA EA ++G+VD +  SR
Sbjct: 179 NRDTERDRFLSADEAKEYGLVDHIYTSR 206


>gi|296134054|ref|YP_003641301.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermincola
           sp. JR]
 gi|296032632|gb|ADG83400.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermincola
           potens JR]
          Length = 194

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 120/194 (61%), Positives = 156/194 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGER+YDIYSRLLK+RI+F+ G I+D +A L+ AQ+LFLEAE+P K+I
Sbjct: 1   MNLVPIVVEQTNRGERAYDIYSRLLKDRIIFIGGPIDDMVANLVIAQMLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVTAGMAIYDTMQ+IKP +ST CMGQAASMGS LL+AG KG R+ALP  RI
Sbjct: 61  HIYINSPGGVVTAGMAIYDTMQYIKPDVSTICMGQAASMGSFLLAAGTKGKRYALPYTRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA++I+++K  LNE+  K+ G+  E + +  +RD  MSA EA
Sbjct: 121 MIHQPLGGVQGQATDIDIHAKEILRMKSVLNELLAKHTGQPVEVIARDTERDFFMSAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G+VD+V+  R 
Sbjct: 181 RKYGIVDEVISVRK 194


>gi|319898776|ref|YP_004158869.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella
           clarridgeiae 73]
 gi|319402740|emb|CBI76287.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella
           clarridgeiae 73]
          Length = 210

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 150/209 (71%), Positives = 180/209 (86%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D     L LVPMVVEQTNRGER+YDI+SRLLKERI+F+ G +ED+MA L+CAQLLFLE
Sbjct: 1   MSDPIKTALSLVPMVVEQTNRGERAYDIFSRLLKERIIFINGPVEDNMAMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVT+GMAIYDTMQFI+P +ST CMGQAASMGSLLL+AG  G R
Sbjct: 61  AENPKKEINLYINSPGGVVTSGMAIYDTMQFIRPSVSTLCMGQAASMGSLLLTAGATGRR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNARI++HQPSGGF GQASDIERHAQDIVK+KRRLNEIYV++ G++YE +EKTLDRD
Sbjct: 121 FALPNARIMVHQPSGGFQGQASDIERHAQDIVKMKRRLNEIYVQHTGQSYEVIEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A E+  +G++D V+  R + E++ K
Sbjct: 181 HFMTAEESKQFGLIDDVIQYRAETEKEEK 209


>gi|320354136|ref|YP_004195475.1| ATP-dependent Clp protease proteolytic subunit ClpP [Desulfobulbus
           propionicus DSM 2032]
 gi|320122638|gb|ADW18184.1| ATP-dependent Clp protease proteolytic subunit ClpP [Desulfobulbus
           propionicus DSM 2032]
          Length = 200

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 115/200 (57%), Positives = 165/200 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQ+ RGER++DIYSRLLKERI+F+  Q+ D +A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MNLVPMVVEQSPRGERAFDIYSRLLKERIIFLGTQVNDDVASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGG VTAGMAIYDTMQ+I+  ++T CMGQAASMG+LLL++G  G RFALPN+RI
Sbjct: 61  TFYINSPGGSVTAGMAIYDTMQYIRCDVATLCMGQAASMGALLLASGAAGKRFALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DI+ HA++I++++  LN I  ++ GK+ ++++   +RD+ MSA+EA
Sbjct: 121 MIHQPMGGYQGQATDIDIHAREILRMRHDLNTILARHTGKSMKKIQADTERDNFMSATEA 180

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
           C++G++DKVL +R ++  + 
Sbjct: 181 CEYGIIDKVLTNREELGGEK 200


>gi|158423232|ref|YP_001524524.1| ATP-dependent Clp protease proteolytic subunit [Azorhizobium
           caulinodans ORS 571]
 gi|172047856|sp|A8HYF2|CLPP_AZOC5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|158330121|dbj|BAF87606.1| ATP-dependent Clp protease proteolytic subunit [Azorhizobium
           caulinodans ORS 571]
          Length = 210

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 138/209 (66%), Positives = 175/209 (83%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  D ++  LVPMVVEQTNRGER+YDIYSRLLKERI+F+TG +ED M+TL  AQLLFL
Sbjct: 1   MRDPVDTYMNYLVPMVVEQTNRGERAYDIYSRLLKERIIFLTGPVEDGMSTLAVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+P +ST C+GQAASMGSLLL+AGEKG+
Sbjct: 61  EAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPAVSTLCIGQAASMGSLLLTAGEKGL 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPNARI++HQPSGGF GQ +DI  HAQ+I+ +K+RLNEIYVK+ G+  E++E  L+R
Sbjct: 121 RFALPNARIMVHQPSGGFQGQVTDIMLHAQEILSLKKRLNEIYVKHTGQPIEKIEDALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ M+A+ A ++G++D V+  R   E   
Sbjct: 181 DNFMTANAAQEFGLIDTVIDKRPSDEPAK 209


>gi|153813468|ref|ZP_01966136.1| hypothetical protein RUMOBE_03888 [Ruminococcus obeum ATCC 29174]
 gi|149830412|gb|EDM85504.1| hypothetical protein RUMOBE_03888 [Ruminococcus obeum ATCC 29174]
          Length = 193

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 115/193 (59%), Positives = 150/193 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A++I AQLLFLEAE+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVNDVSASVIVAQLLFLEAEDPSKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTM++IK  +ST C+G AASMG+ LL+ G KG RFALP++ I
Sbjct: 61  QLYINSPGGSVTAGMAIYDTMKYIKCDVSTICLGMAASMGAFLLAGGTKGKRFALPHSTI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A  I + KR LNEI  +N G+ YE VEK  DRD+ M+A EA
Sbjct: 121 MIHQPSGGAQGQATEIQIVADHIAQTKRTLNEILAENTGQPYEVVEKDTDRDNYMTAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D V+  +
Sbjct: 181 KAYGLIDGVVEHK 193


>gi|312882507|ref|ZP_07742248.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369907|gb|EFP97418.1| ATP-dependent Clp protease proteolytic subunit [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 208

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 126/210 (60%), Positives = 165/210 (78%), Gaps = 2/210 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--EKNAMSPILDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  + +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKKKLNTLLAEHTGQPLDVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           E+  DRD+ MSA +A ++G+VD +L  R +
Sbjct: 179 ERDTDRDNFMSADQAVEYGLVDSMLTHRSE 208


>gi|295689638|ref|YP_003593331.1| endopeptidase Clp [Caulobacter segnis ATCC 21756]
 gi|295431541|gb|ADG10713.1| Endopeptidase Clp [Caulobacter segnis ATCC 21756]
          Length = 210

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 150/210 (71%), Positives = 178/210 (84%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
              D     + LVPMVVEQT+RGER++DI+SRLLKERI+F+TG +ED MA+LICAQLLFL
Sbjct: 1   MMYDPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP+KEI++YINSPGGVVTAG+AIYDTMQ+IK P+ST CMG AASMGSLLL+AG  G 
Sbjct: 61  ESENPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQ 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R +LPNARI++HQPSGGF GQASDIERHA+DI+K KRRLNEIYVK+CG+TYEEVE+TLDR
Sbjct: 121 RISLPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           DH MSA EA  WG+VD V  SR   E  ++
Sbjct: 181 DHFMSADEAKAWGLVDHVYDSREAAEAGAE 210


>gi|149916365|ref|ZP_01904885.1| phosphoglycerate kinase [Roseobacter sp. AzwK-3b]
 gi|149809819|gb|EDM69671.1| phosphoglycerate kinase [Roseobacter sp. AzwK-3b]
          Length = 210

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 176/209 (84%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             D  + ++  LVPMVVEQT+RGER+YDI+SRLLKERI+FV G + D M++LI AQLL L
Sbjct: 1   MTDPYETYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFVNGPVHDGMSSLIVAQLLHL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGEKGM
Sbjct: 61  EAENPAKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+RI++HQPSGG+ GQA+DI  HA++ +K+K+RLN+IYVK+ G+T ++VE  L+R
Sbjct: 121 RFSLPNSRIMVHQPSGGYQGQATDIMIHAEETLKLKKRLNQIYVKHTGQTLKKVEDALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ MS  EA +WG++D+++ SR+  +++ 
Sbjct: 181 DNFMSPEEAKNWGLIDEIVESRVKTDDEK 209


>gi|167766384|ref|ZP_02438437.1| hypothetical protein CLOSS21_00888 [Clostridium sp. SS2/1]
 gi|317496812|ref|ZP_07955142.1| Clp protease [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167711975|gb|EDS22554.1| hypothetical protein CLOSS21_00888 [Clostridium sp. SS2/1]
 gi|291559217|emb|CBL38017.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [butyrate-producing bacterium SSC/2]
 gi|316895824|gb|EFV17976.1| Clp protease [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 193

 Score =  245 bits (626), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 114/193 (59%), Positives = 153/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A L+ +QLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVNDVTAGLVVSQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAGMAIYDTMQ++K  +ST CMG AASMG+ LLS G KG R ALPNA I
Sbjct: 61  NLYINSPGGSVTAGMAIYDTMQYVKCDVSTMCMGMAASMGAFLLSGGTKGKRLALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++IE  A+ I++ K++LN I  +N G+ YE + K  +RD+ ++A EA
Sbjct: 121 MIHQPSGGAQGQATEIEIAAEHILRTKKKLNTILSENTGQPYETIVKDTERDNWLTAQEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKV+ +R
Sbjct: 181 LEYGLIDKVMENR 193


>gi|110680063|ref|YP_683070.1| ATP-dependent Clp protease proteolytic subunit [Roseobacter
           denitrificans OCh 114]
 gi|116243162|sp|Q165F9|CLPP_ROSDO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|109456179|gb|ABG32384.1| Clp protease, putative [Roseobacter denitrificans OCh 114]
          Length = 208

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 126/207 (60%), Positives = 170/207 (82%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            KD  + ++ LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LE
Sbjct: 1   MKDPIETYMNLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMR
Sbjct: 61  AENPAKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+R+++HQPSGG+ GQA+DI  HA +  K+K RLNEIYVK+ G+T ++V   L+RD
Sbjct: 121 FSLPNSRVMVHQPSGGYQGQATDIMIHAAETQKLKDRLNEIYVKHTGQTMKKVVDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEK 214
           + MS  EA ++G++D+++ +R   + +
Sbjct: 181 NFMSPEEAKEFGLIDEIVENRSKDDAE 207


>gi|90410782|ref|ZP_01218797.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium
           profundum 3TCK]
 gi|90328413|gb|EAS44711.1| ATP-dependent Clp protease proteolytic subunit [Photobacterium
           profundum 3TCK]
          Length = 207

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 164/209 (78%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++   +     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--ERNAMSPITDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G KG R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK+RLN +  ++ G+  E V
Sbjct: 119 GGAKGKRYCLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKQRLNNLLAEHTGQPLEIV 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E   DRD+ MSA +A ++G+VD VL  R 
Sbjct: 179 EGDTDRDNFMSADQAVEYGLVDSVLTQRD 207


>gi|15965008|ref|NP_385361.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium
           meliloti 1021]
 gi|307301080|ref|ZP_07580849.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sinorhizobium
           meliloti BL225C]
 gi|307317814|ref|ZP_07597252.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sinorhizobium
           meliloti AK83]
 gi|18202306|sp|P58278|CLPP2_RHIME RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|15074187|emb|CAC45834.1| Probable ATP-dependent CLP protease proteolytic subunit
           [Sinorhizobium meliloti 1021]
 gi|306896576|gb|EFN27324.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sinorhizobium
           meliloti AK83]
 gi|306904035|gb|EFN34621.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sinorhizobium
           meliloti BL225C]
          Length = 208

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 159/205 (77%), Positives = 186/205 (90%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLE
Sbjct: 1   MRNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDHMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KE++LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEVALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+CG+TYEEVE+TLDRD
Sbjct: 121 FATPNSRIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHCGRTYEEVEQTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIE 212
           H MSA EA DWG++DKV+ SR  +E
Sbjct: 181 HFMSADEALDWGLIDKVITSRDAVE 205


>gi|264677387|ref|YP_003277293.1| ATP-dependent Clp protease proteolytic subunit [Comamonas
           testosteroni CNB-2]
 gi|299533085|ref|ZP_07046471.1| ATP-dependent Clp protease, proteolytic subunit [Comamonas
           testosteroni S44]
 gi|262207899|gb|ACY31997.1| ATP-dependent Clp protease, proteolytic subunit [Comamonas
           testosteroni CNB-2]
 gi|298718970|gb|EFI59941.1| ATP-dependent Clp protease, proteolytic subunit [Comamonas
           testosteroni S44]
          Length = 202

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 116/194 (59%), Positives = 155/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG VTAGMAI+DTM FIKP +ST C G AASMG+ LLSAG KG R+ALPNA++
Sbjct: 69  SFYINSPGGSVTAGMAIFDTMNFIKPDVSTLCTGMAASMGAFLLSAGAKGKRYALPNAQV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE HA++I+K + RLN+I  +  G+  E+++   +RD+ +SA EA
Sbjct: 129 MIHQPLGGARGQATEIEIHAREIIKTRERLNKILAERTGQPLEKIQNDTERDYFLSADEA 188

Query: 196 CDWGVVDKVLMSRI 209
            ++G+VD+V+  R 
Sbjct: 189 KEYGLVDQVISKRS 202


>gi|319794078|ref|YP_004155718.1| ATP-dependent clp protease, proteolytic subunit clpp [Variovorax
           paradoxus EPS]
 gi|315596541|gb|ADU37607.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Variovorax
           paradoxus EPS]
          Length = 202

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 119/193 (61%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG+VPMVVEQ+ RGERSYDIYSRLLKERIVF+ G++ D  A L+ AQLLFLE+ENP+K+I
Sbjct: 9   LGMVPMVVEQSGRGERSYDIYSRLLKERIVFLVGEVNDQTANLVVAQLLFLESENPEKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V+AGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG RF+LPN+++
Sbjct: 69  SFYINSPGGSVSAGMAIYDTMQFIKPDVSTMCLGFAASMGAFLLAAGEKGKRFSLPNSKV 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD+ ++A EA
Sbjct: 129 MIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPLEKVKTDTERDYFLTADEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G+VD+V+  R
Sbjct: 189 KDYGLVDQVVAKR 201


>gi|260427575|ref|ZP_05781554.1| Clp protease [Citreicella sp. SE45]
 gi|260422067|gb|EEX15318.1| Clp protease [Citreicella sp. SE45]
          Length = 210

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 134/209 (64%), Positives = 174/209 (83%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D ++  LVPMVVEQT+RGER+YDI+SRLLKERI+FV+G + D M++LI AQLL L
Sbjct: 1   MKDPFDTYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFVSGPVHDGMSSLIVAQLLHL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP IST  +GQAASMGSLLL+AGE GM
Sbjct: 61  EAENPAKEISMYINSPGGVVTSGLSIYDTMQYIKPKISTLVIGQAASMGSLLLTAGEAGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+RI++HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYV++ G+T E+VE  L+R
Sbjct: 121 RFSLPNSRIMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVRHTGQTLEKVEAALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ MS  +A +WG++D+++ SR   E   
Sbjct: 181 DNFMSPEDAKEWGLIDEIVESRGAAEASK 209


>gi|221234978|ref|YP_002517414.1| ATP-dependent Clp protease proteolytic subunit [Caulobacter
           crescentus NA1000]
 gi|220964150|gb|ACL95506.1| ATP-dependent endopeptidase clp, proteolytic subunit ClpP
           [Caulobacter crescentus NA1000]
          Length = 213

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 150/211 (71%), Positives = 178/211 (84%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
               D     + LVPMVVEQT+RGER++DI+SRLLKERI+F+TG +ED MA+LICAQLLF
Sbjct: 3   PMMYDPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLF 62

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP+KEI++YINSPGGVVTAG+AIYDTMQ+IK P+ST CMG AASMGSLLL+AG  G
Sbjct: 63  LESENPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAG 122

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            R +LPNARI++HQPSGGF GQASDIERHA+DI+K KRRLNEIYVK+CG+TYEEVE+TLD
Sbjct: 123 QRISLPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLD 182

Query: 186 RDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           RDH MSA EA  WG+VD V  SR   E  ++
Sbjct: 183 RDHFMSADEAKAWGLVDHVYDSRDAAEAGAE 213


>gi|222085564|ref|YP_002544094.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Agrobacterium
           radiobacter K84]
 gi|221723012|gb|ACM26168.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Agrobacterium
           radiobacter K84]
          Length = 210

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 162/208 (77%), Positives = 190/208 (91%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLE
Sbjct: 1   MRNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDHMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP IST C+GQAASMGSLLL+AG+K MR
Sbjct: 61  AENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAISTLCIGQAASMGSLLLAAGDKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNEIYVK+CG+TYEEVE+TLDRD
Sbjct: 121 FATPNSRIMVHQPSGGFQGQASDIERHARDIIKMKRRLNEIYVKHCGRTYEEVEQTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKS 215
           H MS+ EA DWG++DKVL SR ++E ++
Sbjct: 181 HFMSSDEAKDWGLIDKVLTSRTEMEGEA 208


>gi|84515416|ref|ZP_01002778.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Loktanella
           vestfoldensis SKA53]
 gi|84510699|gb|EAQ07154.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Loktanella
           vestfoldensis SKA53]
          Length = 198

 Score =  245 bits (625), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 123/198 (62%), Positives = 164/198 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT RGER+YDI+SRLLKERI+F+ G + D M+ L+ AQLL LE+ENP+KEI
Sbjct: 1   MNLVPMVVEQTARGERAYDIFSRLLKERIIFLNGPVHDGMSQLVVAQLLHLESENPKKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AG  GMRF+LPN+R+
Sbjct: 61  SMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGHPGMRFSLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG+ GQA+DI  HA +  K+K RLNEIYVK+ G+  ++VE  L+RD+ MS  EA
Sbjct: 121 MVHQPSGGYQGQATDIMIHAAETQKLKTRLNEIYVKHTGQPLKKVETALERDNFMSPEEA 180

Query: 196 CDWGVVDKVLMSRIDIEE 213
            +WG++D+++++R    E
Sbjct: 181 KEWGLIDEIVVNREKSSE 198


>gi|253681101|ref|ZP_04861904.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum D str. 1873]
 gi|331270305|ref|YP_004396797.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum BKT015925]
 gi|253562950|gb|EES92396.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum D str. 1873]
 gi|329126855|gb|AEB76800.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum BKT015925]
          Length = 195

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 120/195 (61%), Positives = 155/195 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+F+  ++ D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIFLGEEVNDVSASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  YLYINSPGGSITAGMAIYDTMQYIKPDVSTICIGMAASMGAFLLTAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA  I+KIK +LN+I  +  GK  E ++K ++RD+ M A EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHANRILKIKDKLNKILSERTGKPLEVIKKDVERDNFMEADEA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D V+ SR  
Sbjct: 181 KEYGLIDDVITSRKK 195


>gi|16126206|ref|NP_420770.1| ATP-dependent Clp protease, proteolytic subunit [Caulobacter
           crescentus CB15]
 gi|3688205|emb|CAA09090.1| endopeptidase clp [Caulobacter crescentus CB15]
 gi|13423424|gb|AAK23938.1| ATP-dependent Clp protease, proteolytic subunit [Caulobacter
           crescentus CB15]
          Length = 210

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 150/210 (71%), Positives = 178/210 (84%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
              D     + LVPMVVEQT+RGER++DI+SRLLKERI+F+TG +ED MA+LICAQLLFL
Sbjct: 1   MMYDPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP+KEI++YINSPGGVVTAG+AIYDTMQ+IK P+ST CMG AASMGSLLL+AG  G 
Sbjct: 61  ESENPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQ 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R +LPNARI++HQPSGGF GQASDIERHA+DI+K KRRLNEIYVK+CG+TYEEVE+TLDR
Sbjct: 121 RISLPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           DH MSA EA  WG+VD V  SR   E  ++
Sbjct: 181 DHFMSADEAKAWGLVDHVYDSRDAAEAGAE 210


>gi|217967475|ref|YP_002352981.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dictyoglomus
           turgidum DSM 6724]
 gi|217336574|gb|ACK42367.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dictyoglomus
           turgidum DSM 6724]
          Length = 194

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 116/193 (60%), Positives = 156/193 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+V+EQT RGER+YDIYSRLLK RIVF+   I D +A LI AQLLFLE+E+P+K+I L
Sbjct: 2   LVPIVIEQTPRGERAYDIYSRLLKSRIVFLGTTINDEVANLIVAQLLFLESEDPEKDIYL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V+AG+AIYDT++ IKP ++T C+GQAASM ++LL+AG+KG R+ALP++R+++
Sbjct: 62  YINSPGGEVSAGLAIYDTIRHIKPKVATVCVGQAASMAAILLAAGDKGKRYALPHSRVMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  G A+DIE H ++I+KIKR LNEI   + G+  E++EK  DRD  MSA EA +
Sbjct: 122 HQPLGGAYGPAADIEIHTREILKIKRVLNEILAYHTGQPIEKIEKDTDRDFFMSAYEAKE 181

Query: 198 WGVVDKVLMSRID 210
           +G+VD+VL S+ +
Sbjct: 182 YGIVDEVLESKKE 194


>gi|239977100|sp|P0CAU1|CLPP_CAUCR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|239977114|sp|B8GX16|CLPP_CAUCN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 209

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 150/207 (72%), Positives = 178/207 (85%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D     + LVPMVVEQT+RGER++DI+SRLLKERI+F+TG +ED MA+LICAQLLFLE+E
Sbjct: 3   DPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+KEI++YINSPGGVVTAG+AIYDTMQ+IK P+ST CMG AASMGSLLL+AG  G R +
Sbjct: 63  NPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQRIS 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNARI++HQPSGGF GQASDIERHA+DI+K KRRLNEIYVK+CG+TYEEVE+TLDRDH 
Sbjct: 123 LPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDRDHF 182

Query: 190 MSASEACDWGVVDKVLMSRIDIEEKSK 216
           MSA EA  WG+VD V  SR   E  ++
Sbjct: 183 MSADEAKAWGLVDHVYDSRDAAEAGAE 209


>gi|319763664|ref|YP_004127601.1| ATP-dependent clp protease, proteolytic subunit clpp
           [Alicycliphilus denitrificans BC]
 gi|330824071|ref|YP_004387374.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Alicycliphilus denitrificans K601]
 gi|317118225|gb|ADV00714.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Alicycliphilus denitrificans BC]
 gi|329309443|gb|AEB83858.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Alicycliphilus denitrificans K601]
          Length = 202

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 118/202 (58%), Positives = 156/202 (77%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
               E   LG++PMV+EQ+ RGERSYDIYSRLLKER++F+ G++ D  A L+ AQLLFLE
Sbjct: 1   MSALETQALGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGEVNDQTANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+IS YINSPGG VTAGMAIYDTMQFIKP +ST C G AASMG+ LL+AG KG R
Sbjct: 61  SENPDKDISFYINSPGGSVTAGMAIYDTMQFIKPDVSTLCCGFAASMGAFLLAAGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN++I++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G++ E+V+   +RD
Sbjct: 121 FSLPNSKIMIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQSIEKVKADTERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + M+A EA D+G+VD+V+  R 
Sbjct: 181 YFMTADEARDYGLVDQVISKRP 202


>gi|300311895|ref|YP_003775987.1| ATP-dependent Clp protease proteolytic subunit [Herbaspirillum
           seropedicae SmR1]
 gi|124483356|emb|CAM32551.1| ATP-dependent Clp protease (proteolytic subunit) protein
           [Herbaspirillum seropedicae]
 gi|300074680|gb|ADJ64079.1| ATP-dependent Clp protease (proteolytic subunit) protein
           [Herbaspirillum seropedicae SmR1]
          Length = 208

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 126/207 (60%), Positives = 160/207 (77%), Gaps = 1/207 (0%)

Query: 3   FEGCAKKDSEDV-FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
             G  K+ + D   LG+VPMV+EQ+ RGER+YDIYSRLLKERI+F+ G + D MA LI A
Sbjct: 1   MTGLMKQSALDTQMLGMVPMVIEQSGRGERAYDIYSRLLKERIIFLVGPVNDAMANLIVA 60

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLLFLE+ENP K+ISLYINSPGG V+AGMAI+DTMQFIKP +ST C G AASMG+ LL+A
Sbjct: 61  QLLFLESENPDKDISLYINSPGGSVSAGMAIFDTMQFIKPQVSTLCTGLAASMGAFLLAA 120

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG RF+LPN+RI++HQP GG  GQASDIE  A++I+ ++ RLN I  +  G+T E++ 
Sbjct: 121 GAKGKRFSLPNSRIMIHQPLGGAQGQASDIEIQAREILYLRERLNTILAEKTGRTVEQIS 180

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSR 208
           K  DRD+ MSA  A ++G++DKVL  R
Sbjct: 181 KDTDRDNFMSADAAAEYGLIDKVLTER 207


>gi|312796430|ref|YP_004029352.1| ATP-dependent endopeptidase clp proteolytic subunit clpP
           [Burkholderia rhizoxinica HKI 454]
 gi|312168205|emb|CBW75208.1| ATP-dependent endopeptidase clp proteolytic subunit clpP (EC
           3.4.21.92) [Burkholderia rhizoxinica HKI 454]
          Length = 238

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 122/201 (60%), Positives = 158/201 (78%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           +D E   LGLVPMVVE + RGER+YDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+
Sbjct: 38  RDFEAQALGLVPMVVETSGRGERAYDIYSRLLKERLVFLVGEVNDQAANLVVAQLLFLES 97

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP K+ISLYINSPGG V+AGMAIYDTMQFIKP ++T CMG AASMG+ LL+AG KG R 
Sbjct: 98  ENPDKDISLYINSPGGSVSAGMAIYDTMQFIKPDVTTLCMGLAASMGAFLLAAGAKGKRI 157

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNAR+++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E++++  DRD+
Sbjct: 158 ALPNARVMIHQPLGGARGQASDIEIQAREILFLKERLNNLLAQHTGQPVEQIQRDTDRDN 217

Query: 189 IMSASEACDWGVVDKVLMSRI 209
            MSA +A  +G++D+VL  R 
Sbjct: 218 FMSAEDAQAYGLIDQVLHKRP 238


>gi|326403118|ref|YP_004283199.1| ATP-dependent Clp protease proteolytic subunit [Acidiphilium
           multivorum AIU301]
 gi|325049979|dbj|BAJ80317.1| ATP-dependent Clp protease proteolytic subunit [Acidiphilium
           multivorum AIU301]
          Length = 209

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 173/209 (82%), Gaps = 1/209 (0%)

Query: 7   AKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
             +D  ++++  LVPMVVEQT RGERSYDI+SRLLKERI+F+TG + D + +LI AQLLF
Sbjct: 1   MDRDPTEIYMNSLVPMVVEQTARGERSYDIFSRLLKERIIFLTGPVYDQVGSLIAAQLLF 60

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP KEI+ YINSPGGVV+AG+AIYDTMQ+IK P+ST C+GQAASMGSLLL+AGEKG
Sbjct: 61  LESENPSKEIAFYINSPGGVVSAGLAIYDTMQYIKSPVSTVCIGQAASMGSLLLAAGEKG 120

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            RFALPN+RI++HQPSGG  GQASDIE  A++I+ ++RRLN+IYV + G++ E +E+ L+
Sbjct: 121 KRFALPNSRIMVHQPSGGAQGQASDIEIQAREILTLRRRLNDIYVTHTGQSLEAIEQALE 180

Query: 186 RDHIMSASEACDWGVVDKVLMSRIDIEEK 214
           RD  MSA+EA ++G+VD+V+  +   + K
Sbjct: 181 RDRFMSANEAQEFGLVDEVVEKKPAKDSK 209


>gi|86749681|ref|YP_486177.1| endopeptidase Clp [Rhodopseudomonas palustris HaA2]
 gi|116243157|sp|Q2IWZ4|CLPP_RHOP2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|86572709|gb|ABD07266.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Rhodopseudomonas palustris HaA2]
          Length = 212

 Score =  245 bits (625), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 137/203 (67%), Positives = 174/203 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED M+TL+ AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYV + G+TY+ +E  L+RD
Sbjct: 121 FSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVHHTGQTYKAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRID 210
             ++A  A D+G+VDKV+  R +
Sbjct: 181 KFLTADMARDFGIVDKVIDKRAE 203


>gi|315634780|ref|ZP_07890062.1| ATP-dependent Clp protease proteolytic subunit [Aggregatibacter
           segnis ATCC 33393]
 gi|315476332|gb|EFU67082.1| ATP-dependent Clp protease proteolytic subunit [Aggregatibacter
           segnis ATCC 33393]
          Length = 193

 Score =  244 bits (624), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 119/193 (61%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVV+QT+RGER+YDIYSRLLK+R++F++G++ED+MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVDQTSRGERAYDIYSRLLKDRVIFLSGEVEDNMANLIVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALP+AR+
Sbjct: 61  NLYINSPGGSVTAGMAIYDTMQFIKPDVRTLCVGQACSMGAFLLAGGAPGKRGALPHARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+  E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKGTLNERLAFHTGQPIETIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+V   R
Sbjct: 181 KNYGLIDEVFTKR 193


>gi|126700924|ref|YP_001089821.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile 630]
 gi|254976904|ref|ZP_05273376.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile QCD-66c26]
 gi|255094290|ref|ZP_05323768.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile CIP 107932]
 gi|255308377|ref|ZP_05352548.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile ATCC 43255]
 gi|255316044|ref|ZP_05357627.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile QCD-76w55]
 gi|255518701|ref|ZP_05386377.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile QCD-97b34]
 gi|255651823|ref|ZP_05398725.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile QCD-37x79]
 gi|255657263|ref|ZP_05402672.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile QCD-23m63]
 gi|260684849|ref|YP_003216134.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile CD196]
 gi|260688507|ref|YP_003219641.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile R20291]
 gi|296451896|ref|ZP_06893613.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile NAP08]
 gi|296879709|ref|ZP_06903684.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile NAP07]
 gi|306521610|ref|ZP_07407957.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile QCD-32g58]
 gi|115252361|emb|CAJ70202.1| ATP-dependent Clp protease proteolytic subunit 1 [Clostridium
           difficile]
 gi|260211012|emb|CBA66324.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile CD196]
 gi|260214524|emb|CBE07039.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile R20291]
 gi|296259278|gb|EFH06156.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile NAP08]
 gi|296429298|gb|EFH15170.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile NAP07]
          Length = 194

 Score =  244 bits (624), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 117/194 (60%), Positives = 151/194 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQT RGERSYDI+SRLLK+RI+F+  Q+ D  A LI AQLLFLEAE+P K+I
Sbjct: 1   MALVPVVVEQTGRGERSYDIFSRLLKDRIIFLGDQVNDATAGLIVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG R ALPN+ I
Sbjct: 61  HLYINSPGGSITSGMAIYDTMQYIKPDVSTICIGMAASMGAFLLAAGAKGKRLALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE HA+ I+KIK  LNEI  +  G+  E+++   +RD+ MSA EA
Sbjct: 121 MIHQPLGGAQGQATDIEIHAKRILKIKETLNEILSERTGQPLEKIKMDTERDNFMSALEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V   R 
Sbjct: 181 KEYGLIDEVFTKRP 194


>gi|157374680|ref|YP_001473280.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           sediminis HAW-EB3]
 gi|189082467|sp|A8FTH9|CLPP_SHESH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|157317054|gb|ABV36152.1| Endopeptidase Clp [Shewanella sediminis HAW-EB3]
          Length = 203

 Score =  244 bits (624), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 126/202 (62%), Positives = 159/202 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +   E V   LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+E+HMA LI AQLLFL
Sbjct: 1   MQNAPESVLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLVGQVEEHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ G +G 
Sbjct: 61  ESESPDKDIYLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGAEGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++   + G+  E +E+  DR
Sbjct: 121 RHCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNQMLADHTGQPMEIIERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D+ MSA+EA ++G+VD VL  R
Sbjct: 181 DNFMSAAEAAEYGLVDSVLSKR 202


>gi|150396095|ref|YP_001326562.1| ATP-dependent Clp protease proteolytic subunit [Sinorhizobium
           medicae WSM419]
 gi|150027610|gb|ABR59727.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Sinorhizobium
           medicae WSM419]
          Length = 208

 Score =  244 bits (624), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 159/205 (77%), Positives = 186/205 (90%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLE
Sbjct: 1   MRNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDHMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+CG+TYEEVE+TLDRD
Sbjct: 121 FATPNSRIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHCGRTYEEVEQTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIE 212
           H MS+ EA DWG++DKV+ SR  +E
Sbjct: 181 HFMSSDEALDWGLIDKVITSRDAVE 205


>gi|289207758|ref|YP_003459824.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Thioalkalivibrio sp. K90mix]
 gi|288943389|gb|ADC71088.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thioalkalivibrio sp. K90mix]
          Length = 224

 Score =  244 bits (624), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 127/201 (63%), Positives = 160/201 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           L LVPMVVEQT RGER+YDIYSRLLK+R++F  G +ED+MA +I AQLLFLE+ENP KEI
Sbjct: 16  LNLVPMVVEQTARGERAYDIYSRLLKDRVIFCVGPVEDYMANVIVAQLLFLESENPDKEI 75

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG++LL+ G  G R++LP++R+
Sbjct: 76  SLYINSPGGAVTAGMAIYDTMQFIKPQVSTLCVGQAASMGAVLLAGGAPGKRYSLPHSRV 135

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HA++I+KI+  LN +   + G+T E+VE+  DRD  M+A EA
Sbjct: 136 MIHQPLGGFQGQASDIDIHAREILKIREELNRVLAHHTGQTVEQVEQDTDRDRFMTAVEA 195

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
            D+G+VD VL SR       K
Sbjct: 196 KDYGLVDNVLSSRGAPAAGDK 216


>gi|51246390|ref|YP_066274.1| ATP-dependent Clp protease, proteolytic subunit (ClpP)
           [Desulfotalea psychrophila LSv54]
 gi|50877427|emb|CAG37267.1| probable ATP-dependent Clp protease, proteolytic subunit (ClpP)
           [Desulfotalea psychrophila LSv54]
          Length = 213

 Score =  244 bits (624), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 121/200 (60%), Positives = 161/200 (80%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
            V + L+PMVVEQT RGERSYDIYSRLLKERI+F+   + D +A +I AQLLFLEAE+P+
Sbjct: 8   SVIMNLIPMVVEQTPRGERSYDIYSRLLKERIIFLGSGVNDDVANVIVAQLLFLEAEDPE 67

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I+ YINSPGG VTAGMAIYDTMQ+IK  I+T CMGQAASMG++LL+AG  G R+ALPN
Sbjct: 68  KDITFYINSPGGSVTAGMAIYDTMQYIKCDIATLCMGQAASMGAVLLAAGTAGKRYALPN 127

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +RI++HQP GGF GQA+DIE H ++I++I++ LN I   + GKT +++E   +RD+ MS+
Sbjct: 128 SRIMIHQPLGGFQGQATDIEIHTKEILRIRKDLNNILAHHTGKTLKKIESDTERDNFMSS 187

Query: 193 SEACDWGVVDKVLMSRIDIE 212
            EA  +G++D+VL+ R D+E
Sbjct: 188 VEAQKYGLIDEVLVKREDVE 207


>gi|330427935|gb|AEC19269.1| ATP-dependent Clp protease proteolytic subunit [Pusillimonas sp.
           T7-7]
          Length = 218

 Score =  244 bits (624), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 122/195 (62%), Positives = 154/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG VP+V+EQ+ RGERSYDIYSRLL+ER++F  G + DH A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYVPIVIEQSGRGERSYDIYSRLLRERVIFFVGPVNDHTANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V AGMAIYDTMQFIKP +ST C G AASMG+ LL+AG KG R+ LPN+RI
Sbjct: 82  SLYINSPGGSVYAGMAIYDTMQFIKPDVSTLCTGIAASMGAFLLAAGAKGKRYTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  KN G+  E + +  +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILSLRERLNTILAKNTGQPVERIAEDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSRID 210
             +G+VDKVL+SR D
Sbjct: 202 VSYGLVDKVLVSRAD 216


>gi|329296782|ref|ZP_08254118.1| ClpP [Plautia stali symbiont]
          Length = 207

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 172/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G   ++       LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--DREFTAPTNALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K+R+NE+  ++ GK+ E++
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKQRMNELMAEHTGKSLEQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSILTHRQ 207


>gi|304407481|ref|ZP_07389133.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           curdlanolyticus YK9]
 gi|304343432|gb|EFM09274.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           curdlanolyticus YK9]
          Length = 193

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 121/192 (63%), Positives = 157/192 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+F+   I+D +A  I AQLLFL A++P+K+I
Sbjct: 1   MNLVPIVVEQTNRGERSYDIYSRLLKDRIIFLGSAIDDDVANSIIAQLLFLAADDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGM I+DTMQFIKP +ST C+G AASMGSLLL+AG KG RF+LPN+ +
Sbjct: 61  HLYINSPGGSVTAGMGIFDTMQFIKPDVSTICVGMAASMGSLLLTAGAKGKRFSLPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI+ HA  I+K K++LN+IYV+  G+ YE++E+  DRD+ +SA EA
Sbjct: 121 MIHQPLGGVRGQASDIKIHADWIIKTKQKLNQIYVERTGQPYEKIERDTDRDNFLSAEEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++DKV+ S
Sbjct: 181 VAYGLIDKVVTS 192


>gi|288958758|ref|YP_003449099.1| ATP-dependent Clp protease, protease subunit [Azospirillum sp.
           B510]
 gi|288911066|dbj|BAI72555.1| ATP-dependent Clp protease, protease subunit [Azospirillum sp.
           B510]
          Length = 208

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 126/200 (63%), Positives = 163/200 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D E     LVPMV+EQTNRGER+YDIYSRLLKERI+F+ G + D +A+LIC+QLLFLE+E
Sbjct: 3   DFEPKMNALVPMVIEQTNRGERAYDIYSRLLKERIIFLIGGVNDAVASLICSQLLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I+LYINSPGG V+AG+AIYDTMQ+I+P +ST CMGQAASMGSLLL+AG  G RF+
Sbjct: 63  NPNKDIALYINSPGGYVSAGLAIYDTMQYIRPQVSTVCMGQAASMGSLLLAAGAPGKRFS 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+RI++HQPSGG  GQASDIE  AQ+I+K++ RLN+IYVK+ G+  + +E  ++RD  
Sbjct: 123 LPNSRIMIHQPSGGAQGQASDIEIQAQEILKLRSRLNDIYVKHTGQDLDTIETAMERDKF 182

Query: 190 MSASEACDWGVVDKVLMSRI 209
           MS  EA  +G++D+V+  R 
Sbjct: 183 MSPEEAKAFGLIDEVVEKRP 202


>gi|262276278|ref|ZP_06054087.1| ATP-dependent Clp protease proteolytic subunit [Grimontia hollisae
           CIP 101886]
 gi|262220086|gb|EEY71402.1| ATP-dependent Clp protease proteolytic subunit [Grimontia hollisae
           CIP 101886]
          Length = 207

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 129/209 (61%), Positives = 164/209 (78%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MSF+   K     +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSFQ--EKNGMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQ+IKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQYIKPDVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G KG R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK RLN +  ++ G+  E +
Sbjct: 119 GGAKGKRYCLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKHRLNTLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  DRD+ M+A +A ++G+VD VL  R 
Sbjct: 179 ERDTDRDNFMAAQDAVNYGLVDAVLNKRD 207


>gi|117926916|ref|YP_867533.1| ATP-dependent Clp protease proteolytic subunit ClpP [Magnetococcus
           sp. MC-1]
 gi|254763794|sp|A0LDT4|CLPP_MAGSM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|117610672|gb|ABK46127.1| ATP-dependent Clp protease proteolytic subunit ClpP [Magnetococcus
           sp. MC-1]
          Length = 202

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 126/201 (62%), Positives = 166/201 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVE TNRGER+YDIYSRLLKER+VF+ GQ+E+HMA L+ AQLLFLE+ENP+K+I
Sbjct: 1   MSLVPMVVETTNRGERAYDIYSRLLKERVVFLVGQVEEHMANLVVAQLLFLESENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQFI+P +ST C+GQAASMG++LL+AGE G R  LPNAR+
Sbjct: 61  HLYINSPGGSVTAGMAIYDTMQFIRPSVSTLCIGQAASMGAVLLAAGEAGKRLVLPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGFSGQASD E HA++I++I+  LN++   + GK  E+V+   +RD+ +SA+EA
Sbjct: 121 MIHQPLGGFSGQASDFEIHAREILRIRENLNQVLSHHTGKPLEQVQLDTERDNFLSATEA 180

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
            ++G+VDKV+  R   E +++
Sbjct: 181 VEYGLVDKVISHRELPEAEAE 201


>gi|60389557|sp|Q6AK59|CLPP_DESPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 203

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 120/197 (60%), Positives = 160/197 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQT RGERSYDIYSRLLKERI+F+   + D +A +I AQLLFLEAE+P+K+I
Sbjct: 1   MNLIPMVVEQTPRGERSYDIYSRLLKERIIFLGSGVNDDVANVIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGG VTAGMAIYDTMQ+IK  I+T CMGQAASMG++LL+AG  G R+ALPN+RI
Sbjct: 61  TFYINSPGGSVTAGMAIYDTMQYIKCDIATLCMGQAASMGAVLLAAGTAGKRYALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE H ++I++I++ LN I   + GKT +++E   +RD+ MS+ EA
Sbjct: 121 MIHQPLGGFQGQATDIEIHTKEILRIRKDLNNILAHHTGKTLKKIESDTERDNFMSSVEA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
             +G++D+VL+ R D+E
Sbjct: 181 QKYGLIDEVLVKREDVE 197


>gi|313894919|ref|ZP_07828479.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312976600|gb|EFR42055.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 205

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 111/202 (54%), Positives = 159/202 (78%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
               VPMVVE ++RGER+YDIYSRLLKERI+F+ G I+D +A ++ AQ+LFLE+E+P K+
Sbjct: 1   MSYYVPMVVENSSRGERAYDIYSRLLKERIIFLGGPIDDSVANVVVAQMLFLESEDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGGVVTAG+AIYDTMQ+IKP +ST C+GQAASMGS+LL+AG KG R+ALP+AR
Sbjct: 61  IHLYINSPGGVVTAGLAIYDTMQYIKPDVSTICIGQAASMGSILLTAGAKGKRYALPHAR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQ++DI+  A++I++++   NEI  ++ G+  +++    +RD+ MSA E
Sbjct: 121 IMIHQPLGGAQGQSTDIQIQAKEILRLREVGNEILARHTGQDTDKINVDTERDNFMSAEE 180

Query: 195 ACDWGVVDKVLMSRIDIEEKSK 216
           A  +G++D+V++      ++SK
Sbjct: 181 AKAYGLIDEVVVRPPAASKESK 202


>gi|77463765|ref|YP_353269.1| ATP-dependent Clp protease proteolytic subunit [Rhodobacter
           sphaeroides 2.4.1]
 gi|126462595|ref|YP_001043709.1| ATP-dependent Clp protease proteolytic subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221639635|ref|YP_002525897.1| ATP-dependent Clp protease proteolytic subunit [Rhodobacter
           sphaeroides KD131]
 gi|124013827|sp|Q3J1G6|CLPP_RHOS4 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214702|sp|A3PKS1|CLPP_RHOS1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763798|sp|B9KJU9|CLPP_RHOSK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|77388183|gb|ABA79368.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodobacter
           sphaeroides 2.4.1]
 gi|126104259|gb|ABN76937.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221160416|gb|ACM01396.1| ATP-dependent Clp protease proteolytic subunit [Rhodobacter
           sphaeroides KD131]
          Length = 210

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 133/210 (63%), Positives = 178/210 (84%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D+++  LVPMVVEQT+RGER+YDIYSR+LKERI+F++G + D M++LICAQLLFL
Sbjct: 1   MKDPIDLYMNTLVPMVVEQTSRGERAYDIYSRMLKERIIFLSGPVHDGMSSLICAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEI++YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AGEKGM
Sbjct: 61  EAENPSKEIAMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGG+ GQA+DI  HA++  K+KRRLNEIYV++ G+  E VE  L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGYQGQATDIMIHARETEKLKRRLNEIYVRHTGQDLETVEAALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           D+ MSA +A  WG++D++L SR   ++ +K
Sbjct: 181 DNFMSAEDAKAWGLIDEILESRNRPDDTAK 210


>gi|120599414|ref|YP_963988.1| ATP-dependent Clp protease proteolytic subunit [Shewanella sp.
           W3-18-1]
 gi|146292590|ref|YP_001183014.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           putrefaciens CN-32]
 gi|166214710|sp|A4Y5I2|CLPP_SHEPC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214712|sp|A1RL89|CLPP_SHESW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|120559507|gb|ABM25434.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella sp.
           W3-18-1]
 gi|145564280|gb|ABP75215.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           putrefaciens CN-32]
 gi|319425892|gb|ADV53966.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shewanella
           putrefaciens 200]
          Length = 202

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 126/201 (62%), Positives = 162/201 (80%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             ++ D+   LVPMV+EQT +GERSYDIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE
Sbjct: 1   MHNASDIQNALVPMVIEQTAKGERSYDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG R
Sbjct: 61  SESPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD
Sbjct: 121 FCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNLMLAEHTGQPLEVIERDTDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + MSA++A ++G+VD V+  R
Sbjct: 181 NFMSATQAVEYGLVDSVMTKR 201


>gi|261855007|ref|YP_003262290.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Halothiobacillus neapolitanus c2]
 gi|261835476|gb|ACX95243.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Halothiobacillus neapolitanus c2]
          Length = 210

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 132/199 (66%), Positives = 161/199 (80%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
           S      LVPMVVEQT+RGER+YDIYSRLLKER+VFV G IEDHMA LI AQLLFLE+EN
Sbjct: 12  SSPELAALVPMVVEQTSRGERAYDIYSRLLKERVVFVVGPIEDHMANLIVAQLLFLESEN 71

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I LYINSPGGVVTAGM+IYDTMQFIKP +ST C+GQAASMGS+LLS GE G RFAL
Sbjct: 72  PDKDIHLYINSPGGVVTAGMSIYDTMQFIKPHVSTLCIGQAASMGSILLSGGEPGKRFAL 131

Query: 131 PNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM 190
           PN+R+++HQP GGF GQASDI+ HA++I+K++  LN +  K+C +  E +E+  DRD  +
Sbjct: 132 PNSRVMIHQPLGGFQGQASDIKIHAEEIIKLRHSLNGVLAKHCNQPMEVIERDTDRDKFL 191

Query: 191 SASEACDWGVVDKVLMSRI 209
           SASEA ++G++D VL  R 
Sbjct: 192 SASEAVEYGLIDAVLDKRA 210


>gi|154506030|ref|ZP_02042768.1| hypothetical protein RUMGNA_03572 [Ruminococcus gnavus ATCC 29149]
 gi|153793529|gb|EDN75949.1| hypothetical protein RUMGNA_03572 [Ruminococcus gnavus ATCC 29149]
          Length = 193

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 112/192 (58%), Positives = 149/192 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A++I AQLLFLEA++P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVNDVSASVIVAQLLFLEADDPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG+AIYDTMQ+IK  +ST C+G AASMG+ LLS G KG RFALPNA I
Sbjct: 61  QLYINSPGGSVTAGLAIYDTMQYIKCDVSTVCIGMAASMGAFLLSGGAKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I   A+ I++ +++LNEI   N G+  E ++   +RD+ MSA EA
Sbjct: 121 MIHQPSGGAQGQATEISIAAEHILRTRQKLNEIMAANTGQPLETIKADTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++D+V+  
Sbjct: 181 KAYGLIDEVIAK 192


>gi|77919287|ref|YP_357102.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pelobacter
           carbinolicus DSM 2380]
 gi|90183182|sp|Q3A3X5|CLPP_PELCD RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|77545370|gb|ABA88932.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pelobacter
           carbinolicus DSM 2380]
          Length = 194

 Score =  244 bits (624), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 112/193 (58%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQT RGER+YDI+SRLLK+RI+F+ G ++D +A LI AQ+LFLE+E+P+KEI
Sbjct: 1   MSLIPMVVEQTGRGERAYDIFSRLLKDRIIFLGGAVDDQVANLIIAQMLFLESEDPEKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAGMAIYDTMQ+++ P+ST C+GQAASMG++LL+AG +G RFALP+ARI
Sbjct: 61  FLYINSPGGVVTAGMAIYDTMQYVRCPVSTLCVGQAASMGAVLLAAGGEGKRFALPHARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HAQ+I++++  LN +   + G+T E++    +RD  M + EA
Sbjct: 121 MIHQPWGGFQGQATDINIHAQEILRLRETLNGVLASHTGQTLEKIATDTERDFFMGSEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD ++  +
Sbjct: 181 KKYGIVDDIVKRK 193


>gi|310657900|ref|YP_003935621.1| clpa-clpp and clpx-clpp ATP-dependent serine protease proteolytic
           subunit [Clostridium sticklandii DSM 519]
 gi|308824678|emb|CBH20716.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Clostridium sticklandii]
          Length = 194

 Score =  244 bits (623), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 113/194 (58%), Positives = 154/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+V+EQT RGERSYDIYSRLLK+RI+F+  Q+ DH A+LI AQLL LE+E+P K+I
Sbjct: 1   MAYVPIVIEQTGRGERSYDIYSRLLKDRIIFLGDQVNDHTASLIVAQLLHLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP ++T C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  FLYINSPGGSITAGMAIYDTMQYIKPDVATICVGMAASMGAFLLTAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA+ I++++ +LNEI     G+  E++E+  +RD  MS++EA
Sbjct: 121 MIHQPLGGTQGQATDIKIHAERIIRMRNKLNEIMADRSGQPLEKIERDTERDFFMSSTEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+VL  R 
Sbjct: 181 KEYGLIDEVLEKRP 194


>gi|30248062|ref|NP_840132.1| Clp protease [Nitrosomonas europaea ATCC 19718]
 gi|60389763|sp|Q82Y57|CLPP_NITEU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|30179947|emb|CAD83942.1| Clp protease [Nitrosomonas europaea ATCC 19718]
          Length = 214

 Score =  244 bits (623), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 118/206 (57%), Positives = 160/206 (77%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +   +   LGL+PMV+E + RGER+YDIYSRLL+ERI+F+ G + +  A L+ AQLLFLE
Sbjct: 9   RNGLDTTGLGLIPMVIETSGRGERAYDIYSRLLRERIIFLVGPVTETSANLVIAQLLFLE 68

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +EN +K+I LYINSPGG+VTAG+A+YDT+QFIKP +ST C+GQAASMG+ LL+AG KG R
Sbjct: 69  SENSEKDIFLYINSPGGLVTAGLAVYDTIQFIKPDVSTLCVGQAASMGAFLLTAGAKGKR 128

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           + LPN+R+++HQP GGF GQASDIE HA++I+ +K RLNEI  K+ G+T + +E+  DRD
Sbjct: 129 YCLPNSRVMIHQPLGGFQGQASDIEIHAKEILALKSRLNEIMAKHTGQTVKAIERDTDRD 188

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEE 213
           + + A  A  +G+VD VL SR   +E
Sbjct: 189 NFLGAEAAVKYGLVDAVLTSREVKQE 214


>gi|307942062|ref|ZP_07657413.1| Clp protease [Roseibium sp. TrichSKD4]
 gi|307774348|gb|EFO33558.1| Clp protease [Roseibium sp. TrichSKD4]
          Length = 211

 Score =  244 bits (623), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 140/210 (66%), Positives = 181/210 (86%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D+++  LVPMVVEQTNRGERS+DIYSRLLKERI+F+TG IEDH+ATL+CAQLLFL
Sbjct: 1   MKDPADIYMNTLVPMVVEQTNRGERSFDIYSRLLKERIIFLTGPIEDHVATLVCAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EA+NP KEI++YINSPGG+VT+G+AIYDTMQFI+P +ST C+GQAASMGSLLL+ GEK M
Sbjct: 61  EADNPSKEIAIYINSPGGLVTSGLAIYDTMQFIRPAVSTLCIGQAASMGSLLLAGGEKDM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPNAR+++HQPSGGF GQA+DI  HAQ+I+ +KRRLNEIYVK+ G++ +EVE+ L+R
Sbjct: 121 RFSLPNARVMVHQPSGGFRGQAADIMLHAQEILAMKRRLNEIYVKHTGQSLDEVEEALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           D+ M+A +A ++G+VD V+  R  +   S+
Sbjct: 181 DNFMTAEKAKEFGIVDSVITDRASLHSDSE 210


>gi|24373360|ref|NP_717403.1| ATP-dependent Clp protease proteolytic subunit [Shewanella
           oneidensis MR-1]
 gi|60389791|sp|Q8EG19|CLPP_SHEON RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|24347620|gb|AAN54847.1|AE015623_9 ATP-dependent Clp protease, proteolytic subunit [Shewanella
           oneidensis MR-1]
          Length = 202

 Score =  244 bits (623), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 125/201 (62%), Positives = 162/201 (80%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             ++ D+   LVPMV+EQT +GERS+DIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE
Sbjct: 1   MHNASDIQSALVPMVIEQTAKGERSFDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG R
Sbjct: 61  SESPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN++   + G+  E +E+  DRD
Sbjct: 121 FCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKNKLNQMLADHTGQPLEVIERDTDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + MSA++A ++G+VD V+  R
Sbjct: 181 NFMSATQAVEYGLVDAVMTKR 201


>gi|257093849|ref|YP_003167490.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257046373|gb|ACV35561.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 209

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 119/200 (59%), Positives = 157/200 (78%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
               LGLVPMV+EQ+ RGER+YDIYSRLLKER+VF+ G + D  A L+ AQLLFLEAENP
Sbjct: 10  NPQALGLVPMVIEQSGRGERAYDIYSRLLKERVVFLVGPVNDVTANLVVAQLLFLEAENP 69

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I  YINSPGG V+AG+++YDTMQFIKP +ST CMGQA SMG+ LL+AG +G RFALP
Sbjct: 70  DKDIHFYINSPGGSVSAGLSVYDTMQFIKPDVSTLCMGQACSMGAFLLAAGTRGKRFALP 129

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GGF GQASDI  HA++I+ ++ +LNE+   + G+  E +E+  DRD+ +S
Sbjct: 130 NSRVMIHQPMGGFQGQASDIAIHAKEILSLRAKLNELMALHTGQEIERIERDTDRDNFLS 189

Query: 192 ASEACDWGVVDKVLMSRIDI 211
           A EA ++G++DKVL +R  I
Sbjct: 190 AQEAAEYGLIDKVLANREAI 209


>gi|90417350|ref|ZP_01225275.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine gamma
           proteobacterium HTCC2207]
 gi|90330792|gb|EAS46061.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine gamma
           proteobacterium HTCC2207]
          Length = 213

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 129/211 (61%), Positives = 166/211 (78%), Gaps = 1/211 (0%)

Query: 1   MSFEGCAKKDSEDV-FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLI 59
           M+F+      + DV   GLVPMVVEQT+RGER+YDIYSRLLKER++F+ GQ+EDHMA LI
Sbjct: 1   MNFQQPYAGHTHDVQASGLVPMVVEQTSRGERAYDIYSRLLKERVIFLVGQVEDHMANLI 60

Query: 60  CAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLL 119
            AQ+LFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL
Sbjct: 61  VAQMLFLESENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPNVSTMCIGQAASMGAFLL 120

Query: 120 SAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEE 179
           +AG +G R+ LPN+R ++HQPSGG  GQA+DI   +Q+I+KIK RLN +  K+ G++ E+
Sbjct: 121 AAGAEGKRYCLPNSRTMIHQPSGGAQGQATDIHIQSQEILKIKSRLNNLMAKHTGQSVEK 180

Query: 180 VEKTLDRDHIMSASEACDWGVVDKVLMSRID 210
           V +  +RD+ MSA E+  +G+VD VL SR  
Sbjct: 181 VTEDTERDNFMSAEESKAYGLVDDVLDSREQ 211


>gi|291550775|emb|CBL27037.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ruminococcus
           torques L2-14]
          Length = 193

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 114/192 (59%), Positives = 155/192 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A++I AQLLFLEA++P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVNDVSASVIVAQLLFLEADDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG+AIYDTMQ+IK  +ST C+G AASMG+ LLS G+KG RFALPNA I
Sbjct: 61  QLYINSPGGSVTAGLAIYDTMQYIKCDVSTVCIGMAASMGAFLLSGGKKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A+ I++ K++LNEI   N GK  E +++  +RD+ MSA EA
Sbjct: 121 MIHQPSGGAQGQATEIQIAAEHILRTKKKLNEILAANTGKPLEVIQQDTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+V+++
Sbjct: 181 KEYGLIDEVIVN 192


>gi|262277075|ref|ZP_06054868.1| ATP-dependent Clp protease, proteolytic subunit ClpP [alpha
           proteobacterium HIMB114]
 gi|262224178|gb|EEY74637.1| ATP-dependent Clp protease, proteolytic subunit ClpP [alpha
           proteobacterium HIMB114]
          Length = 204

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 131/203 (64%), Positives = 167/203 (82%), Gaps = 1/203 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D+++  LVPMV+EQT RGERS+DIYSRLLKERI+F+TG I  ++++L+ AQLLFL
Sbjct: 1   MKDPFDIYMNTLVPMVIEQTPRGERSFDIYSRLLKERIIFLTGPINSYISSLVSAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+EN  KEI LYINSPGGVVT G+AIYDTMQFIKP +ST C+GQAASMGS LL+AGEKG+
Sbjct: 61  ESENNSKEIYLYINSPGGVVTDGLAIYDTMQFIKPTVSTLCIGQAASMGSFLLAAGEKGL 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R +LPNARI++HQPS GF GQA+DIE H ++I+  K+RLNEIY K+ G+T E +++ L+R
Sbjct: 121 RMSLPNARIMVHQPSAGFQGQATDIEIHTKEILSTKKRLNEIYSKHTGQTVETIKEALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRI 209
           D+ MSA EA  +G+VDKV+  R 
Sbjct: 181 DNFMSAEEAKKFGLVDKVVEKRD 203


>gi|302035647|ref|YP_003795969.1| ATP-dependent Clp protease proteolytic subunit clpP [Candidatus
           Nitrospira defluvii]
 gi|300603711|emb|CBK40042.1| ATP-dependent Clp protease, proteolytic subunit clpP [Candidatus
           Nitrospira defluvii]
          Length = 211

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 115/190 (60%), Positives = 158/190 (83%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+V+EQTNRGER+YDIYSRLLK+RI+F+   I+D  A LI AQLLFLEAE+P+K+I+L
Sbjct: 2   LVPIVIEQTNRGERAYDIYSRLLKDRIIFLGAPIDDVFANLIIAQLLFLEAEDPEKDINL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG+ IYDTMQ++KP I+T C+GQAASMG+ LL+AG KG R+ALPNAR+++
Sbjct: 62  YINSPGGSVTAGLGIYDTMQYVKPAINTICLGQAASMGAFLLTAGTKGKRYALPNARVMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA++I+ HA++I+KI+ RLNEI  K+ G+  +++ +  +RD+ MS+ EA  
Sbjct: 122 HQPMGGFQGQATEIDIHAREILKIRERLNEIMAKHTGQPLDKISQDTERDYFMSSEEAKR 181

Query: 198 WGVVDKVLMS 207
           +G++D+V+  
Sbjct: 182 YGLIDEVITR 191


>gi|89900346|ref|YP_522817.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rhodoferax
           ferrireducens T118]
 gi|89345083|gb|ABD69286.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodoferax
           ferrireducens T118]
          Length = 209

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 111/209 (53%), Positives = 157/209 (75%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS         +   LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G + D++A L+ 
Sbjct: 1   MSLPNMMMGAMQTQALGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDYVANLVV 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE++NP K+IS YINSPGG V+AGMAI+DTM F+KP +ST C G AASMG+ LL+
Sbjct: 61  AQLLFLESDNPDKDISFYINSPGGSVSAGMAIFDTMNFVKPDVSTLCTGMAASMGAFLLA 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF+LPN+++++HQPSGG  GQA++IE  A++I+K + +LN+I  +  G+    +
Sbjct: 121 AGAKGKRFSLPNSKVMIHQPSGGSQGQATEIEIQAREILKTREQLNKILAERTGQPLARI 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD+ MSA E  ++G++D+V+  R 
Sbjct: 181 ERDTERDYYMSADECKEYGLIDQVISKRA 209


>gi|319404099|emb|CBI77689.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella
           rochalimae ATCC BAA-1498]
 gi|319407112|emb|CBI80749.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella sp.
           1-1C]
          Length = 210

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 148/209 (70%), Positives = 179/209 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D     L LVPMVVEQTNRGER+YDI+SRLLKERI+F+ G +ED+MA L+CAQLLFLE
Sbjct: 1   MSDPVKKVLSLVPMVVEQTNRGERAYDIFSRLLKERIIFINGPVEDNMAMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVT+GMAIYDTMQFI+P +ST CMGQAASMGSLLL+AG  G R
Sbjct: 61  AENPKKEINLYINSPGGVVTSGMAIYDTMQFIRPSVSTLCMGQAASMGSLLLTAGATGRR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNEIYV++ G++YE +E TLDRD
Sbjct: 121 FALPNARIMVHQPSGGFQGQASDIERHAQDIIKMKRRLNEIYVQHTGQSYEVIENTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A E+  +G++D V+  R + E++ K
Sbjct: 181 HFMTAEESKQFGLIDDVIQYRAETEKEEK 209


>gi|239815493|ref|YP_002944403.1| ATP-dependent Clp protease proteolytic subunit [Variovorax
           paradoxus S110]
 gi|259491242|sp|C5CJT4|CLPP_VARPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|239802070|gb|ACS19137.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Variovorax
           paradoxus S110]
          Length = 202

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 117/194 (60%), Positives = 156/194 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG++PMV+EQ+ RGERSYDIYSRLLKERI+F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 9   LGMIPMVIEQSGRGERSYDIYSRLLKERIIFLVGEVNDQTANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V+AGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG RF+LPN++I
Sbjct: 69  SFYINSPGGSVSAGMAIYDTMQFIKPDVSTMCIGFAASMGAFLLAAGEKGKRFSLPNSKI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQ  GG  GQA+DIE HA+DI++ K ++N I  +  G+  E+V+   +RD+ ++A EA
Sbjct: 129 MIHQVLGGARGQATDIEIHARDILRTKDQMNRILAERTGQPLEKVKSDTERDYFLTADEA 188

Query: 196 CDWGVVDKVLMSRI 209
            D+G+VD+V+  R 
Sbjct: 189 KDYGLVDQVIAKRS 202


>gi|254785725|ref|YP_003073154.1| ATP-dependent Clp protease proteolytic subunit [Teredinibacter
           turnerae T7901]
 gi|259585966|sp|C5BTJ0|CLPP_TERTT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|237684355|gb|ACR11619.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Teredinibacter turnerae T7901]
          Length = 214

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 138/214 (64%), Positives = 163/214 (76%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS        S  +   LVP+VVEQT RGERSYDIYSRLLKER++F+ GQ+EDHMA L+ 
Sbjct: 1   MSQFNPMGGQSTTIQSSLVPIVVEQTARGERSYDIYSRLLKERVIFLVGQVEDHMANLVV 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMGS LLS
Sbjct: 61  AQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQACSMGSFLLS 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG  G RF LPNAR ++HQPSGG  GQASDI  HAQ+I+KI+ RLNEI  K+ GK+ EEV
Sbjct: 121 AGATGKRFCLPNARTMIHQPSGGAQGQASDIHIHAQEILKIRARLNEIMAKHTGKSVEEV 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEK 214
            +  +RD+ MSA E+  +G+VD VL  R+  E K
Sbjct: 181 ARDTERDNFMSAEESKAYGLVDDVLYQRVPEESK 214


>gi|160947717|ref|ZP_02094884.1| hypothetical protein PEPMIC_01652 [Parvimonas micra ATCC 33270]
 gi|158446851|gb|EDP23846.1| hypothetical protein PEPMIC_01652 [Parvimonas micra ATCC 33270]
          Length = 192

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 118/192 (61%), Positives = 158/192 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQTNRGERSYDIYSRLLKERI+F++G++ D MA LI AQLLFLE+E+P+K+I
Sbjct: 1   MALIPMVVEQTNRGERSYDIYSRLLKERIIFLSGEVNDQMADLIVAQLLFLESEDPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG V+AG+AIYDTMQ+IKP +ST C+G+AASMG+ LL++G KG RFALPNA I
Sbjct: 61  QIYINSPGGSVSAGLAIYDTMQYIKPDVSTICIGRAASMGAFLLTSGAKGKRFALPNADI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA DI+  AQ I++++  LNEI  K  G++ +++EK  DRD  MSA EA
Sbjct: 121 MIHQPLGGAQGQAEDIKIQAQKILQVRATLNEILAKRTGQSLKKIEKDTDRDFYMSAYEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+V+ +
Sbjct: 181 KEYGIIDEVIEN 192


>gi|114707244|ref|ZP_01440142.1| ATP-dependent Clp protease proteolytic subunit [Fulvimarina pelagi
           HTCC2506]
 gi|114537440|gb|EAU40566.1| ATP-dependent Clp protease proteolytic subunit [Fulvimarina pelagi
           HTCC2506]
          Length = 217

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 149/209 (71%), Positives = 181/209 (86%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            K   +  + LVPMVVEQTNRGER+YDI+SRLLKER++F+TG IED MATL+CAQLLFLE
Sbjct: 1   MKHPIETAMNLVPMVVEQTNRGERAYDIFSRLLKERVIFITGPIEDSMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVT+GMAIYDTMQFI+P ++T C+GQAASMGSLLL AGEK MR
Sbjct: 61  AENPKKEIALYINSPGGVVTSGMAIYDTMQFIRPAVTTLCIGQAASMGSLLLCAGEKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI++HQPSGGF GQASDIERHAQDI+K+KRRLNE YVK+ G+ YE +E+TLDRD
Sbjct: 121 FATPNARIMVHQPSGGFQGQASDIERHAQDIIKLKRRLNETYVKHTGQDYETIERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A E+ ++G++DKV  SR++ E   +
Sbjct: 181 HFMTAEESLEFGLIDKVYSSRVEQEGTDR 209


>gi|15603841|ref|NP_246915.1| ATP-dependent Clp protease proteolytic subunit [Pasteurella
           multocida subsp. multocida str. Pm70]
 gi|18202809|sp|Q9CJM2|CLPP_PASMU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|12722415|gb|AAK04060.1| ClpP [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 193

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT RGERSYDIYSRLLKER++F+ G++ED MA LI AQLLFLE+E+P+K+I
Sbjct: 1   MSVIPMVVEQTARGERSYDIYSRLLKERVIFLGGEVEDRMANLIVAQLLFLESEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQF+KP I T C+GQA SMG+ LL+ G  G R ALP+AR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFVKPDIRTLCVGQACSMGAFLLAGGTAGKRIALPSARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G+T E +E+  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQTIERIERDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL SR
Sbjct: 181 KAYGLVDEVLASR 193


>gi|59711403|ref|YP_204179.1| ATP-dependent Clp protease proteolytic subunit [Vibrio fischeri
           ES114]
 gi|197335304|ref|YP_002155557.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           fischeri MJ11]
 gi|67460143|sp|Q5E6Q5|CLPP_VIBF1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706555|sp|B5FBZ8|CLPP_VIBFM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|59479504|gb|AAW85291.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Vibrio fischeri ES114]
 gi|197316794|gb|ACH66241.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Vibrio
           fischeri MJ11]
          Length = 207

 Score =  244 bits (623), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 127/209 (60%), Positives = 162/209 (77%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++         +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--ENNAMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKKKLNTLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  DRD+ MSA +A  +G+VD VL  R 
Sbjct: 179 EQDTDRDNFMSADDAVKYGLVDAVLNKRD 207


>gi|304395499|ref|ZP_07377382.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pantoea sp.
           aB]
 gi|304356793|gb|EFM21157.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pantoea sp.
           aB]
          Length = 207

 Score =  244 bits (623), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 133/209 (63%), Positives = 172/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G   ++       LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--DREYTAPHNALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQASDIE HA++I+K+K+R+NE+  ++ GKT EE+
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGYQGQASDIEIHAREILKVKQRMNELMAEHTGKTLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSASEAVEYGLVDSILTHRQ 207


>gi|90419399|ref|ZP_01227309.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336336|gb|EAS50077.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 210

 Score =  244 bits (623), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 151/207 (72%), Positives = 180/207 (86%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
                +  + LVPMVVEQTNRGER+YDI+SRLLKER++F+TG IED MATL+CAQLLFLE
Sbjct: 1   MTHPVETAMNLVPMVVEQTNRGERAYDIFSRLLKERVIFITGPIEDSMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVT+GMAIYDTMQFIKP +ST C+GQAASMGSLLL AG K MR
Sbjct: 61  AENPKKEIALYINSPGGVVTSGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLCAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI++HQPSGGFSGQASDIERHAQDI+K+KRRLNE+YV++ G+ YE VE+TLDRD
Sbjct: 121 FATPNARIMVHQPSGGFSGQASDIERHAQDIIKLKRRLNEVYVEHTGQDYETVERTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEK 214
           H M+A EA ++G++DKV  SR  +E +
Sbjct: 181 HFMTAQEAREFGLIDKVYSSRDALEAE 207


>gi|186475776|ref|YP_001857246.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           phymatum STM815]
 gi|184192235|gb|ACC70200.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           phymatum STM815]
          Length = 219

 Score =  244 bits (623), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 123/209 (58%), Positives = 159/209 (76%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           ++ +    +D E   LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ 
Sbjct: 11  LTSQSSRDRDLEAQALGLVPIVVETSGRGERSYDIYSRLLKERVVFLVGEVNDQTANLVI 70

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+IS YINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL+
Sbjct: 71  AQLLFLESENPDKDISFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLA 130

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RFALPNAR+++HQP GG  GQASDIE  A++I+ +K RLN++   + G+  E +
Sbjct: 131 AGAKGKRFALPNARVMIHQPLGGARGQASDIEIQAREILYLKERLNQLLSHHTGQPVERI 190

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           ++  DRD+ MS  +A  +G+VD+VL  R 
Sbjct: 191 QRDTDRDNFMSGDDAQAYGLVDQVLHKRP 219


>gi|153854553|ref|ZP_01995823.1| hypothetical protein DORLON_01818 [Dorea longicatena DSM 13814]
 gi|149752862|gb|EDM62793.1| hypothetical protein DORLON_01818 [Dorea longicatena DSM 13814]
          Length = 193

 Score =  244 bits (623), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 111/193 (57%), Positives = 149/193 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A++I AQLLFLEAE+P+K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVTDVSASVIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQ+IK  I T C+G AASMGS LL+ G KG R ALPN+ I
Sbjct: 61  HLYINSPGGSVTAGMAIYDTMQYIKCDIETICIGMAASMGSFLLTGGTKGKRLALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++I+  A  I+K +++LN+I  +N G+  E +    +RD+ M+A EA
Sbjct: 121 MIHQPLGGAQGQATEIQIAADHILKTRQKLNQILAENTGQPLEVINADTERDNFMTAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D+V+ SR
Sbjct: 181 KAYGLIDEVIKSR 193


>gi|308185908|ref|YP_003930039.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Pantoea vagans C9-1]
 gi|308056418|gb|ADO08590.1| ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Pantoea vagans C9-1]
          Length = 207

 Score =  244 bits (622), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 172/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G   ++       LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--DREYTAPHNALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQASDIE HA++I+K+K+R+NE+  ++ GKT EE+
Sbjct: 119 AGTKGKRFCLPNSRVMIHQPLGGYQGQASDIEIHAREILKVKQRMNELMAEHTGKTLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA+EA ++G+VD +L  R 
Sbjct: 179 ERDTERDRFLSANEAVEYGLVDSILTHRQ 207


>gi|225850859|ref|YP_002731093.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Persephonella
           marina EX-H1]
 gi|225644930|gb|ACO03116.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Persephonella
           marina EX-H1]
          Length = 202

 Score =  244 bits (622), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 117/202 (57%), Positives = 163/202 (80%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             KD + +   LVP+V+EQT RGER+YDIYSRLLK+RI+ +   I+DH+A LI AQLLFL
Sbjct: 1   MSKDLDSIVSQLVPIVIEQTPRGERAYDIYSRLLKDRIIMLGFPIDDHIANLIIAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P+K+I +YINSPGGVVT+G+AIYDTM++IKP + T CMGQAASMG+ LLSAG KG 
Sbjct: 61  ESEDPEKDIYMYINSPGGVVTSGLAIYDTMRYIKPDVVTICMGQAASMGAFLLSAGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALP++RI++HQP GGF GQA+DIE HA++I+++K+ LNE   ++ G+  E++E+  +R
Sbjct: 121 RYALPSSRIMIHQPLGGFQGQATDIEIHAKEILRLKKYLNERLAEHTGQPLEKIERDTER 180

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D  MSA +A ++G++DKV+  R
Sbjct: 181 DFFMSAHDAVEYGLIDKVIEKR 202


>gi|291616549|ref|YP_003519291.1| ClpP [Pantoea ananatis LMG 20103]
 gi|291151579|gb|ADD76163.1| ClpP [Pantoea ananatis LMG 20103]
 gi|327392981|dbj|BAK10403.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pantoea
           ananatis AJ13355]
          Length = 218

 Score =  244 bits (622), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 172/209 (82%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G   ++       LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA LI 
Sbjct: 12  MSYSG--DREFTAPHNALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLIV 69

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMG+ LL+
Sbjct: 70  AQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGAFLLT 129

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K+R+NE+  ++ GK+ EE+
Sbjct: 130 AGTKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKQRMNELMAEHTGKSLEEI 189

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASEA ++G+VD +L  R 
Sbjct: 190 ERDTERDRFLSASEAVEYGLVDSILTHRQ 218


>gi|160898086|ref|YP_001563668.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Delftia
           acidovorans SPH-1]
 gi|160363670|gb|ABX35283.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Delftia
           acidovorans SPH-1]
          Length = 202

 Score =  244 bits (622), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 113/202 (55%), Positives = 155/202 (76%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
               E   LG++PMV+EQ+ RGERSYDIYSRLLK+R++F+ G + D  A L+ AQLLFLE
Sbjct: 1   MSALETQGLGMIPMVIEQSGRGERSYDIYSRLLKDRVIFLVGPVNDQTANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+IS YINSPGG V+AG+AI+DTM FIKP +ST C G AASMG+ LL+AG KG R
Sbjct: 61  SENPDKDISFYINSPGGSVSAGLAIFDTMNFIKPDVSTLCTGIAASMGAFLLAAGTKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPN+++++HQP GG  GQA++IE HA++I+K + RLN+I  +  G+  E+++   +RD
Sbjct: 121 FALPNSQVMIHQPLGGMQGQATEIEIHAREILKTRERLNKILAERTGQPLEKIQHDTERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + +SA EA D+G+VD+V+  R 
Sbjct: 181 YFLSAEEAKDYGLVDQVINKRS 202


>gi|225573066|ref|ZP_03781821.1| hypothetical protein RUMHYD_01257 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039572|gb|EEG49818.1| hypothetical protein RUMHYD_01257 [Blautia hydrogenotrophica DSM
           10507]
          Length = 193

 Score =  244 bits (622), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 115/193 (59%), Positives = 146/193 (75%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP VVEQT+RGER+YDIYSRLLK+RI+F+  ++ D  A+L+ AQLLFLE+E+  K+I
Sbjct: 1   MSLVPYVVEQTSRGERNYDIYSRLLKDRIIFLGEEVNDVTASLVVAQLLFLESEDAGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQ+IK  +ST C+G AASMG+ LL+ G KG R ALPN+ I
Sbjct: 61  QLYINSPGGSVTAGMAIYDTMQYIKCDVSTICLGLAASMGAFLLAGGAKGKRIALPNSTI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A  I K KR LNEI   N G+  E VE   DRD+ MSA EA
Sbjct: 121 MIHQPSGGAQGQATEIQIVADHIAKTKRTLNEILAANTGQPLEVVEVDTDRDNYMSAQEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++DK++  R
Sbjct: 181 QAYGLIDKIITHR 193


>gi|116243166|sp|Q1GGF6|CLPP_SILST RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 210

 Score =  244 bits (622), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 126/207 (60%), Positives = 173/207 (83%), Gaps = 1/207 (0%)

Query: 10  DSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           D  + ++  LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEA
Sbjct: 3   DPTETYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEA 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF
Sbjct: 63  ENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRF 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPN+R+++HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYVK+ G+ Y+ +EK L+RD+
Sbjct: 123 SLPNSRVMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVKHTGQDYDTIEKALERDN 182

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKS 215
            MS  +A ++G++D+++ +R   ++  
Sbjct: 183 FMSPEQAKEFGLIDEIVENRSKADDAE 209


>gi|295109356|emb|CBL23309.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ruminococcus
           obeum A2-162]
          Length = 193

 Score =  244 bits (622), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 114/193 (59%), Positives = 150/193 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A++I AQLLFLEAE+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVNDVSASIIVAQLLFLEAEDPSKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTM++IK  +ST C+G AASMG+ LL+ G KG R+ALP++ I
Sbjct: 61  QLYINSPGGSVTAGMAIYDTMKYIKCDVSTICLGMAASMGAFLLAGGTKGKRYALPHSTI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A  I + KR LNEI  +N G+ YE VEK  DRD+ M+A EA
Sbjct: 121 MIHQPSGGAQGQATEIQIVADHIAQTKRTLNEILAENTGQPYEVVEKDTDRDNYMTAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D V+  +
Sbjct: 181 KAYGLIDGVVEHK 193


>gi|295695312|ref|YP_003588550.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           tusciae DSM 2912]
 gi|295410914|gb|ADG05406.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           tusciae DSM 2912]
          Length = 196

 Score =  244 bits (622), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 110/191 (57%), Positives = 150/191 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQ++RGER+YDIYSRLLK+RI+F+   I+D +A L+ AQLLFL AE+ +K+I
Sbjct: 1   MSLVPMVIEQSSRGERAYDIYSRLLKDRIIFLGTGIDDIVANLVVAQLLFLAAEDDKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  RLYINSPGGSITAGMAIYDTMQYIKPDVSTVCIGMAASMGAFLLAAGTKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA  I++ K ++N I  +  G+  E++E+  DRD+ M A EA
Sbjct: 121 MIHQPLGGVRGQAADIKIHADWILRTKDKINRILSERTGQPLEKIERDTDRDNFMDAEEA 180

Query: 196 CDWGVVDKVLM 206
             +G++D+V+ 
Sbjct: 181 KAYGLIDEVIS 191


>gi|300114126|ref|YP_003760701.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrosococcus
           watsonii C-113]
 gi|299540063|gb|ADJ28380.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosococcus
           watsonii C-113]
          Length = 203

 Score =  244 bits (622), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 122/199 (61%), Positives = 158/199 (79%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT RGER+YDIYSRLLKER+VF+ G +EDHMA L+ AQLLFLE+ENP 
Sbjct: 3   DSLNTLVPMVVEQTARGERAYDIYSRLLKERVVFLVGPVEDHMANLVVAQLLFLESENPD 62

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAG++IYDTMQFIKP +ST C+GQAASMG++LL+ G  G R  LP+
Sbjct: 63  KDIHLYINSPGGSVTAGLSIYDTMQFIKPDVSTLCVGQAASMGAVLLAGGAPGKRHCLPH 122

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+L+HQP GGF GQA+DI+ HA++I+ ++ RLN I  K+ G+  E+++   DRD+ MSA
Sbjct: 123 SRLLIHQPLGGFQGQATDIDIHAREILLVRERLNHILAKHTGQPIEKIQHDTDRDYFMSA 182

Query: 193 SEACDWGVVDKVLMSRIDI 211
           +E+  +G+VD VL  R +I
Sbjct: 183 TESLAYGLVDSVLKQRTEI 201


>gi|288549991|ref|ZP_05968896.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Enterobacter
           cancerogenus ATCC 35316]
 gi|288316903|gb|EFC55841.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Enterobacter
           cancerogenus ATCC 35316]
          Length = 194

 Score =  244 bits (622), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 126/194 (64%), Positives = 166/194 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R+
Sbjct: 61  YLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G++ E++E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQSLEQIERDTERDRFLSAPEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G+VD VL  R 
Sbjct: 181 VEYGLVDSVLTHRN 194


>gi|190573022|ref|YP_001970867.1| ATP-dependent Clp protease proteolytic subunit [Stenotrophomonas
           maltophilia K279a]
 gi|194364614|ref|YP_002027224.1| ATP-dependent Clp protease proteolytic subunit [Stenotrophomonas
           maltophilia R551-3]
 gi|226706475|sp|B2FQR2|CLPP_STRMK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|190010944|emb|CAQ44553.1| ATP-dependent clp protease proteolytic subunit [Stenotrophomonas
           maltophilia K279a]
 gi|194347418|gb|ACF50541.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Stenotrophomonas maltophilia R551-3]
          Length = 208

 Score =  244 bits (622), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 124/201 (61%), Positives = 167/201 (83%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D+    L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+DHMA ++ AQLLFLE+E
Sbjct: 2   DNRTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVVVAQLLFLESE 61

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+K+I++YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL+AGE G R+A
Sbjct: 62  NPEKDINIYINSPGGVVTAGMAIYDTMQYIKPNVSTTCIGQAASMGALLLAAGEAGKRYA 121

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GG+ GQA+DI+ HA++I+ ++ RLNE+  K+ G++ E + +  +RD+ 
Sbjct: 122 LPNSRVMIHQPLGGYQGQATDIDIHAREILTLRSRLNEVLAKHTGQSLETIARDTERDNF 181

Query: 190 MSASEACDWGVVDKVLMSRID 210
            SA EA  +G+VD+VL  R D
Sbjct: 182 KSAFEAQAYGLVDQVLERRPD 202


>gi|296136117|ref|YP_003643359.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thiomonas
           intermedia K12]
 gi|295796239|gb|ADG31029.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thiomonas
           intermedia K12]
          Length = 202

 Score =  244 bits (622), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 118/194 (60%), Positives = 155/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMV+EQ+ RGER+YDIYSRLL+ER++F+ G I D MA L+ AQLLFLE+ENP K+I
Sbjct: 9   LGLVPMVIEQSGRGERAYDIYSRLLRERVIFLVGPINDQMANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGMAI+DTMQFIKP +ST C G AASMG+ L++AG KG R++LPN+RI
Sbjct: 69  SLYINSPGGSVSAGMAIFDTMQFIKPDVSTLCTGIAASMGAFLMAAGAKGKRYSLPNSRI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DIE  A++I+ ++ RLN I  +  G+T E++    +RD  MSA EA
Sbjct: 129 MIHQPSGGAQGQATDIEIQAREILYLRERLNGILAERTGQTLEKIGIDTERDFFMSAEEA 188

Query: 196 CDWGVVDKVLMSRI 209
            D+G++D+V+  R 
Sbjct: 189 KDYGLIDEVISKRS 202


>gi|152968972|ref|YP_001334081.1| ATP-dependent Clp protease proteolytic subunit [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|262042473|ref|ZP_06015632.1| ATP-dependent Clp protease [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330011533|ref|ZP_08307119.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Klebsiella sp. MS 92-3]
 gi|150953821|gb|ABR75851.1| ATP-dependent Clp protease proteolytic subunit [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|259040177|gb|EEW41289.1| ATP-dependent Clp protease [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328534150|gb|EGF60785.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Klebsiella sp. MS 92-3]
          Length = 194

 Score =  244 bits (622), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 125/194 (64%), Positives = 166/194 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R+
Sbjct: 61  YLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++E+  +RD  +SA+EA
Sbjct: 121 MIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDRFLSAAEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G+VD +L  R 
Sbjct: 181 VEYGLVDSILTHRN 194


>gi|192360657|ref|YP_001982472.1| ATP-dependent Clp protease proteolytic subunit [Cellvibrio
           japonicus Ueda107]
 gi|190686822|gb|ACE84500.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Cellvibrio
           japonicus Ueda107]
          Length = 214

 Score =  244 bits (622), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 124/215 (57%), Positives = 162/215 (75%), Gaps = 1/215 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++    +    +  GLVP+V+EQT RGERS+DIYSRLLKER++F+ G +ED+MA L+ 
Sbjct: 1   MSYDYPKSQSPI-INSGLVPIVIEQTARGERSFDIYSRLLKERVIFLVGPVEDYMANLVV 59

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+
Sbjct: 60  AQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQACSMGAFLLN 119

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG +G RF LPN+R+++HQPSGG  GQASDI   AQ+I+KI+ RLNE+   + G+  E +
Sbjct: 120 AGAEGKRFCLPNSRVMIHQPSGGAQGQASDIHIQAQEILKIRARLNELMAHHSGQPIERI 179

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           E   +RD+ MSA +A D+G++D V+  RI      
Sbjct: 180 EVDTERDNFMSAQQAKDYGLIDAVVEKRIMTTSTK 214


>gi|255102472|ref|ZP_05331449.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           difficile QCD-63q42]
          Length = 194

 Score =  243 bits (621), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 117/194 (60%), Positives = 152/194 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQT RGERSYDI+SRLLK+RI+F+  Q+ D  A LI AQLLFLEAE+P K+I
Sbjct: 1   MALVPVVVEQTGRGERSYDIFSRLLKDRIIFLGDQVNDATAGLIVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG R ALPN+ I
Sbjct: 61  HLYINSPGGSITSGMAIYDTMQYIKPDVSTICIGMAASMGAFLLAAGAKGKRLALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE HA+ I+KIK  LNEI+ +  G+  E+++   +RD+ MSA EA
Sbjct: 121 MIHQPLGGAQGQATDIEIHAKRILKIKETLNEIFSERTGQPLEKIKMDTERDNFMSALEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V   R 
Sbjct: 181 KEYGLIDEVFTKRP 194


>gi|170751514|ref|YP_001757774.1| endopeptidase Clp [Methylobacterium radiotolerans JCM 2831]
 gi|226706463|sp|B1LW28|CLPP_METRJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|170658036|gb|ACB27091.1| Endopeptidase Clp [Methylobacterium radiotolerans JCM 2831]
          Length = 208

 Score =  243 bits (621), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 131/204 (64%), Positives = 172/204 (84%), Gaps = 1/204 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  DV+   LVPMVVEQ++RGER++DIYSRLL+ERI+F+TG +ED+ A+LI AQLLFL
Sbjct: 1   MRDPIDVYNNALVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDYGASLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+KEIS YINSPGGVVT+G++IYDTMQFI+ P++T C+GQAASMGSLLL+AGE G 
Sbjct: 61  EAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVTTLCVGQAASMGSLLLTAGEPGH 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPNARI++HQPSGGF GQA+DI  HA++I  +KRRLNEIYVK+ G+ Y+ +   L+R
Sbjct: 121 RFALPNARIMVHQPSGGFQGQATDILIHAREIEALKRRLNEIYVKHTGRDYDTIHTALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRID 210
           D+ M+A  A ++G++D+V+  R +
Sbjct: 181 DNFMTADAAKEFGLIDEVIEKRPE 204


>gi|22124934|ref|NP_668357.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis KIM
           10]
 gi|45440623|ref|NP_992162.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51595309|ref|YP_069500.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808643|ref|YP_652559.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Antiqua]
 gi|108811098|ref|YP_646865.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Nepal516]
 gi|145600052|ref|YP_001164128.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Pestoides F]
 gi|149364997|ref|ZP_01887032.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis CA88-4125]
 gi|153950622|ref|YP_001402052.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           pseudotuberculosis IP 31758]
 gi|162419837|ref|YP_001607420.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Angola]
 gi|165926613|ref|ZP_02222445.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165935884|ref|ZP_02224454.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|166010967|ref|ZP_02231865.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166212961|ref|ZP_02238996.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167398957|ref|ZP_02304481.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167421692|ref|ZP_02313445.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167423463|ref|ZP_02315216.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|170025451|ref|YP_001721956.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           pseudotuberculosis YPIII]
 gi|186894326|ref|YP_001871438.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930187|ref|YP_002348062.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           CO92]
 gi|229838761|ref|ZP_04458920.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229896085|ref|ZP_04511255.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis Pestoides A]
 gi|229899329|ref|ZP_04514472.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901327|ref|ZP_04516449.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis Nepal516]
 gi|270489513|ref|ZP_06206587.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis KIM D27]
 gi|294504888|ref|YP_003568950.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Z176003]
 gi|21759072|sp|Q8ZC65|CLPP_YERPE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|60389537|sp|Q66DT4|CLPP_YERPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|122980282|sp|Q1CL65|CLPP_YERPN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|123072666|sp|Q1C4K8|CLPP_YERPA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214723|sp|A4TPE3|CLPP_YERPP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167008652|sp|A7FLC4|CLPP_YERP3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|21957773|gb|AAM84608.1|AE013706_3 ATP-dependent proteolytic subunit of clpA-clpP serine protease,
           heat shock protein F21.5 [Yersinia pestis KIM 10]
 gi|45435480|gb|AAS61039.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis biovar Microtus str. 91001]
 gi|51588591|emb|CAH20199.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease,
           heat shock protein F21.5 [Yersinia pseudotuberculosis IP
           32953]
 gi|108774746|gb|ABG17265.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis Nepal516]
 gi|108780556|gb|ABG14614.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis Antiqua]
 gi|115348798|emb|CAL21752.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis CO92]
 gi|145211748|gb|ABP41155.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis Pestoides F]
 gi|149291410|gb|EDM41484.1| ATP-dependent Clp protease proteolytic subunit ClpP [Yersinia
           pestis CA88-4125]
 gi|152962117|gb|ABS49578.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pseudotuberculosis IP 31758]
 gi|162352652|gb|ABX86600.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis Angola]
 gi|165916029|gb|EDR34636.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|165921541|gb|EDR38738.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165989967|gb|EDR42268.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166205748|gb|EDR50228.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|166960611|gb|EDR56632.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167051461|gb|EDR62869.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167057633|gb|EDR67379.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|169751985|gb|ACA69503.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pseudotuberculosis YPIII]
 gi|186697352|gb|ACC87981.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681256|gb|EEO77350.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis Nepal516]
 gi|229687731|gb|EEO79804.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229695127|gb|EEO85174.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701008|gb|EEO89037.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Yersinia pestis Pestoides A]
 gi|262362954|gb|ACY59675.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           D106004]
 gi|262366873|gb|ACY63430.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           D182038]
 gi|270338017|gb|EFA48794.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Yersinia
           pestis KIM D27]
 gi|294355347|gb|ADE65688.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           Z176003]
 gi|320016343|gb|ADV99914.1| ATP-dependent Clp protease proteolytic subunit [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 207

 Score =  243 bits (621), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 170/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQFAPNMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIT 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIFLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG RF LPN+R+++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+
Sbjct: 119 AGAKGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAYHTGKSLEEI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SA ++ ++G+VD V   R 
Sbjct: 179 ERDTERDRFLSAEQSVEYGLVDSVFTRRD 207


>gi|320540337|ref|ZP_08039989.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Serratia symbiotica str. Tucson]
 gi|320029657|gb|EFW11684.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Serratia symbiotica str. Tucson]
          Length = 207

 Score =  243 bits (621), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 128/209 (61%), Positives = 169/209 (80%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  ++D     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERDQCAPNMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAE+P+K+I LYINSPGGV+TAGM+IYDTM+FIKP +ST CMGQA SMGS LL+
Sbjct: 59  AQMLFLEAESPEKDIFLYINSPGGVITAGMSIYDTMKFIKPDVSTICMGQACSMGSFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG K  RF LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G++  ++
Sbjct: 119 AGAKSKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAEHTGQSLAQI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E   +RD  M+A EA ++G+VD +L  R 
Sbjct: 179 ECDTERDRFMTADEAVEYGLVDGILTHRS 207


>gi|218289882|ref|ZP_03494072.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Alicyclobacillus acidocaldarius LAA1]
 gi|258511244|ref|YP_003184678.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|218240022|gb|EED07208.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Alicyclobacillus acidocaldarius LAA1]
 gi|257477970|gb|ACV58289.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 192

 Score =  243 bits (621), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 109/192 (56%), Positives = 147/192 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQT+RGERSYDIYSRLLK+RI+F+   I+D +A  + AQLLFL A++P K+I
Sbjct: 1   MSLIPYVIEQTSRGERSYDIYSRLLKDRIIFLGTPIDDDVANAVVAQLLFLAADDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG V+AG+AIYDTMQ IKP +ST C+G AASM ++LL+AG KG R+ALPN+ +
Sbjct: 61  QMYINSPGGSVSAGLAIYDTMQHIKPDVSTMCVGMAASMAAVLLAAGAKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE HA+ I+K + RLN I  +  G+  E V +  DRD+ MSA EA
Sbjct: 121 MIHQPLGGARGQASDIEIHARHILKTRERLNRILAERTGQPLERVAQDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++D+V+  
Sbjct: 181 KAYGLIDEVIYR 192


>gi|73541074|ref|YP_295594.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia eutropha
           JMP134]
 gi|124013825|sp|Q472D3|CLPP_RALEJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|72118487|gb|AAZ60750.1| ATP-dependent Clp protease proteolytic subunit ClpP [Ralstonia
           eutropha JMP134]
          Length = 216

 Score =  243 bits (621), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 119/194 (61%), Positives = 153/194 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 23  LGLVPMVVEQSGRGERAYDIYSRLLKERVVFLVGEVNDQTANLVVAQLLFLESENPDKDI 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AG+AIYDTMQF+KP + T CMG AASMG+ LL+AG KG R ALPN+RI
Sbjct: 83  SLYINSPGGSVSAGLAIYDTMQFVKPDVQTLCMGMAASMGAFLLAAGAKGKRSALPNSRI 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN I  +  G+  E++ +  DRD+ MS  +A
Sbjct: 143 MIHQPLGGARGQASDIEIQAREILYLRERLNSILSEVTGQPVEKIARDTDRDNFMSGDQA 202

Query: 196 CDWGVVDKVLMSRI 209
            D+G++DKV+  R 
Sbjct: 203 VDYGLIDKVIARRS 216


>gi|260596809|ref|YP_003209380.1| ATP-dependent Clp protease proteolytic subunit [Cronobacter
           turicensis z3032]
 gi|260215986|emb|CBA28638.1| ATP-dependent Clp protease proteolytic subunit [Cronobacter
           turicensis z3032]
          Length = 214

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 125/202 (61%), Positives = 167/202 (82%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           ++D     + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+ED MA LI AQ+LFLE
Sbjct: 13  ERDQFAPHMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDQMANLIVAQMLFLE 72

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+K+I LYINSPGGV+TAGM+IYDTMQFI+P +ST CMGQAASMG+ LL+AG KG R
Sbjct: 73  AENPEKDIYLYINSPGGVITAGMSIYDTMQFIQPDVSTICMGQAASMGAFLLTAGTKGKR 132

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G+  E++E+  +RD
Sbjct: 133 FCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQPLEQIERDTERD 192

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
             +SA EA ++G+VD ++  R 
Sbjct: 193 RFLSAGEAVEYGLVDSIMTHRN 214


>gi|182417589|ref|ZP_02948911.1| Clp protease [Clostridium butyricum 5521]
 gi|237667767|ref|ZP_04527751.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           butyricum E4 str. BoNT E BL5262]
 gi|182378544|gb|EDT76073.1| Clp protease [Clostridium butyricum 5521]
 gi|237656115|gb|EEP53671.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           butyricum E4 str. BoNT E BL5262]
          Length = 201

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 117/201 (58%), Positives = 157/201 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+ ++G++ D  A LI AQLLFL++E+P K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIFSRLLKERIIMLSGEVNDASAQLIVAQLLFLDSEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGMAIYDTMQ I   +ST C+G AASMG+ LLS G KG R+ALPNA I
Sbjct: 61  SLYINSPGGSVTAGMAIYDTMQLINADVSTICVGMAASMGAFLLSCGAKGKRYALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQ +DIE HA  ++K+K  LN+   +N GK  E +++  +RD+ MSA +A
Sbjct: 121 MIHQPLGGFQGQVTDIEIHANRMLKVKEVLNKTLSENTGKPLEVIQRDTERDNFMSAEDA 180

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
            ++G+VD++++ +   +EKS+
Sbjct: 181 KEYGLVDEIIVKKPKNKEKSE 201


>gi|77360986|ref|YP_340561.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           haloplanktis TAC125]
 gi|110816463|sp|Q3IF46|CLPP_PSEHT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|76875897|emb|CAI87118.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           (Caseinolytic protease) (Protease Ti)(Heat shock protein
           F21.5) [Pseudoalteromonas haloplanktis TAC125]
          Length = 205

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 125/197 (63%), Positives = 156/197 (79%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT +GERSYDIYSRLLKERI+F+TG +ED+MA LI AQ+LFLE+ENP 
Sbjct: 7   DPLNALVPMVVEQTPKGERSYDIYSRLLKERIIFLTGPVEDNMANLILAQMLFLESENPD 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAGMAIYDTM FIKP +ST C+GQAASMG+ LL+AG KG RF LPN
Sbjct: 67  KDIFLYINSPGGSVTAGMAIYDTMNFIKPDVSTICVGQAASMGAFLLTAGAKGKRFCLPN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQASD E HA++I+ IK +LN +  ++ G+  + + K  DRD+ MSA
Sbjct: 127 SRVMIHQPLGGFQGQASDFEIHAKEILSIKDKLNRLMAEHTGQPLDVISKDTDRDNFMSA 186

Query: 193 SEACDWGVVDKVLMSRI 209
            +A D+G+VD V  +R 
Sbjct: 187 DQAVDYGIVDSVFKNRA 203


>gi|171463607|ref|YP_001797720.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171193145|gb|ACB44106.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 209

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 121/209 (57%), Positives = 159/209 (76%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M +     ++ E   LGLVPMV+E + RGER+YDIYSRLL+ER++F+ G++ D  A L+ 
Sbjct: 1   MIYNHSQSENLEPKGLGLVPMVIETSGRGERAYDIYSRLLRERVIFLVGEVNDQTANLVI 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP KEISLYINSPGG V+AG+AIYDTMQFIKP +ST CMG AASMG+ LL 
Sbjct: 61  AQLLFLESENPDKEISLYINSPGGAVSAGLAIYDTMQFIKPHVSTLCMGMAASMGAFLLC 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AGE G R+ALPN+R+++HQP GG  GQASDIE  A++I+ ++ RLN+I     G++ E +
Sbjct: 121 AGENGKRYALPNSRVMIHQPLGGARGQASDIEIQAREILYLRERLNKILADRTGQSIETI 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
            K  DRD+ MSA +A D+G++DKV+  R 
Sbjct: 181 AKDTDRDNFMSAEQARDYGLIDKVIEKRP 209


>gi|163793182|ref|ZP_02187158.1| Protease subunit of ATP-dependent Clp protease [alpha
           proteobacterium BAL199]
 gi|159181828|gb|EDP66340.1| Protease subunit of ATP-dependent Clp protease [alpha
           proteobacterium BAL199]
          Length = 213

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 129/210 (61%), Positives = 173/210 (82%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             +  D+++  LVPMVVEQTNRGER+YDIYSRLLKERI+FV G I D +A+++CAQLLFL
Sbjct: 1   MANPVDIYMNSLVPMVVEQTNRGERAYDIYSRLLKERIIFVMGPINDAVASVVCAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP K+I++YINSPGG+VT+GMA+YDTM++++P IST CMG AASMGSLLL+AG  G 
Sbjct: 61  EAENPTKDIAMYINSPGGIVTSGMAMYDTMEYVRPEISTVCMGHAASMGSLLLTAGAPGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ LPNA++++HQPSGGF GQASDIE HA++I+K + RLN+IYVK+ G++ +E+EK +DR
Sbjct: 121 RYCLPNAKVMIHQPSGGFQGQASDIEIHAREIIKTRERLNQIYVKHSGRSIDEIEKGMDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           D+ M+A EA  +G++D+V+  R    E  K
Sbjct: 181 DNFMTADEAKAFGLIDEVIHKRPAPVETDK 210


>gi|171059225|ref|YP_001791574.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Leptothrix
           cholodnii SP-6]
 gi|226706459|sp|B1Y6H3|CLPP_LEPCP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|170776670|gb|ACB34809.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Leptothrix
           cholodnii SP-6]
          Length = 202

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 113/198 (57%), Positives = 156/198 (78%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   LG+VP+V+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP
Sbjct: 5   ETQNLGMVPIVIEQSGRGERAYDIYSRLLRERVIFLVGPVNDQSANLVVAQLLFLESENP 64

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+IS YINSPGG V+AGM+IYDTMQFIKP +ST CMG AASMG+ LL+AG KG RF+LP
Sbjct: 65  DKDISFYINSPGGSVSAGMSIYDTMQFIKPQVSTLCMGLAASMGAFLLAAGAKGKRFSLP 124

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N++I++HQP GG  GQA+DIE HA++I+K + +LN I  +  G++ E+++   +RD+ MS
Sbjct: 125 NSKIMIHQPLGGAQGQATDIEIHAREILKTREQLNRILAERTGQSLEKIQNDTERDYFMS 184

Query: 192 ASEACDWGVVDKVLMSRI 209
           + EA  +G++D+V+  R 
Sbjct: 185 SEEAQTYGLIDQVISKRP 202


>gi|222528715|ref|YP_002572597.1| ATP-dependent Clp protease proteolytic subunit
           [Caldicellulosiruptor bescii DSM 6725]
 gi|312622971|ref|YP_004024584.1| ATP-dependent clp protease, proteolytic subunit clpp
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|222455562|gb|ACM59824.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor bescii DSM 6725]
 gi|312203438|gb|ADQ46765.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 195

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 120/195 (61%), Positives = 154/195 (78%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVP+V+EQTNRGER+YDIYSRLLK+RIV ++G+I D +A+LI AQLLFLEAE+P K+
Sbjct: 1   MSALVPIVIEQTNRGERAYDIYSRLLKDRIVILSGEITDDIASLIVAQLLFLEAEDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGG VTAG AIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ 
Sbjct: 61  IYLYINSPGGSVTAGFAIYDTMQYIKPDVSTICVGLAASMGAFLLAAGAKGKRFALPNSE 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQA+DI+ HA+ I+KIK R+N+I  +  G+  E +E+  DRD  M+A E
Sbjct: 121 IMIHQPLGGVRGQATDIKIHAEWILKIKNRINKILSERTGQPIEVIERDTDRDFFMTAEE 180

Query: 195 ACDWGVVDKVLMSRI 209
           A  +G++DKV+  R 
Sbjct: 181 ALKYGIIDKVIERRP 195


>gi|260438109|ref|ZP_05791925.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Butyrivibrio
           crossotus DSM 2876]
 gi|292809590|gb|EFF68795.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Butyrivibrio
           crossotus DSM 2876]
          Length = 194

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 115/194 (59%), Positives = 150/194 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A ++ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVTDVSANIVVAQLLFLEAEDPGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTM +IK  +ST C+G AASMG+ LLS G KG RFALPNA I
Sbjct: 61  QLYINSPGGSVTAGMAIYDTMNYIKSDVSTICIGMAASMGAFLLSGGTKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  G ASD++  A  I+K K++LNEI  KN GK  + +E+  DRD+ M+A EA
Sbjct: 121 MIHQPSGGSRGMASDMKIVADQILKTKQKLNEILAKNTGKPIDVIERDTDRDNYMTAQEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D ++ +R 
Sbjct: 181 LEYGLIDSIIENRK 194


>gi|261346364|ref|ZP_05974008.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Providencia
           rustigianii DSM 4541]
 gi|282565678|gb|EFB71213.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Providencia
           rustigianii DSM 4541]
          Length = 206

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 128/193 (66%), Positives = 164/193 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 14  MALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 74  HLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGTKGKRFCLPNSRV 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HAQ+I+K+K R+NE+   + GK+ EE+ +  +RD  +SA+EA
Sbjct: 134 MIHQPLGGYQGQATDIEIHAQEILKVKSRMNELMAHHTGKSIEEISRDTERDRFLSANEA 193

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD +  SR
Sbjct: 194 KEYGLVDHIYTSR 206


>gi|225389281|ref|ZP_03759005.1| hypothetical protein CLOSTASPAR_03027 [Clostridium asparagiforme
           DSM 15981]
 gi|225044660|gb|EEG54906.1| hypothetical protein CLOSTASPAR_03027 [Clostridium asparagiforme
           DSM 15981]
          Length = 193

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 116/192 (60%), Positives = 155/192 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A+LI AQLLFLEAE+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVNDVSASLIVAQLLFLEAEDPGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAGMAIYDTM +IK  +ST C+G AASMG+ LLS G KG RF+LPN++I
Sbjct: 61  NLYINSPGGSVTAGMAIYDTMNYIKSDVSTICIGMAASMGAFLLSGGAKGKRFSLPNSQI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A++I+K KR+LNEI   N GK  E +E+  +RD+ MSA EA
Sbjct: 121 MIHQPSGGAQGQATEIKIVAENILKTKRKLNEILAANTGKPLEVIERDTERDYYMSAEEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+++ +
Sbjct: 181 REYGLIDQIITN 192


>gi|238759262|ref|ZP_04620429.1| ATP-dependent Clp protease proteolytic subunit [Yersinia aldovae
           ATCC 35236]
 gi|238702549|gb|EEP95099.1| ATP-dependent Clp protease proteolytic subunit [Yersinia aldovae
           ATCC 35236]
          Length = 194

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 128/194 (65%), Positives = 163/194 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 61  FLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+E+  +RD  +SA +A
Sbjct: 121 MIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAHHTGKSLEEIERDTERDRFLSAQQA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G+VD V   R 
Sbjct: 181 VEYGLVDSVFTRRD 194


>gi|300856723|ref|YP_003781707.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           ljungdahlii DSM 13528]
 gi|300436838|gb|ADK16605.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           ljungdahlii DSM 13528]
          Length = 194

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 115/194 (59%), Positives = 154/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQT+RGERSYDIYSRLLK+RIV ++ ++ D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTSRGERSYDIYSRLLKDRIVMLSEEVNDVSASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GMAIYDTMQ+IK  +ST C+G  ASMG+ LL+AG KG RFALPNA I
Sbjct: 61  YLYINSPGGSITSGMAIYDTMQYIKSDVSTICIGMGASMGAFLLTAGAKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA+ I+ IK++LN I  +  G+  E+VEK  +RD+ M+A EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHAKRILDIKKKLNTIISERTGQPLEKVEKDTERDNFMTAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V+  + 
Sbjct: 181 KEYGLIDEVITKKK 194


>gi|260913095|ref|ZP_05919577.1| ATP-dependent Clp protease [Pasteurella dagmatis ATCC 43325]
 gi|260632682|gb|EEX50851.1| ATP-dependent Clp protease [Pasteurella dagmatis ATCC 43325]
          Length = 193

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 160/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P+K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCVGQACSMGAFLLAGGTAGKRIALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G++ E +E+  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIERIERDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 KAYGLVDEVLVKR 193


>gi|238788008|ref|ZP_04631804.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           frederiksenii ATCC 33641]
 gi|238723956|gb|EEQ15600.1| ATP-dependent Clp protease proteolytic subunit [Yersinia
           frederiksenii ATCC 33641]
          Length = 194

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 128/194 (65%), Positives = 163/194 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 61  FLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+E+  +RD  +SA +A
Sbjct: 121 MIHQPLGGFQGQATDIEIHAKEILKVKSRMNELMAHHTGKSLEEIERDTERDRFLSAEQA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G+VD V   R 
Sbjct: 181 VEYGLVDSVFTRRD 194


>gi|257455804|ref|ZP_05621030.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Enhydrobacter
           aerosaccus SK60]
 gi|257446818|gb|EEV21835.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Enhydrobacter
           aerosaccus SK60]
          Length = 224

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 121/208 (58%), Positives = 163/208 (78%)

Query: 4   EGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           +    +D       LVPMVVEQ+ RGERS+DIYSRLL+ER+VF+ GQ+EDHMA LI AQL
Sbjct: 16  QNTVTRDVLSPQSALVPMVVEQSARGERSFDIYSRLLRERVVFLAGQVEDHMANLIVAQL 75

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           LFLEAENP+K+I LYINSPGG V+AG+A++DTM FI+P +ST CMG A SMGS LL+AGE
Sbjct: 76  LFLEAENPEKDIHLYINSPGGSVSAGLAVFDTMNFIQPQVSTICMGGAYSMGSFLLAAGE 135

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
           KG R+AL NAR+++HQPSGG  GQA+DIE +A++I+KI+ RLN+I  +  G+  E++ + 
Sbjct: 136 KGKRYALANARVMIHQPSGGAQGQATDIEINAREILKIRERLNKILAERTGQPLEKIARD 195

Query: 184 LDRDHIMSASEACDWGVVDKVLMSRIDI 211
           ++RD+ + A EA ++G++D+VL  R  I
Sbjct: 196 VERDYWLDAQEAKEYGLIDEVLEKRPSI 223


>gi|251791978|ref|YP_003006698.1| ATP-dependent Clp protease proteolytic subunit [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533365|gb|ACS96611.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Aggregatibacter aphrophilus NJ8700]
          Length = 193

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 119/193 (61%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVV+QT+RGER+YDIYSRLLK+R++F++G++ED+MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVDQTSRGERAYDIYSRLLKDRVIFLSGEVEDNMANLIVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R  LP+AR+
Sbjct: 61  NLYINSPGGSVTAGMAIYDTMQFIKPDVRTLCVGQACSMGAFLLAGGAPGKRGVLPHARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+  E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKSTLNERLAFHTGQPIETIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD+V   R
Sbjct: 181 QNYGLVDEVFTKR 193


>gi|307265821|ref|ZP_07547372.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919216|gb|EFN49439.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 195

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 111/195 (56%), Positives = 152/195 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDI+SRLLK+RIVF+  +I D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPIVVEQTNRGERSYDIFSRLLKDRIVFLGEEINDTTASLVIAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAG AIYDTMQ+IKP + T C+G AASM + LL+AG KG RFALPN+ I
Sbjct: 61  WLYINSPGGSITAGFAIYDTMQYIKPDVVTLCVGMAASMAAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA+ I+K++ +L++I  +N G+  E+++   +RD  M A +A
Sbjct: 121 MIHQPLGGMQGQATDIKIHAERILKLRDKLDKILAENTGQPIEKIKADTERDFFMDAEDA 180

Query: 196 CDWGVVDKVLMSRID 210
             +G++D+VL+ +  
Sbjct: 181 KAYGIIDEVLVRKKK 195


>gi|312128165|ref|YP_003993039.1| ATP-dependent clp protease, proteolytic subunit clpp
           [Caldicellulosiruptor hydrothermalis 108]
 gi|312134617|ref|YP_004001955.1| ATP-dependent clp protease, proteolytic subunit clpp
           [Caldicellulosiruptor owensensis OL]
 gi|312792981|ref|YP_004025904.1| ATP-dependent clp protease, proteolytic subunit clpp
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312876447|ref|ZP_07736431.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311774668|gb|ADQ04155.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor owensensis OL]
 gi|311778184|gb|ADQ07670.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311796805|gb|EFR13150.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|312180121|gb|ADQ40291.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 195

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 120/195 (61%), Positives = 154/195 (78%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVP+V+EQTNRGER+YDIYSRLLK+RIV ++G+I D +A+LI AQLLFLEAE+P K+
Sbjct: 1   MSALVPIVIEQTNRGERAYDIYSRLLKDRIVILSGEITDDIASLIVAQLLFLEAEDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGG VTAG AIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ 
Sbjct: 61  IYLYINSPGGSVTAGFAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRFALPNSE 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQA+DI+ HA+ I+KIK R+N+I  +  G+  E +E+  DRD  M+A E
Sbjct: 121 IMIHQPLGGVRGQATDIKIHAEWILKIKNRINKILSERTGQPIEVIERDTDRDFFMTAEE 180

Query: 195 ACDWGVVDKVLMSRI 209
           A  +G++DKV+  R 
Sbjct: 181 ALKYGIIDKVIERRP 195


>gi|258544428|ref|ZP_05704662.1| endopeptidase Clp [Cardiobacterium hominis ATCC 15826]
 gi|258520317|gb|EEV89176.1| endopeptidase Clp [Cardiobacterium hominis ATCC 15826]
          Length = 206

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 118/196 (60%), Positives = 155/196 (79%), Gaps = 2/196 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMVVEQT RGERSYDIYSRLLKER++F+ G + D  A L+ AQ+LFLEAENP ++I L
Sbjct: 8   LIPMVVEQTGRGERSYDIYSRLLKERVIFLVGPVNDASANLVVAQMLFLEAENPDQDIHL 67

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM++YDTM FIKP +ST C+GQAASMG++LL+AG KG RFALP++R+++
Sbjct: 68  YINSPGGSVTAGMSVYDTMNFIKPDVSTLCLGQAASMGAMLLTAGAKGKRFALPHSRVMI 127

Query: 138 HQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP       GQASDIE HA++++K+K  LNE+  K+ G+  E++E+  DRD+ MSA EA
Sbjct: 128 HQPLISGGLGGQASDIEIHARELLKMKATLNELLAKHSGQPLEKIERDTDRDNFMSAEEA 187

Query: 196 CDWGVVDKVLMSRIDI 211
             +G++D V  +R DI
Sbjct: 188 AAYGLIDHVTTARADI 203


>gi|317405213|gb|EFV85552.1| ATP-dependent Clp protease proteolytic subunit [Achromobacter
           xylosoxidans C54]
          Length = 217

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 116/195 (59%), Positives = 153/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDATANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V AGMAIYDTMQF+KP +ST C G AASMG+ LL+AG+KG RF LPN+RI
Sbjct: 82  SLYINSPGGSVYAGMAIYDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I   N G++ + +    +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILDLRERLNRILADNTGQSIDRIALDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSRID 210
             +G+VDKV+ SR +
Sbjct: 202 VSYGLVDKVMTSRSE 216


>gi|134300401|ref|YP_001113897.1| ATP-dependent Clp protease proteolytic subunit [Desulfotomaculum
           reducens MI-1]
 gi|172044337|sp|A4J7L9|CLPP_DESRM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|134053101|gb|ABO51072.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Desulfotomaculum reducens MI-1]
          Length = 195

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 118/195 (60%), Positives = 157/195 (80%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
             GLVP+VVEQTNRGER+YDIYSRLLK+RI+F+ G I+DH+A L+ AQ LFLEAE+P+K+
Sbjct: 1   MSGLVPIVVEQTNRGERAYDIYSRLLKDRIIFIGGPIDDHIANLVIAQFLFLEAEDPEKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGGVVTAG+AIYDTMQ+IKP +ST C+GQAASMGS LL+AG  G R+ALP AR
Sbjct: 61  IHLYINSPGGVVTAGLAIYDTMQYIKPAVSTICLGQAASMGSFLLAAGAPGKRYALPMAR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQA+DI+ HA++I+++K  LN+    + G+  E++ +  +RD+ MSA E
Sbjct: 121 IMIHQPLGGVQGQATDIDIHAKEILRMKDLLNDRLAHHTGQPLEQITRDTERDYFMSAEE 180

Query: 195 ACDWGVVDKVLMSRI 209
           A  +G++D+V+  R 
Sbjct: 181 AKKYGLIDEVMPYRK 195


>gi|71083579|ref|YP_266298.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91762000|ref|ZP_01263965.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|115311789|sp|Q4FM94|CLPP_PELUB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|71062692|gb|AAZ21695.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91717802|gb|EAS84452.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 203

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 123/203 (60%), Positives = 169/203 (83%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
              +  D    LVPMVVEQ+N+GER+YDIYSRLLKERI+F+ G I D++A+L+ AQLLFL
Sbjct: 1   MTTNLLDQMNTLVPMVVEQSNKGERAYDIYSRLLKERIIFLVGPINDNVASLVTAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P+KEI+LYINSPGG+VTAG+ IYDTMQ+IKP +ST C+GQAASMGS LL+AG+KG 
Sbjct: 61  ESEDPKKEINLYINSPGGLVTAGLGIYDTMQYIKPDVSTLCIGQAASMGSFLLAAGKKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+RI++HQPS GF GQA+DIE HA +++ +K+RLNEIY K+ GK+ ++V+K L+R
Sbjct: 121 RFSLPNSRIMVHQPSAGFQGQATDIEIHANEVLALKKRLNEIYSKHTGKSVDDVKKALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRI 209
           D+ M+   A ++G++D+V+ +R 
Sbjct: 181 DNFMTPDTAKEFGLIDEVVENRS 203


>gi|92117752|ref|YP_577481.1| endopeptidase Clp [Nitrobacter hamburgensis X14]
 gi|116243151|sp|Q1QL76|CLPP_NITHX RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|91800646|gb|ABE63021.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrobacter
           hamburgensis X14]
          Length = 211

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 138/209 (66%), Positives = 176/209 (84%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED+M+ L+ AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDNMSMLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           A+NP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP++T C GQAASMGSLLL+AGEK MR
Sbjct: 61  ADNPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVATLCTGQAASMGSLLLAAGEKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
            ALPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD
Sbjct: 121 HALPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
             ++A  A D+G+VDKV+  R +     K
Sbjct: 181 KFLTADMARDFGLVDKVIDKRAEEPAAPK 209


>gi|332112672|gb|EGJ12465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rubrivivax
           benzoatilyticus JA2]
          Length = 202

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 120/197 (60%), Positives = 157/197 (79%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   LG+VPMV+EQ+ RGER+YDIYSRLL+ERIVF+ G + D +A L+CAQLLFLE+ENP
Sbjct: 5   ETTGLGMVPMVIEQSGRGERAYDIYSRLLRERIVFLVGPVNDQVANLVCAQLLFLESENP 64

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+ISLYINSPGG V+AG++I+DTM FIKP +ST CMG AASMGS LL AG KG RFALP
Sbjct: 65  DKDISLYINSPGGSVSAGLSIFDTMNFIKPEVSTLCMGMAASMGSFLLMAGAKGKRFALP 124

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQPSGG  GQASDIE  A++I+K + +LN IY +  G++ E++   ++RD  +S
Sbjct: 125 NSRVMIHQPSGGAQGQASDIEIQAREIIKTREQLNRIYAERTGQSIEKIAADMERDMWLS 184

Query: 192 ASEACDWGVVDKVLMSR 208
             EA D+G++D+VL  R
Sbjct: 185 PGEAKDYGLIDQVLEKR 201


>gi|146295915|ref|YP_001179686.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|166201809|sp|A4XHW0|CLPP_CALS8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|145409491|gb|ABP66495.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 195

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 118/195 (60%), Positives = 154/195 (78%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVP+V+EQTNRGER+YDIYSRLLK+RIV ++G+I D +A+LI AQLLFLEAE+P K+
Sbjct: 1   MSALVPIVIEQTNRGERAYDIYSRLLKDRIVILSGEITDDIASLIVAQLLFLEAEDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGG VTAG AIYDT+Q+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ 
Sbjct: 61  IYLYINSPGGSVTAGFAIYDTIQYIKPDVSTICVGMAASMGAFLLAAGAKGKRFALPNSE 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQA+DI+ HA+ I+KIK+R+N I  +  G+  E +E+  +RD  M+A E
Sbjct: 121 IMIHQPIGGVRGQATDIKIHAEWILKIKQRINRILAERTGQPIEVIERDTERDFFMTAEE 180

Query: 195 ACDWGVVDKVLMSRI 209
           A  +G++DKV+  R 
Sbjct: 181 ALKYGIIDKVIERRP 195


>gi|330431763|gb|AEC16822.1| ATP-dependent Clp protease proteolytic subunit [Gallibacterium
           anatis UMN179]
          Length = 195

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 126/194 (64%), Positives = 157/194 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT RGER++DIYSRLLKER++F+ GQ+ED+MA LI AQLLFLEAENP ++I
Sbjct: 1   MALVPMVVEQTARGERAFDIYSRLLKERVIFLNGQVEDNMANLIVAQLLFLEAENPDEDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVTAGMAIYDTMQFIKP + T CMGQA SMG+ LL+ G  G RFALP+ARI
Sbjct: 61  NLYINSPGGVVTAGMAIYDTMQFIKPDVRTLCMGQACSMGAFLLAGGAAGKRFALPHARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQASDI+ HAQ+I+KIK  LN+    + G+  E VE+  DRD+ MSA  A
Sbjct: 121 MIHQPLGGYRGQASDIQIHAQEILKIKDTLNQRLAFHTGQPLEVVERDTDRDNFMSAQAA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+VL  R 
Sbjct: 181 KEYGLIDEVLTHRQ 194


>gi|220934115|ref|YP_002513014.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995425|gb|ACL72027.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 216

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 124/215 (57%), Positives = 167/215 (77%), Gaps = 1/215 (0%)

Query: 1   MSFEGCAKK-DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLI 59
           MS +G   +   +   L LVPMVVEQT RGER+YDIYSRLLKER++F  G +ED+MA +I
Sbjct: 1   MSNQGIGDRGALDTRALNLVPMVVEQTARGERAYDIYSRLLKERVIFAVGPVEDYMANVI 60

Query: 60  CAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLL 119
            AQLLFLE+ENP K+ISLYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG++LL
Sbjct: 61  VAQLLFLESENPDKDISLYINSPGGAVTAGMAIYDTMQFIKPDVSTLCIGQAASMGAVLL 120

Query: 120 SAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEE 179
           + G KG RF LP++R+++HQP GGF GQA+DI+ HA++I+K++  LN I   + G++ E+
Sbjct: 121 AGGAKGKRFCLPHSRVMIHQPLGGFQGQATDIDIHAREILKVRAELNRILAHHTGQSIEQ 180

Query: 180 VEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEK 214
           +E+  +RD  ++  EA ++G++D+VL SR   E+ 
Sbjct: 181 IEQDTERDRFLNPVEAAEYGLIDQVLSSREMAEQA 215


>gi|170744618|ref|YP_001773273.1| ATP-dependent Clp protease proteolytic subunit [Methylobacterium
           sp. 4-46]
 gi|168198892|gb|ACA20839.1| Endopeptidase Clp [Methylobacterium sp. 4-46]
          Length = 208

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 132/206 (64%), Positives = 173/206 (83%), Gaps = 1/206 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  + +   LVPMVVEQ++RGER++DIYSRLL+ERI+F+TG +ED+ A+LI AQLLFL
Sbjct: 1   MRDPVEFYNSALVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDYSASLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+KEIS YINSPGGVVT+G++IYDTMQFI+ P++T C+GQAASMGSLLL+AGE G 
Sbjct: 61  EAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVATLCVGQAASMGSLLLAAGEPGH 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPNARI++HQPSGGF GQA+DI  HA++I  +KRRLNEIYVK+ G+ Y+ +E+ L+R
Sbjct: 121 RFALPNARIMVHQPSGGFQGQATDILIHAREIEALKRRLNEIYVKHTGRDYDAIEQGLER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIE 212
           D+ M+A  A +WG++D+VL  R +  
Sbjct: 181 DNFMTADAAKEWGLIDEVLQKRAETP 206


>gi|114048055|ref|YP_738605.1| ATP-dependent Clp protease proteolytic subunit [Shewanella sp.
           MR-7]
 gi|123326387|sp|Q0HTK7|CLPP_SHESR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|113889497|gb|ABI43548.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella sp.
           MR-7]
          Length = 202

 Score =  243 bits (620), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 126/201 (62%), Positives = 162/201 (80%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             ++ D+   LVPMV+EQT +GERS+DIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE
Sbjct: 1   MHNASDIQSALVPMVIEQTAKGERSFDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG R
Sbjct: 61  SESPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD
Sbjct: 121 FCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNLMLAEHTGQPLEVIERDTDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + MSA++A D+G+VD V+  R
Sbjct: 181 NFMSATQAVDYGLVDAVMTKR 201


>gi|294340353|emb|CAZ88734.1| ATP-dependent Clp protease proteolytic subunit precursor
           (Endopeptidase Clp) (Caseinolytic protease) (Protease
           Ti) (Heat shock protein F21.5) [Thiomonas sp. 3As]
          Length = 202

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 118/194 (60%), Positives = 155/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMV+EQ+ RGER+YDIYSRLL+ER++F+ G I D MA L+ AQLLFLE+ENP K+I
Sbjct: 9   LGLVPMVIEQSGRGERAYDIYSRLLRERVIFLVGPINDQMANLVVAQLLFLESENPDKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AGMAI+DTMQFIKP +ST C G AASMG+ L++AG KG R++LPN+RI
Sbjct: 69  SLYINSPGGSVSAGMAIFDTMQFIKPDVSTLCTGIAASMGAFLMAAGAKGKRYSLPNSRI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DIE  A++I+ ++ RLN I  +  G+T E++    +RD  MSA EA
Sbjct: 129 MIHQPSGGAQGQATDIEIQAREILYLRERLNGILAERTGQTLEKIGIDTERDFFMSADEA 188

Query: 196 CDWGVVDKVLMSRI 209
            D+G++D+V+  R 
Sbjct: 189 KDYGLIDEVISKRS 202


>gi|77165153|ref|YP_343678.1| endopeptidase Clp [Nitrosococcus oceani ATCC 19707]
 gi|254434725|ref|ZP_05048233.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosococcus
           oceani AFC27]
 gi|110816460|sp|Q3JAJ8|CLPP_NITOC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|76883467|gb|ABA58148.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrosococcus
           oceani ATCC 19707]
 gi|207091058|gb|EDZ68329.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosococcus
           oceani AFC27]
          Length = 203

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 122/199 (61%), Positives = 158/199 (79%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT RGER+YDIYSRLLKER+VF+ G +EDHMA L+ AQLLFLE+ENP 
Sbjct: 3   DSLNTLVPMVVEQTARGERAYDIYSRLLKERVVFLVGPVEDHMANLVVAQLLFLESENPD 62

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAG++IYDTMQFIKP +ST C+GQAASMG++LL+ G  G R  LP+
Sbjct: 63  KDIHLYINSPGGSVTAGLSIYDTMQFIKPDVSTLCVGQAASMGAVLLAGGAGGKRHCLPH 122

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+L+HQP GGF GQA+DI+ HA++I+ ++ RLN I  K+ G+  E+++   DRD+ MSA
Sbjct: 123 SRLLIHQPLGGFQGQATDIDIHAREILLVRERLNHILAKHTGQPIEKIQHDTDRDYFMSA 182

Query: 193 SEACDWGVVDKVLMSRIDI 211
           +E+  +G+VD VL  R +I
Sbjct: 183 TESLAYGLVDSVLKQRAEI 201


>gi|153814157|ref|ZP_01966825.1| hypothetical protein RUMTOR_00366 [Ruminococcus torques ATCC 27756]
 gi|317499957|ref|ZP_07958193.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 8_1_57FAA]
 gi|331087820|ref|ZP_08336745.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 3_1_46FAA]
 gi|145848553|gb|EDK25471.1| hypothetical protein RUMTOR_00366 [Ruminococcus torques ATCC 27756]
 gi|316898674|gb|EFV20709.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 8_1_57FAA]
 gi|330409515|gb|EGG88956.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 3_1_46FAA]
          Length = 193

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 113/192 (58%), Positives = 152/192 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A++I AQLLFLEA++P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVNDVSASVIVAQLLFLEADDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQ+IK  +ST C+G AASMG+ LL+ G+KG RFALPNA I
Sbjct: 61  QLYINSPGGSVTAGMAIYDTMQYIKCDVSTVCIGMAASMGAFLLAGGKKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A+ I++ K++LNEI   N G++ E ++   +RD+ MSA EA
Sbjct: 121 MIHQPSGGAQGQATEIQIAAEHILRTKQKLNEILAANTGQSLETIKADTERDNFMSADEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++D+V+  
Sbjct: 181 KAYGLIDEVIAK 192


>gi|292493106|ref|YP_003528545.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrosococcus
           halophilus Nc4]
 gi|291581701|gb|ADE16158.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosococcus
           halophilus Nc4]
          Length = 203

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 121/199 (60%), Positives = 159/199 (79%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT RGER+YDIYSRLLKER+VF+ G +EDHMA L+ AQLLFLE+ENP 
Sbjct: 3   DSLNTLVPMVVEQTARGERAYDIYSRLLKERVVFLVGPVEDHMANLVVAQLLFLESENPD 62

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAG+++YDTMQFIKP IST C+GQAASMG++LL+ G +G R  LP+
Sbjct: 63  KDIHLYINSPGGSVTAGLSVYDTMQFIKPDISTLCIGQAASMGAVLLAGGTQGKRHCLPH 122

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+L+HQP GGF GQA+DI+ HA++I+ ++ RLN I  K+ G+  E++++  DRD+ MSA
Sbjct: 123 SRLLIHQPLGGFQGQAADIDIHAREIMLVRERLNHILAKHTGQPIEKIQRDTDRDYFMSA 182

Query: 193 SEACDWGVVDKVLMSRIDI 211
           +E+  +G+VD VL  R + 
Sbjct: 183 NESVAYGLVDSVLQQRGET 201


>gi|114767020|ref|ZP_01445928.1| Protease subunit of ATP-dependent Clp protease [Pelagibaca
           bermudensis HTCC2601]
 gi|114540804|gb|EAU43868.1| Protease subunit of ATP-dependent Clp protease [Roseovarius sp.
           HTCC2601]
          Length = 210

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 131/209 (62%), Positives = 174/209 (83%), Gaps = 1/209 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  + ++  LVPMVVEQT+RGER+YDI+SRLLKERI+FV+G + D M++LI AQLL L
Sbjct: 1   MKDPFETYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFVSGPVHDGMSSLIVAQLLHL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G++IYDTMQ+I+P +ST  +GQAASMGSLLL+AGE GM
Sbjct: 61  EAENPSKEISMYINSPGGVVTSGLSIYDTMQYIRPKVSTLVIGQAASMGSLLLTAGEAGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+RI++HQPSGG+ GQA+DI  HA++ +K+KRRLNEIYV++ G+T E VE  L+R
Sbjct: 121 RFSLPNSRIMVHQPSGGYQGQATDIMIHAEETLKLKRRLNEIYVRHTGQTLENVEAALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ M+  +A +WG++D+++ SR   EE  
Sbjct: 181 DNFMAPEDAKEWGLIDEIVESRGAAEEAK 209


>gi|300900508|ref|ZP_07118675.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 198-1]
 gi|300924164|ref|ZP_07140156.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 182-1]
 gi|300937054|ref|ZP_07151920.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 21-1]
 gi|300958005|ref|ZP_07170169.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 175-1]
 gi|300988008|ref|ZP_07178488.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 45-1]
 gi|300997374|ref|ZP_07181714.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 200-1]
 gi|301022569|ref|ZP_07186441.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 69-1]
 gi|301049644|ref|ZP_07196593.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 185-1]
 gi|301301588|ref|ZP_07207723.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 124-1]
 gi|301647363|ref|ZP_07247175.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 146-1]
 gi|309787029|ref|ZP_07681641.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           dysenteriae 1617]
 gi|312964538|ref|ZP_07778794.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 2362-75]
 gi|312970533|ref|ZP_07784714.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 1827-70]
 gi|300298581|gb|EFJ54966.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 185-1]
 gi|300304193|gb|EFJ58713.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 200-1]
 gi|300315272|gb|EFJ65056.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 175-1]
 gi|300355989|gb|EFJ71859.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 198-1]
 gi|300397450|gb|EFJ80988.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 69-1]
 gi|300407560|gb|EFJ91098.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 45-1]
 gi|300419617|gb|EFK02928.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 182-1]
 gi|300457885|gb|EFK21378.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 21-1]
 gi|300843085|gb|EFK70845.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 124-1]
 gi|301074508|gb|EFK89314.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 146-1]
 gi|308924607|gb|EFP70102.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           dysenteriae 1617]
 gi|310337182|gb|EFQ02320.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 1827-70]
 gi|312290772|gb|EFR18649.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 2362-75]
 gi|313646936|gb|EFS11393.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           flexneri 2a str. 2457T]
 gi|315256265|gb|EFU36233.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 85-1]
 gi|315289845|gb|EFU49235.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 110-3]
 gi|315294229|gb|EFU53580.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 153-1]
 gi|315299561|gb|EFU58809.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 16-3]
 gi|315616622|gb|EFU97239.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 3431]
 gi|323153474|gb|EFZ39728.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli EPECa14]
 gi|323160452|gb|EFZ46400.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli E128010]
 gi|323164238|gb|EFZ50045.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           sonnei 53G]
 gi|323170523|gb|EFZ56173.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli LT-68]
 gi|323178294|gb|EFZ63872.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 1180]
 gi|323184732|gb|EFZ70103.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli 1357]
 gi|323191357|gb|EFZ76620.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli RN587/1]
 gi|324010068|gb|EGB79287.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 57-2]
 gi|324010651|gb|EGB79870.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 60-1]
 gi|324016702|gb|EGB85921.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli MS 117-3]
 gi|325498272|gb|EGC96131.1| ATP-dependent Clp protease proteolytic subunit [Escherichia
           fergusonii ECD227]
 gi|327254765|gb|EGE66381.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Escherichia
           coli STEC_7v]
 gi|332085596|gb|EGI90760.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           dysenteriae 155-74]
 gi|332094593|gb|EGI99639.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           boydii 5216-82]
 gi|332098592|gb|EGJ03558.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Shigella
           boydii 3594-74]
          Length = 194

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 125/194 (64%), Positives = 165/194 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R+
Sbjct: 61  YLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G+VD +L  R 
Sbjct: 181 VEYGLVDSILTHRN 194


>gi|251798425|ref|YP_003013156.1| ATP-dependent Clp protease proteolytic subunit ClpP [Paenibacillus
           sp. JDR-2]
 gi|247546051|gb|ACT03070.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           sp. JDR-2]
          Length = 195

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 123/192 (64%), Positives = 159/192 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+F+   I+D +A  + AQLLFL A++P+K+I
Sbjct: 1   MNLVPIVVEQTNRGERSYDIYSRLLKDRIIFLGSAIDDDVANSVIAQLLFLAADDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQ+IKP +ST CMG AASMGSLLL+AG KG RFALPNA +
Sbjct: 61  HLYINSPGGSVTAGMAIYDTMQYIKPDVSTICMGMAASMGSLLLTAGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI+ HA  I+K K++LNEIYV+  G+ YE++++  DRD+ MSA +A
Sbjct: 121 MIHQPLGGVRGQASDIKIHADWILKTKQKLNEIYVERTGQPYEKIDRDTDRDNFMSAEDA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++DKV+ +
Sbjct: 181 LNYGLIDKVITT 192


>gi|212709197|ref|ZP_03317325.1| hypothetical protein PROVALCAL_00230 [Providencia alcalifaciens DSM
           30120]
 gi|212688109|gb|EEB47637.1| hypothetical protein PROVALCAL_00230 [Providencia alcalifaciens DSM
           30120]
          Length = 206

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 128/193 (66%), Positives = 165/193 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 14  MALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 73

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 74  QLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGTKGKRFCLPNSRV 133

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HAQ+I+K+K R+NE+  ++ GK+ EE+ +  +RD  +SA+EA
Sbjct: 134 MIHQPLGGYQGQATDIEIHAQEILKVKSRMNELMAQHTGKSIEEISRDTERDRFLSANEA 193

Query: 196 CDWGVVDKVLMSR 208
            ++G+VD +  SR
Sbjct: 194 KEYGLVDHIYTSR 206


>gi|156935010|ref|YP_001438926.1| hypothetical protein ESA_02861 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533264|gb|ABU78090.1| hypothetical protein ESA_02861 [Cronobacter sakazakii ATCC BAA-894]
          Length = 194

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 124/194 (63%), Positives = 164/194 (84%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+ED MA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDQMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFI+P +ST CMGQAASMG+ LL+AG KG RF LPN+R+
Sbjct: 61  YLYINSPGGVITAGMSIYDTMQFIQPDVSTICMGQAASMGAFLLTAGTKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE HA++I+K+K R+NE+  ++ G+  E++E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGYQGQATDIEIHAREILKVKARMNELMAQHTGQPLEQIERDTERDRFLSAGEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G+VD ++  R 
Sbjct: 181 VEYGLVDSIMTHRN 194


>gi|116243127|sp|Q0VQ90|CLPP_ALCBS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 205

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 129/199 (64%), Positives = 162/199 (81%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
            +   LGLVP+V+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA LI AQ+LFLE+EN
Sbjct: 6   KDPTNLGLVPVVIEQTARGERSFDIYSRLLKERVIFMIGQVEDHMANLIVAQMLFLESEN 65

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+AG  G RFAL
Sbjct: 66  PDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGAFLLTAGAAGKRFAL 125

Query: 131 PNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM 190
           PNAR+++HQP GGF GQASDIE HA++I+KIK +LN +   + G+  E++EK  DRD+ M
Sbjct: 126 PNARVMIHQPLGGFQGQASDIEIHAKEILKIKGQLNSLLAHHTGQPIEQLEKDTDRDNFM 185

Query: 191 SASEACDWGVVDKVLMSRI 209
           SA EA ++G++D VL  R 
Sbjct: 186 SADEAKEYGIIDAVLSQRP 204


>gi|170692395|ref|ZP_02883558.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           graminis C4D1M]
 gi|307729638|ref|YP_003906862.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1003]
 gi|323526047|ref|YP_004228200.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1001]
 gi|170142825|gb|EDT10990.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           graminis C4D1M]
 gi|307584173|gb|ADN57571.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1003]
 gi|323383049|gb|ADX55140.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1001]
          Length = 217

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 120/208 (57%), Positives = 154/208 (74%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    + +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ A
Sbjct: 10  TLTSQSSRDLEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFLVGEVNDQTANLVVA 69

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           Q+LFLE+ENP K+I  YINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL+A
Sbjct: 70  QMLFLESENPDKDIYFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLAA 129

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG RFALPN+R+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + 
Sbjct: 130 GAKGKRFALPNSRVMIHQPLGGARGQASDIEIQAREILYLKERLNHLLAHHTGQPVERIA 189

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  DRD+ MS  +A  +G+VD+V   R 
Sbjct: 190 RDTDRDNFMSGDDAQAYGLVDQVAHKRP 217


>gi|77459919|ref|YP_349426.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens Pf0-1]
 gi|92087005|sp|Q3K9W9|CLPP_PSEPF RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|77383922|gb|ABA75435.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pseudomonas
           fluorescens Pf0-1]
          Length = 211

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 125/193 (64%), Positives = 159/193 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG  G RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAPGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G+T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDTNRDNFMSAEAAK 197

Query: 197 DWGVVDKVLMSRI 209
           ++G++D+V+  R 
Sbjct: 198 EYGLIDEVINQRP 210


>gi|117921102|ref|YP_870294.1| ATP-dependent Clp protease proteolytic subunit [Shewanella sp.
           ANA-3]
 gi|166214711|sp|A0KYL9|CLPP_SHESA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|117613434|gb|ABK48888.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella sp.
           ANA-3]
          Length = 202

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 125/201 (62%), Positives = 162/201 (80%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             ++ D+   LVPMV+EQT +GERS+DIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE
Sbjct: 1   MHNASDIQSALVPMVIEQTAKGERSFDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG R
Sbjct: 61  SESPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD
Sbjct: 121 FCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNLMLSEHTGQPLEVIERDTDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + MSA++A ++G+VD V+  R
Sbjct: 181 NFMSATQAVEYGLVDAVMTKR 201


>gi|150388889|ref|YP_001318938.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Alkaliphilus
           metalliredigens QYMF]
 gi|167008644|sp|A6TM61|CLPP_ALKMQ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|149948751|gb|ABR47279.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Alkaliphilus
           metalliredigens QYMF]
          Length = 194

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 118/194 (60%), Positives = 152/194 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQT+RGERSYDI+SRLLKERI+F+  +I D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MALVPVVVEQTSRGERSYDIFSRLLKERIIFLGDEINDVTASLLVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG +TAGMAIYDTM +IKP +ST C+G AASMG+ LL+AG KG RFALPNA +
Sbjct: 61  QIYINSPGGSITAGMAIYDTMNYIKPDVSTICVGMAASMGAFLLAAGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA DI  HA+ IVK++  LN+I V+  G+  E V+K  DRD  M A EA
Sbjct: 121 MIHQPLGGTRGQAEDIRIHAERIVKLRDTLNKILVERTGQPLERVQKDTDRDFFMEAKEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V+ SR 
Sbjct: 181 KEYGIIDEVISSRK 194


>gi|295676517|ref|YP_003605041.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1002]
 gi|295436360|gb|ADG15530.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1002]
          Length = 217

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 120/208 (57%), Positives = 154/208 (74%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    + +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ A
Sbjct: 10  TLTSQSSRDLEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFLVGEVNDQTANLVVA 69

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           Q+LFLE+ENP K+I  YINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL+A
Sbjct: 70  QMLFLESENPDKDIYFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLAA 129

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG RFALPN+R+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + 
Sbjct: 130 GAKGKRFALPNSRVMIHQPLGGARGQASDIEIQAREILYLKDRLNHLLAHHTGQPVERIA 189

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  DRD+ MS  +A  +G+VD+V   R 
Sbjct: 190 RDTDRDNFMSGDDAQAYGLVDQVAHKRP 217


>gi|332038369|gb|EGI74814.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 205

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 127/198 (64%), Positives = 158/198 (79%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT +GERSYDIYSRLLKERI+F+TGQ+ED+MA LI AQ+LFLE+ENP 
Sbjct: 7   DPLNALVPMVVEQTPKGERSYDIYSRLLKERIIFLTGQVEDNMANLILAQMLFLESENPD 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAGMAIYDTM FIKP +ST C+GQAASMG+ LL+AG KG RF LPN
Sbjct: 67  KDIFLYINSPGGSVTAGMAIYDTMNFIKPDVSTICVGQAASMGAFLLTAGAKGKRFCLPN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQASD E HA++I+ IK +LN +  ++ G+  + + K  DRD+ MSA
Sbjct: 127 SRVMIHQPLGGFQGQASDFEIHAKEILSIKDKLNRLMAEHTGQPLDIISKDTDRDNFMSA 186

Query: 193 SEACDWGVVDKVLMSRID 210
           S+A D+G+VD V  +R  
Sbjct: 187 SQAVDYGLVDSVFTNRDK 204


>gi|308070425|ref|YP_003872030.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Paenibacillus polymyxa E681]
 gi|310643606|ref|YP_003948364.1| ATP-dependent clp protease proteolytic subunit [Paenibacillus
           polymyxa SC2]
 gi|305859704|gb|ADM71492.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Paenibacillus polymyxa E681]
 gi|309248556|gb|ADO58123.1| ATP-dependent Clp protease proteolytic subunit [Paenibacillus
           polymyxa SC2]
          Length = 211

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 121/199 (60%), Positives = 156/199 (78%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K+   V + LVPMVVEQTNRGERSYDIYSRLLK+RI+F++G I+D +A L+ AQLLFL A
Sbjct: 9   KEKRLVVMSLVPMVVEQTNRGERSYDIYSRLLKDRIIFLSGPIDDDVANLVIAQLLFLSA 68

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           E+P+K+I+LYINSPGG VTAGM IYDTMQFIKP +ST C+G AASMGSLLL+AG  G R+
Sbjct: 69  EDPEKDINLYINSPGGSVTAGMGIYDTMQFIKPDVSTICVGMAASMGSLLLTAGAPGKRY 128

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           AL N+ +++HQP GG  GQASD+  HA  I+K + +LN+IYV+  G+  E++E+  DRD 
Sbjct: 129 ALTNSEVMIHQPLGGIQGQASDMLIHADWIIKTRAKLNQIYVERTGQPLEKIERDTDRDF 188

Query: 189 IMSASEACDWGVVDKVLMS 207
            M A EA  +G++D+VL  
Sbjct: 189 FMEAEEAKAYGIIDQVLSK 207


>gi|91783520|ref|YP_558726.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           xenovorans LB400]
 gi|187923896|ref|YP_001895538.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           phytofirmans PsJN]
 gi|296157827|ref|ZP_06840661.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. Ch1-1]
 gi|116243110|sp|Q13Z15|CLPP2_BURXL RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|91687474|gb|ABE30674.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           xenovorans LB400]
 gi|187715090|gb|ACD16314.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           phytofirmans PsJN]
 gi|295892073|gb|EFG71857.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. Ch1-1]
          Length = 217

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 121/208 (58%), Positives = 155/208 (74%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    + +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ A
Sbjct: 10  TLTSQSSRDLEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFLVGEVNDQTANLVVA 69

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           Q+LFLE+ENP K+IS YINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL+A
Sbjct: 70  QMLFLESENPDKDISFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLAA 129

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG RFALPN+R+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + 
Sbjct: 130 GAKGKRFALPNSRVMIHQPLGGARGQASDIEIQAREILYLKERLNHLLAHHTGQPVERIA 189

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  DRD+ MS  +A  +G+VD+V   R 
Sbjct: 190 RDTDRDNFMSGDDAQAYGLVDQVAHKRP 217


>gi|323703643|ref|ZP_08115286.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfotomaculum nigrificans DSM 574]
 gi|323531415|gb|EGB21311.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfotomaculum nigrificans DSM 574]
          Length = 195

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 118/195 (60%), Positives = 156/195 (80%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVP+VVEQTNRGER+YDIYSRLLK+RI+F+ G I+DH+A L+ AQ LFLEAE+P+K+
Sbjct: 1   MSALVPIVVEQTNRGERAYDIYSRLLKDRIIFIGGPIDDHIANLVIAQFLFLEAEDPEKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGGVVTAG+AIYDTMQ+IKP +ST C+GQAASMGS LL+AG KG R+ALP AR
Sbjct: 61  IHLYINSPGGVVTAGLAIYDTMQYIKPAVSTICLGQAASMGSFLLAAGAKGKRYALPQAR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQA+DI+ HA++I++++  LNE    + G+  E++ +  +RD  MSA E
Sbjct: 121 IMIHQPLGGVQGQATDIDIHAREILRMREILNERLSHHTGQPLEKIARDTERDFFMSAEE 180

Query: 195 ACDWGVVDKVLMSRI 209
           A  +G++D+V+  R 
Sbjct: 181 AKKYGIIDEVMPYRK 195


>gi|326391008|ref|ZP_08212557.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325992953|gb|EGD51396.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 195

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 112/195 (57%), Positives = 151/195 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDI+SRLLK+RIVF+  +I D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPIVVEQTNRGERSYDIFSRLLKDRIVFLGEEINDTTASLVIAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAG AIYDTMQ+IKP + T C+G AASM + LL+AG KG RFALPN+ I
Sbjct: 61  WLYINSPGGSITAGFAIYDTMQYIKPDVVTLCVGMAASMAAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA+ I+K++ +L++I  +N G+  E+++   +RD  M A EA
Sbjct: 121 MIHQPLGGMQGQATDIKIHAERILKLRDKLDKILAENTGQPIEKIKADTERDFFMDAEEA 180

Query: 196 CDWGVVDKVLMSRID 210
             +G++D+VL+    
Sbjct: 181 KAYGIIDEVLIRNKK 195


>gi|196230686|ref|ZP_03129547.1| Endopeptidase Clp [Chthoniobacter flavus Ellin428]
 gi|196225027|gb|EDY19536.1| Endopeptidase Clp [Chthoniobacter flavus Ellin428]
          Length = 228

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 114/201 (56%), Positives = 153/201 (76%), Gaps = 2/201 (0%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
            +  +   VP VVEQT RGERSYDIYSRLLK+RI+F+   I+D +A  I AQLLFL+ E+
Sbjct: 12  PQSNY--YVPYVVEQTGRGERSYDIYSRLLKDRIIFLGTAIDDGVANSIIAQLLFLQMED 69

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
            +K+I++YINSPGG VTAG+AIYDTMQF+   ++T+C+G AASMG++LL+AG KG R+AL
Sbjct: 70  GKKDINIYINSPGGSVTAGLAIYDTMQFLTCDVNTYCIGMAASMGAVLLAAGTKGKRYAL 129

Query: 131 PNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM 190
           PN+ I++HQ SGG  G ASD+ER  + + K+K+RL  I  K+ GKT E+V+   DRD+ M
Sbjct: 130 PNSDIMIHQVSGGAQGTASDVERTVEFMFKLKKRLIHILAKHTGKTDEQVKTDSDRDYYM 189

Query: 191 SASEACDWGVVDKVLMSRIDI 211
           SA EA  +G+VD+V+ SR DI
Sbjct: 190 SADEAKAYGLVDEVVKSRKDI 210


>gi|291548434|emb|CBL21542.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ruminococcus
           sp. SR1/5]
          Length = 193

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 117/193 (60%), Positives = 150/193 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A LI AQLLFLEAE+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVNDVSANLIVAQLLFLEAEDPSKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQ+IK  +ST C+G AASMG+ LLS+G KG R+ALPN+ I
Sbjct: 61  QLYINSPGGSVTAGMAIYDTMQYIKCDVSTICLGMAASMGAFLLSSGAKGKRYALPNSTI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A  I K K++LNEI   N G+  E VEK  DRD+ M+A EA
Sbjct: 121 MIHQPSGGAQGQATEIQIVADQIAKTKKKLNEILSANTGQPLEIVEKDTDRDNYMTAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D V++ +
Sbjct: 181 KAYGLIDGVVIHK 193


>gi|331090536|ref|ZP_08339389.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 2_1_46FAA]
 gi|330405879|gb|EGG85407.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 2_1_46FAA]
          Length = 193

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 112/193 (58%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A++I AQLL LEAE+P+K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVTDVSASIIVAQLLHLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG+AIYDTMQ+IK  +ST C+G AASMG+ LL+ G KG RFALPNA I
Sbjct: 61  QLYINSPGGSVSAGLAIYDTMQYIKCDVSTTCIGMAASMGAFLLAGGAKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++I+  A+ I+K +++LNEI  +  GK++E++    +RD+ MSA EA
Sbjct: 121 MIHQPLGGAQGQATEIQIAAEHILKTRQKLNEILAERTGKSFEQISADTERDNFMSAKEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKV++SR
Sbjct: 181 EEYGLIDKVVVSR 193


>gi|210615408|ref|ZP_03290535.1| hypothetical protein CLONEX_02751 [Clostridium nexile DSM 1787]
 gi|210150257|gb|EEA81266.1| hypothetical protein CLONEX_02751 [Clostridium nexile DSM 1787]
          Length = 193

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 110/192 (57%), Positives = 154/192 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++P V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A++I AQLLFLE E+P+K+I
Sbjct: 1   MSVIPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVTDASASVIIAQLLFLEGEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG+AIYDTMQ+IK  +ST C+G AASMGS LLS G+KG R+ALPNA I
Sbjct: 61  HLYINSPGGSVSAGLAIYDTMQYIKCDVSTICIGMAASMGSFLLSGGKKGKRYALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++I+  A+ I+K +++LN I  +N G++ E+++   +RD+ MSA EA
Sbjct: 121 MIHQPLGGAQGQATEIQIAAEHILKTRQKLNTILAENTGQSLEKIQADTERDNFMSAQEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G+VD+V+ S
Sbjct: 181 KEYGLVDEVIAS 192


>gi|160936367|ref|ZP_02083736.1| hypothetical protein CLOBOL_01259 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440650|gb|EDP18388.1| hypothetical protein CLOBOL_01259 [Clostridium bolteae ATCC
           BAA-613]
          Length = 193

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 112/192 (58%), Positives = 151/192 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVNDVSASLVVAQLLFLESEDPGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG AIYDTM +IK  +ST C+G AASMG+ LLS G KG RFALPNA I
Sbjct: 61  HLYINSPGGSVSAGFAIYDTMNYIKCDVSTICIGMAASMGAFLLSGGAKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A++I+K +++LNEI   N GK  E +E+  +RD+ MSA EA
Sbjct: 121 MIHQPSGGAKGQATEIKIVAENILKTRKKLNEILAANTGKPLEVIERDTERDNYMSALEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+++  
Sbjct: 181 KEYGLIDEIIAH 192


>gi|88860444|ref|ZP_01135082.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           tunicata D2]
 gi|88817642|gb|EAR27459.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           tunicata D2]
          Length = 205

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 126/203 (62%), Positives = 157/203 (77%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
                 D    LVPMVVEQT +GERSYDIYSRLLKER++F+TGQ+EDHMA LI AQLLFL
Sbjct: 1   MFNSVTDPLNALVPMVVEQTAKGERSYDIYSRLLKERVIFLTGQVEDHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP+K+I +YINSPGG VTAGMAIYDTM FIKP +ST CMGQAASMG+ LLS G KG 
Sbjct: 61  ESENPEKDIFIYINSPGGSVTAGMAIYDTMNFIKPNVSTVCMGQAASMGAFLLSGGTKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF LPN+R+++HQP GGF GQASD E HA++I+ IK +LN +  ++ G+  E + +  DR
Sbjct: 121 RFCLPNSRVMIHQPLGGFQGQASDFEIHAREILSIKDKLNRLLAEHTGQPIEVISRDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRI 209
           D+ MS ++A ++G+VD VL  R 
Sbjct: 181 DNFMSGAQAVEYGIVDAVLTQRD 203


>gi|239623656|ref|ZP_04666687.1| ATP-dependent Clp protease [Clostridiales bacterium 1_7_47_FAA]
 gi|239521687|gb|EEQ61553.1| ATP-dependent Clp protease [Clostridiales bacterium 1_7_47FAA]
          Length = 193

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 108/192 (56%), Positives = 151/192 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVNDVSASLVVAQLLFLESEDPGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG AIYDTM +IK  +ST C+G AASMG+ LL+ G KG RFALPN+ I
Sbjct: 61  HLYINSPGGSVSAGFAIYDTMNYIKCDVSTICIGMAASMGAFLLAGGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A++I+K +++LN+I   N G+  E +E+  +RD+ MSA EA
Sbjct: 121 MIHQPSGGAKGQATEIKIVAENILKTRKKLNDILAANTGRPIEVIERDTERDNYMSAEEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+++  
Sbjct: 181 KEYGLIDEIIAH 192


>gi|302871325|ref|YP_003839961.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574184|gb|ADL41975.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 195

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 119/195 (61%), Positives = 154/195 (78%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVP+V+EQTNRGER+YDIYSRLLK+RIV ++G+I D +A+LI AQLLFLEAE+P K+
Sbjct: 1   MSALVPIVIEQTNRGERAYDIYSRLLKDRIVILSGEITDDIASLIVAQLLFLEAEDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGG VTAG AIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ 
Sbjct: 61  IYLYINSPGGSVTAGFAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRFALPNSE 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQA+DI+ HA+ I+KIK R+N+I  +  G+  E +E+  DRD  M+A E
Sbjct: 121 IMIHQPLGGVRGQATDIKIHAEWILKIKNRINKILSERTGQPIEVIERDTDRDFFMTAEE 180

Query: 195 ACDWGVVDKVLMSRI 209
           A  +G++D+V+  R 
Sbjct: 181 ALKYGIIDRVIERRP 195


>gi|254179427|ref|ZP_04886026.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1655]
 gi|254200063|ref|ZP_04906429.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei FMH]
 gi|147749659|gb|EDK56733.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei FMH]
 gi|184209967|gb|EDU07010.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1655]
          Length = 211

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 120/208 (57%), Positives = 156/208 (75%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ A
Sbjct: 4   TLASQAPRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVA 63

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLLFLE+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++
Sbjct: 64  QLLFLESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLAS 123

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN +   + G+  E + 
Sbjct: 124 GAKGKRYALPNARVMIHQPLGGARGQASDIEIQAREILYLRDRLNHLLAHHTGQDVERIA 183

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  DRD+ MS+ +A  +G++D V   R 
Sbjct: 184 RDTDRDNFMSSEDAKAYGLIDHVSTKRP 211


>gi|268317954|ref|YP_003291673.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rhodothermus
           marinus DSM 4252]
 gi|262335488|gb|ACY49285.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rhodothermus
           marinus DSM 4252]
          Length = 252

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 105/207 (50%), Positives = 153/207 (73%), Gaps = 4/207 (1%)

Query: 3   FEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQ 62
           + G  ++        LVP+V+EQT RGER+YDI+SRLLKERIV +   I D +A L+ AQ
Sbjct: 24  YSGPFQQYPVG---ALVPIVIEQTTRGERAYDIFSRLLKERIVIIGTPINDQIANLVVAQ 80

Query: 63  LLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAG 122
           LL+L +E+ +++I++YINSPGG + +G+A+YDTMQ++ PP++T C+G AASMG++LL+AG
Sbjct: 81  LLWLASEDSERDINIYINSPGGSIDSGLAVYDTMQYVAPPVATICVGLAASMGAVLLAAG 140

Query: 123 EKGMRFALPNARILLHQPSGG-FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
            KG R ALPN+RI++HQP      GQA+DIE HA++I+K++ RLNEI   + G+  E + 
Sbjct: 141 VKGKRAALPNSRIMIHQPWMSGVQGQATDIEIHAREILKMRERLNEILAYHTGQPKERIA 200

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSR 208
           + +DRD  +SA EA ++G+VD VL  R
Sbjct: 201 QDVDRDFWLSAQEAKEYGLVDNVLTPR 227


>gi|115634688|ref|XP_786892.2| PREDICTED: similar to LOC496087 protein [Strongylocentrotus
           purpuratus]
          Length = 239

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 110/200 (55%), Positives = 161/200 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+V+EQT RGER+YDIYSRLLKERI+ + G + D +++++ AQLLFL++E+ +K I 
Sbjct: 32  PLVPIVIEQTGRGERAYDIYSRLLKERIICLMGPVNDTVSSVVIAQLLFLQSESNKKPIH 91

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGG VTAG+ IYD+MQ++ PPI+T+C+GQA SMGSLLL+AG  GMR +LPN+RI+
Sbjct: 92  MYINSPGGSVTAGLGIYDSMQYVLPPIATWCVGQACSMGSLLLTAGAPGMRHSLPNSRIM 151

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSG   GQA+DI+  A++I+K+K+++N++YVK+ G+T + +E+ ++RDH MS  EA 
Sbjct: 152 VHQPSGQAVGQATDIQIQAEEIIKLKKQINKLYVKHTGQTLDVIEQAMERDHFMSPQEAL 211

Query: 197 DWGVVDKVLMSRIDIEEKSK 216
            +G++DKVL     I E ++
Sbjct: 212 QFGLIDKVLDHPPHIGENNQ 231


>gi|209521458|ref|ZP_03270166.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. H160]
 gi|209498114|gb|EDZ98261.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. H160]
          Length = 217

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 120/208 (57%), Positives = 154/208 (74%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    + +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ A
Sbjct: 10  TLTSQSSRDLETQALGLVPIVVETSGRGERSYDIYSRLLKERIVFLVGEVNDQTANLVVA 69

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           Q+LFLE+ENP K+I  YINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL+A
Sbjct: 70  QMLFLESENPDKDIYFYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLAA 129

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG RFALPN+R+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + 
Sbjct: 130 GAKGKRFALPNSRVMIHQPLGGARGQASDIEIQAREILYLKDRLNHLLAHHTGQPVERIA 189

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  DRD+ MS  +A  +G+VD+V   R 
Sbjct: 190 RDTDRDNFMSGDDAQAYGLVDQVAHKRP 217


>gi|46198558|ref|YP_004225.1| ATP-dependent Clp protease proteolytic subunit [Thermus
           thermophilus HB27]
 gi|46196180|gb|AAS80598.1| ATP-dependent clp protease proteolytic subunit [Thermus
           thermophilus HB27]
          Length = 212

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 107/192 (55%), Positives = 149/192 (77%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           ++P V+EQT RGER YDIYSRLLK+RI+F+   I+  +A ++ AQLLFL+A+NP +EI L
Sbjct: 20  VIPYVIEQTARGERVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKL 79

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V AG+AIYDTMQF++ P+ST  +G AASM +++L+AGEKG R+ALP+A++++
Sbjct: 80  YINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMI 139

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  G ASDI   AQ+I+K K+ LNEI  K+ G+  E+VEK  DRD+ +SA EA +
Sbjct: 140 HQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALE 199

Query: 198 WGVVDKVLMSRI 209
           +G++D+V+    
Sbjct: 200 YGLIDQVVTREE 211


>gi|225378750|ref|ZP_03755971.1| hypothetical protein ROSEINA2194_04420 [Roseburia inulinivorans DSM
           16841]
 gi|225209409|gb|EEG91763.1| hypothetical protein ROSEINA2194_04420 [Roseburia inulinivorans DSM
           16841]
          Length = 202

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 114/202 (56%), Positives = 156/202 (77%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            K+  +   + LVP V+EQT+RGER+YDIYSRLLK+RI+F+  ++ +  A+L+ AQLLFL
Sbjct: 1   MKRKGQVRDMSLVPYVIEQTSRGERNYDIYSRLLKDRIIFLGEEVNETTASLVVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+E+P K+I LYINSPGG+VTAG+AIYDTMQ+IK  +ST C+G AASMG+ LL+ G KG 
Sbjct: 61  ESEDPGKDIHLYINSPGGMVTAGLAIYDTMQYIKCDVSTICIGMAASMGAFLLAGGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R ALPNA I++HQPSGG  GQA++I+  A++I+K K++LNEI   N GK Y+ +    +R
Sbjct: 121 RLALPNAEIMIHQPSGGAKGQATEIQIAAENILKTKKKLNEILAANTGKPYDVIAADTER 180

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           DH MSA EA ++G++D V+ SR
Sbjct: 181 DHYMSAQEAMEYGLIDNVITSR 202


>gi|118590047|ref|ZP_01547451.1| ATP-dependent Clp protease proteolytic subunit [Stappia aggregata
           IAM 12614]
 gi|118437544|gb|EAV44181.1| ATP-dependent Clp protease proteolytic subunit [Stappia aggregata
           IAM 12614]
          Length = 211

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 138/210 (65%), Positives = 181/210 (86%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D+++  LVPMVVEQTNRGER++DIYSRLLKERI+F+TG +EDHMATL+ AQLL+L
Sbjct: 1   MKDPVDIYMNTLVPMVVEQTNRGERAFDIYSRLLKERIIFLTGPVEDHMATLVSAQLLYL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEI++YINSPGG+VT+G+AIYDTMQFI+P +ST C+GQAASMGSLLL+AGEKGM
Sbjct: 61  EAENPSKEIAIYINSPGGLVTSGLAIYDTMQFIRPAVSTLCIGQAASMGSLLLAAGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ LPNAR+++HQPSGGF GQA+DI  HAQ+I+ +KRRLN+IYVK+ G+T ++VE+ L+R
Sbjct: 121 RYILPNARVMVHQPSGGFRGQAADIMLHAQEILAMKRRLNDIYVKHTGRTLDQVEEALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           D+ M+A +A ++G+VDKV+  R  +    +
Sbjct: 181 DNFMTAEKAKEFGIVDKVITDRNTLGGDEE 210


>gi|150016209|ref|YP_001308463.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           beijerinckii NCIMB 8052]
 gi|149902674|gb|ABR33507.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           beijerinckii NCIMB 8052]
          Length = 199

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 117/199 (58%), Positives = 155/199 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+ ++G++ D  A LI AQLLFLE+E+P K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIMLSGEVNDDSANLIVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG +TAG AIYDTMQ+IK  +ST C+G AASMG+ LLS+G KG RFALPNA +
Sbjct: 61  YIYINSPGGSITAGNAIYDTMQYIKCDVSTICIGMAASMGAFLLSSGTKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+D E HA+ I+K+K  LN I  +N GK  E ++  ++RD+ MSA EA
Sbjct: 121 MIHQPLGGFQGQATDFEIHAKRILKMKETLNRILSENTGKPLETIKADVERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSRIDIEEK 214
             +G+VD+V+ +    ++K
Sbjct: 181 KAYGLVDEVITTHKIGKDK 199


>gi|85716433|ref|ZP_01047405.1| peptidase S14, ClpP [Nitrobacter sp. Nb-311A]
 gi|85696790|gb|EAQ34676.1| peptidase S14, ClpP [Nitrobacter sp. Nb-311A]
          Length = 212

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 139/209 (66%), Positives = 175/209 (83%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED M+ L+ AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDTMSMLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP++T C GQAASMGSLLL+AGEK MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVATLCTGQAASMGSLLLAAGEKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
            ALPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD
Sbjct: 121 HALPNARIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQTYQAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
             ++A  A D+G+VDKV+  R +     K
Sbjct: 181 KFLTADMARDFGIVDKVIDKRAEDPAAPK 209


>gi|294635324|ref|ZP_06713821.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Edwardsiella
           tarda ATCC 23685]
 gi|291091300|gb|EFE23861.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Edwardsiella
           tarda ATCC 23685]
          Length = 194

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 130/194 (67%), Positives = 161/194 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+AG +G RF LPN+R+
Sbjct: 61  HLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLAAGAQGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+ IK R+N +  K+ G+  E +E+  +RD  MSA EA
Sbjct: 121 MIHQPLGGFQGQATDIEIHAKEILSIKARMNTLMAKHSGQPLEVIERDTERDRFMSAQEA 180

Query: 196 CDWGVVDKVLMSRI 209
            D+G+VD VL  R 
Sbjct: 181 VDYGLVDAVLTQRA 194


>gi|302874445|ref|YP_003843078.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           cellulovorans 743B]
 gi|307690948|ref|ZP_07633394.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           cellulovorans 743B]
 gi|302577302|gb|ADL51314.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           cellulovorans 743B]
          Length = 194

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 115/192 (59%), Positives = 154/192 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLK+RIVF+  ++ D  A+++ AQLLFLE+E+P K+I
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKDRIVFLGEEVNDASASVVVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAGMAIYDTM +IKP ++T C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  SLYINSPGGSITAGMAIYDTMNYIKPDVATICIGMAASMGAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA+ I+ +K++LN I  +  G+  E +EK  +RD+ M+A +A
Sbjct: 121 MIHQPLGGFKGQATDIGIHAERILLMKKKLNSILSERTGQPLEVIEKDTERDNFMTADKA 180

Query: 196 CDWGVVDKVLMS 207
            D+G++D+V+  
Sbjct: 181 KDYGLIDEVIAK 192


>gi|53719039|ref|YP_108025.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei K96243]
 gi|121601387|ref|YP_993274.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia mallei
           SAVP1]
 gi|124386617|ref|YP_001029282.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia mallei
           NCTC 10229]
 gi|126440189|ref|YP_001059356.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 668]
 gi|126450257|ref|YP_001080784.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia mallei
           NCTC 10247]
 gi|126451473|ref|YP_001066627.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 1106a]
 gi|134277993|ref|ZP_01764708.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 305]
 gi|217421679|ref|ZP_03453183.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 576]
 gi|226197408|ref|ZP_03792985.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei Pakistan 9]
 gi|237812684|ref|YP_002897135.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei MSHR346]
 gi|238562204|ref|ZP_00440781.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei GB8 horse 4]
 gi|242317499|ref|ZP_04816515.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1106b]
 gi|251766649|ref|ZP_02264557.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei PRL-20]
 gi|254178458|ref|ZP_04885113.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei ATCC 10399]
 gi|254189184|ref|ZP_04895695.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254206398|ref|ZP_04912750.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei JHU]
 gi|254258354|ref|ZP_04949408.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1710a]
 gi|254297312|ref|ZP_04964765.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 406e]
 gi|254358192|ref|ZP_04974465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei 2002721280]
 gi|67460243|sp|Q63V41|CLPP_BURPS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201803|sp|A3MKJ8|CLPP_BURM7 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201804|sp|A2SBG3|CLPP_BURM9 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201805|sp|A1V4X1|CLPP_BURMS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201806|sp|A3NWA6|CLPP_BURP0 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201807|sp|A3NAI5|CLPP_BURP6 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|52209453|emb|CAH35404.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei K96243]
 gi|121230197|gb|ABM52715.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei SAVP1]
 gi|124294637|gb|ABN03906.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei NCTC 10229]
 gi|126219682|gb|ABN83188.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 668]
 gi|126225115|gb|ABN88655.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1106a]
 gi|126243127|gb|ABO06220.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei NCTC 10247]
 gi|134251643|gb|EBA51722.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 305]
 gi|147753841|gb|EDK60906.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei JHU]
 gi|148027319|gb|EDK85340.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei 2002721280]
 gi|157807201|gb|EDO84371.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 406e]
 gi|157936863|gb|EDO92533.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160699497|gb|EDP89467.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei ATCC 10399]
 gi|217395421|gb|EEC35439.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 576]
 gi|225930787|gb|EEH26797.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei Pakistan 9]
 gi|237504658|gb|ACQ96976.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei MSHR346]
 gi|238523066|gb|EEP86507.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei GB8 horse 4]
 gi|242140738|gb|EES27140.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1106b]
 gi|243065058|gb|EES47244.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei PRL-20]
 gi|254217043|gb|EET06427.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1710a]
          Length = 217

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 120/208 (57%), Positives = 156/208 (75%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ A
Sbjct: 10  TLASQAPRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVA 69

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLLFLE+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++
Sbjct: 70  QLLFLESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLAS 129

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN +   + G+  E + 
Sbjct: 130 GAKGKRYALPNARVMIHQPLGGARGQASDIEIQAREILYLRDRLNHLLAHHTGQDVERIA 189

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  DRD+ MS+ +A  +G++D V   R 
Sbjct: 190 RDTDRDNFMSSEDAKAYGLIDHVSTKRP 217


>gi|304319808|ref|YP_003853451.1| Protease subunit of ATP-dependent Clp protease [Parvularcula
           bermudensis HTCC2503]
 gi|303298711|gb|ADM08310.1| Protease subunit of ATP-dependent Clp protease [Parvularcula
           bermudensis HTCC2503]
          Length = 210

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 132/203 (65%), Positives = 176/203 (86%), Gaps = 1/203 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  D+++  LVPMV+EQT+RGERS+DIYSRLLKERI+F++GQ+ D ++TLI AQLLFL
Sbjct: 1   MRDPHDIYMNTLVPMVIEQTSRGERSFDIYSRLLKERIIFLSGQVHDQVSTLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EA+NP+K+I+ YINSPGG VTAG+A+YDTM++I+P IST C+G AASMGSLLL+AG+KGM
Sbjct: 61  EADNPKKDIAFYINSPGGSVTAGLAMYDTMRYIRPQISTMCVGLAASMGSLLLTAGDKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+RI++HQPS GF GQASDIERHA+DI++ K+RLNEIYV++ G+ YE +E+TLDR
Sbjct: 121 RFSLPNSRIMVHQPSAGFQGQASDIERHARDIIQTKKRLNEIYVEHTGQDYETIERTLDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRI 209
           D  M+  +A D+G++D+VL  R 
Sbjct: 181 DTFMTPEDALDFGLIDQVLEKRA 203


>gi|254428693|ref|ZP_05042400.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Alcanivorax
           sp. DG881]
 gi|196194862|gb|EDX89821.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Alcanivorax
           sp. DG881]
          Length = 244

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 129/199 (64%), Positives = 162/199 (81%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
            +   LGLVP+V+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA LI AQ+LFLE+EN
Sbjct: 45  KDPTNLGLVPVVIEQTARGERSFDIYSRLLKERVIFMIGQVEDHMANLIVAQMLFLESEN 104

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+AG  G RFAL
Sbjct: 105 PDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCVGQAASMGAFLLTAGATGKRFAL 164

Query: 131 PNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM 190
           PNAR+++HQP GGF GQASDIE HA++I+KIK +LN +   + G+  E++EK  DRD+ M
Sbjct: 165 PNARVMIHQPLGGFQGQASDIEIHAKEILKIKGQLNSLLAHHTGQPIEQLEKDTDRDNFM 224

Query: 191 SASEACDWGVVDKVLMSRI 209
           SA EA ++G++D VL  R 
Sbjct: 225 SADEAKEYGIIDAVLSQRP 243


>gi|257138854|ref|ZP_05587116.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           thailandensis E264]
          Length = 217

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 121/208 (58%), Positives = 156/208 (75%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ A
Sbjct: 10  TLASQAPRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVA 69

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLLFLE+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++
Sbjct: 70  QLLFLESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLAS 129

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG R+ALPNAR+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E + 
Sbjct: 130 GAKGKRYALPNARVMIHQPLGGARGQASDIEIQAREILYLKDRLNHLLAHHTGQDVERIA 189

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  DRD+ MS+ +A  +G++D V   R 
Sbjct: 190 RDTDRDNFMSSEDAKAYGLIDHVSTKRP 217


>gi|152980689|ref|YP_001353221.1| protease subunit of ATP-dependent Clp proteases [Janthinobacterium
           sp. Marseille]
 gi|226706516|sp|A6SY74|CLPP_JANMA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|151280766|gb|ABR89176.1| protease subunit of ATP-dependent Clp proteases [Janthinobacterium
           sp. Marseille]
          Length = 210

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 126/195 (64%), Positives = 156/195 (80%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
            LG+VPMV+EQ+ RGER+YDIYSRLLKERI+F+ G + D MA LI AQLLFLE+ENP K+
Sbjct: 16  MLGMVPMVIEQSGRGERAYDIYSRLLKERIIFLVGPVNDQMANLIVAQLLFLESENPDKD 75

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           ISLYINSPGG V+AGMAIYDTMQFIKP +ST C G AASMG+ LL+AGEKG RF+LPN+R
Sbjct: 76  ISLYINSPGGSVSAGMAIYDTMQFIKPNVSTLCTGLAASMGAFLLAAGEKGKRFSLPNSR 135

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQASDIE  A++I+ ++ RLN I  +  GK+ EE+ K  DRD+ MSA  
Sbjct: 136 IMIHQPLGGAQGQASDIEIQAREILYLRERLNAILAERTGKSVEEIAKDTDRDNFMSADA 195

Query: 195 ACDWGVVDKVLMSRI 209
           A  +G++DKVL +R 
Sbjct: 196 AVTYGMIDKVLATRA 210


>gi|209694398|ref|YP_002262326.1| ATP-dependent Clp protease proteolytic subunit [Aliivibrio
           salmonicida LFI1238]
 gi|226706438|sp|B6EHK3|CLPP_ALISL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|208008349|emb|CAQ78503.1| ATP-dependent Clp protease proteolytic subunit [Aliivibrio
           salmonicida LFI1238]
          Length = 207

 Score =  242 bits (618), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 127/209 (60%), Positives = 162/209 (77%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS++         +   LVPMVVEQT+RGERSYDIYSRLLKER++F+TGQ+EDHMA L+ 
Sbjct: 1   MSYQ--ENNAMPSIMDALVPMVVEQTSRGERSYDIYSRLLKERVIFLTGQVEDHMANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQLLFLESENPDKDIFLYINSPGGSVTAGMSIYDTMQFIKPNVSTVCMGQACSMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G  G R+ LPN+R+++HQP GGF GQASDI+ HAQ+I+ IK++LN +  ++ G+  E +
Sbjct: 119 GGAPGKRYVLPNSRVMIHQPLGGFQGQASDIQIHAQEILTIKKKLNTLLAEHTGQPLEVI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           EK  DRD+ M+A +A  +G+VD VL  R 
Sbjct: 179 EKDTDRDNFMAADDAVKYGLVDAVLNKRD 207


>gi|88705172|ref|ZP_01102884.1| ATP-dependent Clp protease, proteolytic subunit [Congregibacter
           litoralis KT71]
 gi|88700867|gb|EAQ97974.1| ATP-dependent Clp protease, proteolytic subunit [Congregibacter
           litoralis KT71]
          Length = 206

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 125/200 (62%), Positives = 158/200 (79%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
                 LGLVPMVVEQT+RGERSYDIYSRLLKER+VFV GQ+EDHMA LI AQLLFLE+E
Sbjct: 2   SPPVEALGLVPMVVEQTSRGERSYDIYSRLLKERVVFVVGQVEDHMANLIVAQLLFLESE 61

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I LYINSPGG VTAG++IYDTMQFIKP IST C+GQAASMG+ LLS G KG R+ 
Sbjct: 62  NPDKDIHLYINSPGGSVTAGLSIYDTMQFIKPDISTMCLGQAASMGAFLLSGGTKGKRYC 121

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNAR ++HQPSGG  GQA+DI+  A++I+ I+ RLN +  ++ G+  E +E+  +RD  
Sbjct: 122 LPNARTMIHQPSGGAQGQATDIDIQAKEILIIRERLNRLMAEHTGQPLEVIERDTERDRF 181

Query: 190 MSASEACDWGVVDKVLMSRI 209
           M A ++ ++G+VD+V+ +R 
Sbjct: 182 MDAEQSKEYGLVDEVVTARS 201


>gi|326502578|dbj|BAJ95352.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326506866|dbj|BAJ91474.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 300

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 120/193 (62%), Positives = 159/193 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVE T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K IS
Sbjct: 71  GLVPMVVETTSRGERAYDIFSRLLKERIVCIHGPIADETASLVVAQLLFLESENPLKPIS 130

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG +G R ALPNAR++
Sbjct: 131 LYINSPGGVVTAGLAIYDTMQYIRCPVNTICIGQAASMGSLLLAAGARGERRALPNARVM 190

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DI   A++I+K++ RLN+IY K+ G+  +++E+ ++RD  M   EA 
Sbjct: 191 IHQPSGGAQGQATDIAIQAKEILKLRDRLNKIYAKHTGQNIDKIEQCMERDLFMDPEEAR 250

Query: 197 DWGVVDKVLMSRI 209
           +WG++D+V+ +R 
Sbjct: 251 EWGLIDEVIENRP 263


>gi|326492708|dbj|BAJ90210.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 285

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 120/193 (62%), Positives = 159/193 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVE T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K IS
Sbjct: 56  GLVPMVVETTSRGERAYDIFSRLLKERIVCIHGPIADETASLVVAQLLFLESENPLKPIS 115

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG +G R ALPNAR++
Sbjct: 116 LYINSPGGVVTAGLAIYDTMQYIRCPVNTICIGQAASMGSLLLAAGARGERRALPNARVM 175

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DI   A++I+K++ RLN+IY K+ G+  +++E+ ++RD  M   EA 
Sbjct: 176 IHQPSGGAQGQATDIAIQAKEILKLRDRLNKIYAKHTGQNIDKIEQCMERDLFMDPEEAR 235

Query: 197 DWGVVDKVLMSRI 209
           +WG++D+V+ +R 
Sbjct: 236 EWGLIDEVIENRP 248


>gi|238923369|ref|YP_002936885.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Eubacterium
           rectale ATCC 33656]
 gi|259585954|sp|C4ZGF4|CLPP_EUBR3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|238875044|gb|ACR74751.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Eubacterium
           rectale ATCC 33656]
 gi|291525457|emb|CBK91044.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Eubacterium
           rectale DSM 17629]
 gi|291528435|emb|CBK94021.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Eubacterium
           rectale M104/1]
          Length = 193

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 113/193 (58%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGER+YDIYSRLLK+RI+F+  ++ +  A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERNYDIYSRLLKDRIIFLGEEVNETTASLVVAQLLFLESEDPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG+VTAG+AIYDTMQ+IK  +ST C+G AASMG+ LL+ G KG R+ALPNA I
Sbjct: 61  HLYINSPGGMVTAGLAIYDTMQYIKCDVSTICIGLAASMGAFLLAGGAKGKRYALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A++I+K K+RLNEI   N GK YE +    +RD+ MSA EA
Sbjct: 121 MIHQPSGGAKGQATEIQIAAENILKTKKRLNEILAANTGKPYETIAADTERDNYMSAQEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D V+ +R
Sbjct: 181 AEYGLIDSVITNR 193


>gi|83858431|ref|ZP_00951953.1| ATP-dependent Clp protease, proteolytic subunit [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853254|gb|EAP91106.1| ATP-dependent Clp protease, proteolytic subunit [Oceanicaulis
           alexandrii HTCC2633]
          Length = 207

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 140/201 (69%), Positives = 171/201 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            ++ +DV + LVPMVVEQ+ RGER+YDIYSRLLKERIVFVTG IEDHMA+L+ AQLLFLE
Sbjct: 1   MREPQDVMMNLVPMVVEQSARGERAYDIYSRLLKERIVFVTGPIEDHMASLMVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP KEI++YINSPGG V+AG+AIYDTMQ+I  P++T C+G AASMGSLLL+AG+KGMR
Sbjct: 61  SENPNKEIAMYINSPGGSVSAGLAIYDTMQYISCPVATACVGMAASMGSLLLTAGDKGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI+LHQPSGGF G  +DIERH +DI+KIKRR+NEIYVK+ G+  E+VEKTLDRD
Sbjct: 121 FATPNARIMLHQPSGGFRGTTADIERHGEDILKIKRRMNEIYVKHTGQPLEKVEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSR 208
             M A EA ++G++D V   R
Sbjct: 181 FYMDAMEAKEFGLIDHVYEKR 201


>gi|124266485|ref|YP_001020489.1| ATP-dependent Clp protease proteolytic subunit ClpP [Methylibium
           petroleiphilum PM1]
 gi|189082491|sp|A2SFB5|CLPP_METPP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|124259260|gb|ABM94254.1| ATP-dependent Clp protease proteolytic subunit ClpP [Methylibium
           petroleiphilum PM1]
          Length = 202

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 115/202 (56%), Positives = 155/202 (76%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
               E   LG+VP+V+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE
Sbjct: 1   MSALETQNLGMVPVVIEQSGRGERAYDIYSRLLRERVIFLVGPVNDQTANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+ISLYINSPGG V+AG++I+DTMQFIKP +ST CMG AASMG+ LL+AG KG R
Sbjct: 61  SENPDKDISLYINSPGGSVSAGLSIFDTMQFIKPDVSTLCMGIAASMGAFLLAAGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPN+R+++HQPSGG  GQA+DIE  A++I+K++  LN I  +  G+  E++    +RD
Sbjct: 121 FALPNSRVMIHQPSGGAQGQATDIEIQAREILKLRESLNGILAERTGQPLEKIRADSERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + MSA EA  +G++DKV+  R 
Sbjct: 181 YFMSAEEATGYGLIDKVIAQRA 202


>gi|269792564|ref|YP_003317468.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269100199|gb|ACZ19186.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 199

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 115/198 (58%), Positives = 153/198 (77%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
           S      L+P V+EQT RGERSYDIYSRLLK+RI+F+  +I+DH++ L+ AQLLFLE+E+
Sbjct: 2   SHGTMSYLIPYVIEQTGRGERSYDIYSRLLKDRIIFIGQEIDDHLSNLVVAQLLFLESED 61

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K++ +YINSPGGVVTAG+AIYDTMQ++K P+ST C+GQAASM ++LLSAGEKG R  L
Sbjct: 62  PDKDVFVYINSPGGVVTAGLAIYDTMQYVKCPVSTICVGQAASMAAVLLSAGEKGKRICL 121

Query: 131 PNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM 190
           P++RI++HQP GG  GQASDIE  A++I+++K  LN I   + G+  + + K  DRD  M
Sbjct: 122 PHSRIMIHQPLGGAQGQASDIEIQAKEILRMKEILNSILSNHTGQPMDRIAKDTDRDFFM 181

Query: 191 SASEACDWGVVDKVLMSR 208
           SA EA  +G+VDKV+  R
Sbjct: 182 SAEEAMAYGIVDKVIDRR 199


>gi|121534156|ref|ZP_01665981.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermosinus
           carboxydivorans Nor1]
 gi|121307259|gb|EAX48176.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermosinus
           carboxydivorans Nor1]
          Length = 203

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 112/198 (56%), Positives = 156/198 (78%), Gaps = 3/198 (1%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+VVEQ+NRGER+YDIYSRLLK+RIVF+ G I+DH+A L+ AQLLFLE+E+P K+I
Sbjct: 1   MTFVPIVVEQSNRGERAYDIYSRLLKDRIVFIGGPIDDHVANLVIAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTMQ+IKP +ST C+G AASM ++LL+AG  G R+ALP AR+
Sbjct: 61  HLYINSPGGVVTAGLAIYDTMQYIKPDVSTICLGSAASMAAVLLAAGAPGKRYALPYARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  A++I++++  LN+I  ++ GK  E ++   +RD+ MS+ EA
Sbjct: 121 MIHQPLGGAQGQATDIQIQAREILRLREILNDILARHTGKPLERIQHDTERDYFMSSEEA 180

Query: 196 CDWGVVDKVL---MSRID 210
            ++G++D V+     R D
Sbjct: 181 KEYGIIDAVVVRGEQRKD 198


>gi|259909254|ref|YP_002649610.1| Putative ATP-dependent Clp protease proteolytic subunit [Erwinia
           pyrifoliae Ep1/96]
 gi|224964876|emb|CAX56398.1| Putative ATP-dependent Clp protease proteolytic subunit [Erwinia
           pyrifoliae Ep1/96]
          Length = 207

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 171/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERELTAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+K K+ +NE+  K+ G+T E +
Sbjct: 119 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIDIHAREIIKTKQMMNELMAKHTGQTIETI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASE+ ++G+VD VL  R 
Sbjct: 179 ERDTNRDRFLSASESVEYGLVDSVLSQRS 207


>gi|53723667|ref|YP_103112.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia mallei
           ATCC 23344]
 gi|76808778|ref|YP_333874.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 1710b]
 gi|167719122|ref|ZP_02402358.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei DM98]
 gi|167738116|ref|ZP_02410890.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 14]
 gi|167815308|ref|ZP_02446988.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 91]
 gi|167823710|ref|ZP_02455181.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 9]
 gi|167845261|ref|ZP_02470769.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei B7210]
 gi|167893805|ref|ZP_02481207.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 7894]
 gi|167902257|ref|ZP_02489462.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei NCTC 13177]
 gi|167910496|ref|ZP_02497587.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei 112]
 gi|167918525|ref|ZP_02505616.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           pseudomallei BCC215]
 gi|67460238|sp|Q62JK7|CLPP_BURMA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|92087004|sp|Q3JRC9|CLPP_BURP1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|52427090|gb|AAU47683.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           mallei ATCC 23344]
 gi|76578231|gb|ABA47706.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei 1710b]
          Length = 207

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 120/209 (57%), Positives = 157/209 (75%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M+ +    +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ 
Sbjct: 1   MASQAP--RDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL+
Sbjct: 59  AQLLFLESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           +G KG R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN +   + G+  E +
Sbjct: 119 SGAKGKRYALPNARVMIHQPLGGARGQASDIEIQAREILYLRDRLNHLLAHHTGQDVERI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
            +  DRD+ MS+ +A  +G++D V   R 
Sbjct: 179 ARDTDRDNFMSSEDAKAYGLIDHVSTKRP 207


>gi|197302444|ref|ZP_03167499.1| hypothetical protein RUMLAC_01172 [Ruminococcus lactaris ATCC
           29176]
 gi|197298342|gb|EDY32887.1| hypothetical protein RUMLAC_01172 [Ruminococcus lactaris ATCC
           29176]
          Length = 193

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 113/192 (58%), Positives = 150/192 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A++I AQLLFLEA++P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVNDVSASVIVAQLLFLEADDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQ+IK  +ST C+G AASMG+ LLS G KG RFALPNA I
Sbjct: 61  QLYINSPGGSVTAGMAIYDTMQYIKCDVSTVCIGMAASMGAFLLSGGAKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++I+  A+ I++ ++ LN I   N GK  E ++   +RD+ MSA+EA
Sbjct: 121 MIHQPLGGAQGQATEIQIAAEHILRTRKTLNSILAANTGKPLEVIQTDTERDNFMSAAEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+V+ S
Sbjct: 181 KEYGLIDEVIAS 192


>gi|283797647|ref|ZP_06346800.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           sp. M62/1]
 gi|291074652|gb|EFE12016.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           sp. M62/1]
 gi|295092868|emb|CBK78975.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           cf. saccharolyticum K10]
 gi|295114657|emb|CBL35504.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [butyrate-producing bacterium SM4/1]
          Length = 193

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 113/193 (58%), Positives = 151/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+E T+RGERSYDI+SRLLKERIVF+  ++ D  A+LI AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIESTSRGERSYDIFSRLLKERIVFLGEEVTDVSASLIVAQLLFLESEDPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTM +IK  +ST C+G AASMG+ LL+ G KG R ALPNA +
Sbjct: 61  HLYINSPGGSVTAGMAIYDTMNYIKCDVSTICVGMAASMGAFLLAGGAKGKRLALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A++I++ K++LNEI   N G+ YE +E+  DRD+ M+A EA
Sbjct: 121 MIHQPSGGARGQATEIQIVAENILRTKKKLNEILAANTGQPYEVIERDTDRDNYMTAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D+V+  R
Sbjct: 181 LKYGLIDRVIAGR 193


>gi|295094048|emb|CBK83139.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Coprococcus
           sp. ART55/1]
          Length = 193

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 110/193 (56%), Positives = 149/193 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP VVEQT+RGER+YDIYSRLLK+RI+F+  ++ D  A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MALVPYVVEQTSRGERTYDIYSRLLKDRIIFLGDEVNDATASLVIAQLLFLESEDPSKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGM IYDTM++IK  +ST C G AASMG+ LL+ G KG R+ALPN+ I
Sbjct: 61  SLYINSPGGSVTAGMGIYDTMRYIKCDVSTICCGMAASMGAFLLAGGTKGKRYALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+K K +LN++  +N GK  + +    DRD+ M+A EA
Sbjct: 121 MIHQPLGGTQGQATEIEIAARHILKTKEKLNKMLSENTGKPLDVIAADTDRDNWMTAEEA 180

Query: 196 CDWGVVDKVLMSR 208
           C +G++D V+ +R
Sbjct: 181 CAYGLIDSVITNR 193


>gi|119713091|gb|ABL97160.1| ATP-dependent Clp protease proteolytic subunit [uncultured marine
           bacterium EB0_49D07]
          Length = 204

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 124/203 (61%), Positives = 170/203 (83%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E +  GLVPMVVEQT RGER++DIYSRLLKERI+F+TG I+D+++ L+ AQLLFLE+ENP
Sbjct: 2   ETINSGLVPMVVEQTPRGERAFDIYSRLLKERIIFLTGPIDDYISNLVVAQLLFLESENP 61

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+IS+YINSPGGV+T+G+AIYDTMQFI P +ST C+GQAASMGSLLL+ G +G RFAL 
Sbjct: 62  EKDISIYINSPGGVITSGLAIYDTMQFIAPEVSTLCIGQAASMGSLLLAGGAEGKRFALT 121

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+RI++HQP GGFSGQASD E HA++++ +K+++NEI  K+ GKT ++VE+  DRD+ ++
Sbjct: 122 NSRIMIHQPLGGFSGQASDFEIHAKEMLLVKQKVNEILSKHTGKTLKKVEQDTDRDNFLN 181

Query: 192 ASEACDWGVVDKVLMSRIDIEEK 214
           A+EA  +G++D++L  R +   K
Sbjct: 182 ATEAVTYGIIDEILEKRPETNGK 204


>gi|83718816|ref|YP_442643.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           thailandensis E264]
 gi|167581577|ref|ZP_02374451.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           thailandensis TXDOH]
 gi|167619693|ref|ZP_02388324.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           thailandensis Bt4]
 gi|167836265|ref|ZP_02463148.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           thailandensis MSMB43]
 gi|110816456|sp|Q2SWQ6|CLPP_BURTA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|83652641|gb|ABC36704.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           thailandensis E264]
          Length = 207

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 121/209 (57%), Positives = 157/209 (75%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M+ +    +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ 
Sbjct: 1   MASQAP--RDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL+
Sbjct: 59  AQLLFLESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           +G KG R+ALPNAR+++HQP GG  GQASDIE  A++I+ +K RLN +   + G+  E +
Sbjct: 119 SGAKGKRYALPNARVMIHQPLGGARGQASDIEIQAREILYLKDRLNHLLAHHTGQDVERI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
            +  DRD+ MS+ +A  +G++D V   R 
Sbjct: 179 ARDTDRDNFMSSEDAKAYGLIDHVSTKRP 207


>gi|163781838|ref|ZP_02176838.1| ATP-dependent Clp protease proteolytic subunit [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159883058|gb|EDP76562.1| ATP-dependent Clp protease proteolytic subunit [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 201

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 122/200 (61%), Positives = 162/200 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D ++V   LVP+V+EQT RGER+YDIYSRLL++RIV +   I+DH+A LI AQLLFLE++
Sbjct: 2   DIKEVTNQLVPIVIEQTPRGERAYDIYSRLLQDRIVLLGFPIDDHVANLIVAQLLFLESQ 61

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           +P K+I LYINSPGG VTAGMA+YDTMQ+IKP + T C+GQAASMG++LL+AG KG R+A
Sbjct: 62  DPDKDIYLYINSPGGSVTAGMAVYDTMQYIKPDVVTICIGQAASMGAVLLAAGAKGKRYA 121

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LP++RI++HQP GG  GQA+DI  HA++I +IKR LNEI  K+ G+  E++EK ++RD+ 
Sbjct: 122 LPHSRIMIHQPLGGIQGQATDIIIHAEEIKRIKRMLNEILAKHTGQDLEKIEKDVERDYF 181

Query: 190 MSASEACDWGVVDKVLMSRI 209
           MSA EA D+GV+DKV+  R 
Sbjct: 182 MSAEEAKDYGVIDKVIEKRQ 201


>gi|154482729|ref|ZP_02025177.1| hypothetical protein EUBVEN_00406 [Eubacterium ventriosum ATCC
           27560]
 gi|149736324|gb|EDM52210.1| hypothetical protein EUBVEN_00406 [Eubacterium ventriosum ATCC
           27560]
          Length = 193

 Score =  242 bits (617), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 112/193 (58%), Positives = 152/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQ +RGERSYDIYSRLLK+RI+F+  +I D +A+ + AQLLFLE+E+P K+I
Sbjct: 1   MALVPYVIEQNSRGERSYDIYSRLLKDRIIFLGEEINDAVASTVVAQLLFLESEDPGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG VTAGMAIYDTM ++K  +ST C+G AASMG+ LLS+G KG R+ALPNA +
Sbjct: 61  HMYINSPGGSVTAGMAIYDTMNYVKCDVSTTCIGMAASMGAFLLSSGAKGKRYALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++I+  A+ I+K K++LN+I   N GK  EEVEK  DRD+ +SA EA
Sbjct: 121 MIHQPLGGAQGQATEIQIAAEHILKTKKKLNQILADNAGKPVEEVEKDTDRDNWLSADEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+V+  R
Sbjct: 181 KEYGLIDEVIKDR 193


>gi|116793577|gb|ABK26796.1| unknown [Picea sitchensis]
          Length = 248

 Score =  241 bits (616), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 121/209 (57%), Positives = 162/209 (77%), Gaps = 1/209 (0%)

Query: 2   SFEGCAKKDSEDVFL-GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           S    +          GL+PMV+E T+RGER+YDI+SRLLKERI+ + G I D  A+++ 
Sbjct: 20  SLGTPSMNQFNPRRSYGLIPMVIEHTSRGERAYDIFSRLLKERIICINGPIADETASVVV 79

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENPQK I++YINSPGGVVTAG+AIYDTMQ+IK P++T C+GQAASMGSLLL+
Sbjct: 80  AQLLFLESENPQKPINMYINSPGGVVTAGLAIYDTMQYIKSPVTTLCIGQAASMGSLLLA 139

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG  G R ALPNAR+++HQPSGG SGQASDI  HA++I+K + RLN +Y K+ G+T E++
Sbjct: 140 AGSHGERRALPNARVMIHQPSGGASGQASDIAIHAKEILKTRERLNGLYAKHTGQTIEKI 199

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+ ++RD  MS  EA ++G++D+V+  R 
Sbjct: 200 EQFMERDTFMSPDEAKEFGLIDEVIEHRP 228


>gi|110816466|sp|Q2NV79|CLPP_SODGM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 194

 Score =  241 bits (616), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 131/194 (67%), Positives = 165/194 (85%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ++FLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFMTGQVEDHMANLIVAQMMFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +STFCMGQAASMG+ LL+AG KG RF LPN+R+
Sbjct: 61  YLYINSPGGVITAGMSIYDTMQFIKPDVSTFCMGQAASMGAFLLAAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ G+  E +E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGFQGQATDIEIHAREILKVKARMNELMAKHTGQPLEVIERDTERDRFLSAPEA 180

Query: 196 CDWGVVDKVLMSRI 209
            D+G+VD VL  R 
Sbjct: 181 VDYGLVDSVLSQRT 194


>gi|254476195|ref|ZP_05089581.1| Clp protease [Ruegeria sp. R11]
 gi|214030438|gb|EEB71273.1| Clp protease [Ruegeria sp. R11]
          Length = 202

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 124/201 (61%), Positives = 167/201 (83%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KE
Sbjct: 1   MNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKE 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           IS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R
Sbjct: 61  ISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEPGMRFSLPNSR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           +++HQPSGGF GQA+DI  HA++ +K+K+RLNEIYVK+ G+ Y+ +   L+RD+ MS  E
Sbjct: 121 VMVHQPSGGFQGQATDIMIHAEETLKLKKRLNEIYVKHTGQDYDSIVNALERDNFMSPEE 180

Query: 195 ACDWGVVDKVLMSRIDIEEKS 215
           A ++G++D+++ +R  ++   
Sbjct: 181 AKEFGLIDEIVENRSKLDSDD 201


>gi|238791431|ref|ZP_04635069.1| ATP-dependent Clp protease proteolytic subunit [Yersinia intermedia
           ATCC 29909]
 gi|238729047|gb|EEQ20563.1| ATP-dependent Clp protease proteolytic subunit [Yersinia intermedia
           ATCC 29909]
          Length = 194

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 129/194 (66%), Positives = 161/194 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 61  FLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK  EE+E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGFQGQATDIEIHAREILKVKSRMNELMALHTGKPLEEIERDTERDRFLSAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G+VD V   R 
Sbjct: 181 VGYGLVDSVFTRRD 194


>gi|254514393|ref|ZP_05126454.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium NOR5-3]
 gi|219676636|gb|EED33001.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium NOR5-3]
          Length = 213

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 125/199 (62%), Positives = 158/199 (79%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
                LGLVPMVVEQT+RGERSYDIYSRLLKER+VFV GQ+EDHMA LI AQLLFLE+EN
Sbjct: 10  PSVQSLGLVPMVVEQTSRGERSYDIYSRLLKERVVFVVGQVEDHMANLIVAQLLFLESEN 69

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I LYINSPGG VTAG++IYDTMQFIKP IST C+GQAASMG+ LLS G KG R+ L
Sbjct: 70  PDKDIHLYINSPGGSVTAGLSIYDTMQFIKPDISTMCLGQAASMGAFLLSGGTKGKRYCL 129

Query: 131 PNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM 190
           PNAR ++HQPSGG  GQA+DI+  A++I+ I+ RLN +  ++ G+  E +E+  +RD  M
Sbjct: 130 PNARTMIHQPSGGAQGQATDIDIQAKEILIIRERLNRLMAEHTGQPLEVIERDTERDRFM 189

Query: 191 SASEACDWGVVDKVLMSRI 209
            A ++ ++G+VD+V+ +R 
Sbjct: 190 DAEQSKEYGLVDEVVTARS 208


>gi|89098789|ref|ZP_01171670.1| ATP-dependent Clp protease proteolytic subunit [Bacillus sp. NRRL
           B-14911]
 gi|89086465|gb|EAR65585.1| ATP-dependent Clp protease proteolytic subunit [Bacillus sp. NRRL
           B-14911]
          Length = 201

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 110/201 (54%), Positives = 157/201 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D+++  I AQLLFLEAENP+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVSNSIVAQLLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG +TAGMAIYDTMQ+I+P +ST C+G AASMG+ LL+AGEKG RFALPN+ +
Sbjct: 61  TLYINSPGGSITAGMAIYDTMQYIRPKVSTVCIGMAASMGAFLLAAGEKGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN+I  +  G+  E + K  DRD+ M+A  A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLREKLNQILSERTGQPLEVIAKDTDRDNFMTAERA 180

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
            ++G++D+++   +  E+K K
Sbjct: 181 LEYGLIDQIISRNVLEEKKDK 201


>gi|86605879|ref|YP_474642.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Synechococcus
           sp. JA-3-3Ab]
 gi|115311348|sp|Q2JV68|CLPP2_SYNJA RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|86554421|gb|ABC99379.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Synechococcus
           sp. JA-3-3Ab]
          Length = 200

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 102/193 (52%), Positives = 147/193 (76%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           ++P V+EQ+ RGER++DIYSRLL++RI+F+  Q++D +A LI AQ+L+LE+E+P+K+I L
Sbjct: 1   MIPTVIEQSARGERAFDIYSRLLRDRIIFLGTQVDDDIANLIVAQMLYLESEDPEKDIYL 60

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V AGMAIYDTMQ I+P +ST C+G AASMG+ LL+ G KG R ALP+ARI++
Sbjct: 61  YINSPGGSVYAGMAIYDTMQHIQPDVSTICIGLAASMGAFLLAGGAKGKRIALPHARIMI 120

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  G A+DIE  A++I+ IK  LN +   + G+  E +E+  DRD+ M+  +A +
Sbjct: 121 HQPLGGAQGPATDIEIQAKEILFIKNSLNSLLAYHTGQPLERIERDTDRDNFMTPEQAKE 180

Query: 198 WGVVDKVLMSRID 210
           +G++D+V+  R  
Sbjct: 181 YGLIDQVITRRPQ 193


>gi|125975222|ref|YP_001039132.1| ATP-dependent Clp protease proteolytic subunit ClpP [Clostridium
           thermocellum ATCC 27405]
 gi|256003116|ref|ZP_05428108.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           thermocellum DSM 2360]
 gi|281419196|ref|ZP_06250212.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           thermocellum JW20]
 gi|166201818|sp|A3DJ10|CLPP_CLOTH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|125715447|gb|ABN53939.1| ATP-dependent Clp protease proteolytic subunit ClpP [Clostridium
           thermocellum ATCC 27405]
 gi|255992807|gb|EEU02897.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           thermocellum DSM 2360]
 gi|281407062|gb|EFB37324.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           thermocellum JW20]
 gi|316939386|gb|ADU73420.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           thermocellum DSM 1313]
          Length = 194

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 117/194 (60%), Positives = 154/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+ ++ +I D  A+L+ AQ+LFLEAE+P K+I
Sbjct: 1   MSLVPIVVEQTNRGERSYDIYSRLLKDRIIVLSDEINDVTASLVVAQMLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG AIYDTMQ++KP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  QLYINSPGGSVTAGFAIYDTMQYVKPDVSTICIGMAASMGAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA+ I+KIK +LN I  +  G+ +E++E+  +RD  MSA EA
Sbjct: 121 MIHQPLGGARGQATDIKIHAEQIIKIKNKLNRILSERTGQPFEKIERDTERDFFMSAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G+VD+V+  R 
Sbjct: 181 KAYGIVDEVMERRK 194


>gi|163815266|ref|ZP_02206643.1| hypothetical protein COPEUT_01426 [Coprococcus eutactus ATCC 27759]
 gi|158449461|gb|EDP26456.1| hypothetical protein COPEUT_01426 [Coprococcus eutactus ATCC 27759]
          Length = 193

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 109/193 (56%), Positives = 149/193 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP VVEQT+RGER++DIYSRLLK+RI+F+  ++ D  A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MALVPYVVEQTSRGERTFDIYSRLLKDRIIFLGDEVNDATASLVIAQLLFLESEDPSKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGM IYDTM++IK  +ST C G AASMG+ LL+ G KG R+ALPN+ I
Sbjct: 61  SLYINSPGGSVTAGMGIYDTMRYIKCDVSTICCGMAASMGAFLLAGGAKGKRYALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+K K +LN++  +N GK  + +    DRD+ M+A EA
Sbjct: 121 MIHQPLGGTQGQATEIEIAARHILKTKEKLNKMLAENTGKPLDVIAADTDRDNWMTADEA 180

Query: 196 CDWGVVDKVLMSR 208
           C +G++D V+ +R
Sbjct: 181 CAYGLIDSVITNR 193


>gi|251772219|gb|EES52789.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Leptospirillum ferrodiazotrophum]
          Length = 201

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 124/200 (62%), Positives = 165/200 (82%), Gaps = 1/200 (0%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMVVEQTNRGER+YDIYSRLL++RI+ +   I+D +A L+ AQ+LFLE+E+  K+I+L
Sbjct: 2   LIPMVVEQTNRGERAYDIYSRLLRDRIIILGTPIDDTVANLVIAQMLFLESEDSSKDINL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG+VTAG+AIYDT++FIKP +ST C+GQAASMG+ LLSAG KG R+ALPNARI++
Sbjct: 62  YINSPGGIVTAGLAIYDTIKFIKPDVSTICIGQAASMGAFLLSAGAKGKRYALPNARIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DIE HA++I+K+K  LN +  ++CG+  E+V +  DRD+ MSA EA D
Sbjct: 122 HQPMGGFQGQATDIEIHAREILKLKADLNRMMSEHCGQPVEKVAQDTDRDYFMSAKEAKD 181

Query: 198 WGVVDKVLMS-RIDIEEKSK 216
           +G++D V+ S RID E+ SK
Sbjct: 182 YGLIDSVITSHRIDTEKTSK 201


>gi|118594831|ref|ZP_01552178.1| Peptidase S14, ClpP [Methylophilales bacterium HTCC2181]
 gi|118440609|gb|EAV47236.1| Peptidase S14, ClpP [Methylophilales bacterium HTCC2181]
          Length = 209

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 127/197 (64%), Positives = 164/197 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMVVEQ+ RGERSYDIYSRLLKER+VF+ G ++D  A ++ AQLLFLEAENP K+I
Sbjct: 13  LGYIPMVVEQSGRGERSYDIYSRLLKERVVFLVGPVDDMTANVVVAQLLFLEAENPDKDI 72

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGMAIYDTMQFIKP IST C+GQAASMG+LLL+AG    RF+LPN+R+
Sbjct: 73  SLYINSPGGSVTAGMAIYDTMQFIKPDISTLCIGQAASMGALLLTAGAAKKRFSLPNSRV 132

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDIE HA++I+ +K +LN+I  ++ G++ E+V K  DRD+ MSA +A
Sbjct: 133 MIHQPLGGFQGQASDIEIHAKEILYLKEKLNKIMAEHSGQSLEKVSKDTDRDNFMSAKDA 192

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++DKV+ SR D++
Sbjct: 193 MEYGLIDKVISSRSDVK 209


>gi|152977369|ref|YP_001376886.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|152026121|gb|ABS23891.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cytotoxicus NVH 391-98]
          Length = 193

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 107/193 (55%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLE+++P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG RFALPN+ +
Sbjct: 61  HLYINSPGGSITAGMAIYDTMQFIKPNVSTICIGMAASMGAFLLAAGEKGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN+I  +  G+  E +E+  DRD+ M+A +A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLRDKLNKILAERTGQPLEVIERDTDRDNFMTAEKA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D++  +R
Sbjct: 181 LEYGLIDRIFTNR 193


>gi|261404070|ref|YP_003240311.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           sp. Y412MC10]
 gi|329927993|ref|ZP_08281997.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Paenibacillus sp. HGF5]
 gi|261280533|gb|ACX62504.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           sp. Y412MC10]
 gi|328938097|gb|EGG34494.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Paenibacillus sp. HGF5]
          Length = 198

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 110/192 (57%), Positives = 150/192 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  +PMVVEQ+NRGER+YDIYSRLLK+RI+F+   + D +A  I AQ+LFL AE+P+K+I
Sbjct: 1   MSFIPMVVEQSNRGERAYDIYSRLLKDRIIFLGSDVNDVVANSIIAQMLFLSAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAI+DTMQFIKP +ST C+G AASMG+ LL+AG KG R+ LPN+ I
Sbjct: 61  HLYINSPGGSITAGMAIFDTMQFIKPDVSTICVGMAASMGAFLLNAGAKGKRYGLPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE  A+ I+K++ +LN I  +  G+  E +EK  DRD+ M+A EA
Sbjct: 121 MIHQPLGGAQGQATDIEIRARRILKMRDKLNRILSERTGQPLERIEKDTDRDYFMTADEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+VL +
Sbjct: 181 KEYGLIDQVLEN 192


>gi|134094958|ref|YP_001100033.1| ATP-dependent Clp protease proteolytic subunit [Herminiimonas
           arsenicoxydans]
 gi|133738861|emb|CAL61908.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Herminiimonas arsenicoxydans]
          Length = 209

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 124/195 (63%), Positives = 157/195 (80%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
            LG+VPMV+EQ+ RGER+YDIYSRLLKER++F+ G + DH A LI AQLLFLE+ENP K+
Sbjct: 15  MLGMVPMVIEQSGRGERAYDIYSRLLKERVIFLVGPVNDHAANLIVAQLLFLESENPDKD 74

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           ISLYINSPGG V+AGMAI+DTMQFIKP +ST C G AASMG+ LL+AGEKG RF+LPN+R
Sbjct: 75  ISLYINSPGGSVSAGMAIFDTMQFIKPNVSTLCTGLAASMGAFLLAAGEKGKRFSLPNSR 134

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQASDIE  A++I+ ++ RLN+I     GKT EE+ +  DRD+ MSA  
Sbjct: 135 IMIHQPLGGAQGQASDIEIQAREILYLRERLNQILADRTGKTLEEISRDTDRDNFMSADA 194

Query: 195 ACDWGVVDKVLMSRI 209
           A ++G++DKVL +R 
Sbjct: 195 AVEYGMIDKVLTTRA 209


>gi|294670412|ref|ZP_06735294.1| hypothetical protein NEIELOOT_02131 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307876|gb|EFE49119.1| hypothetical protein NEIELOOT_02131 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 211

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 114/206 (55%), Positives = 158/206 (76%), Gaps = 2/206 (0%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
            E     L+P V+EQ+ RGER++DIYSRLLKERI+F+ G + DH A L+ AQ+LFLE+EN
Sbjct: 3   PEITNNTLIPTVIEQSGRGERAFDIYSRLLKERIIFLVGPVTDHTANLVVAQMLFLESEN 62

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I  YI+SPGG VTAGM+++DTM FIKP +ST C+GQAASMG+ LLSAG KG RFAL
Sbjct: 63  PDKDIFFYIDSPGGSVTAGMSVFDTMNFIKPDVSTLCLGQAASMGAFLLSAGAKGKRFAL 122

Query: 131 PNARILLHQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           PN+RI++HQP       GQASDIE HA++++K+K++LNE+  K+ G+  E+VE+  DRD+
Sbjct: 123 PNSRIMIHQPLISGGLGGQASDIEIHARELIKLKQKLNELLAKHTGQPLEKVERDTDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEK 214
            MS+  A ++G++D+V+ +R D  + 
Sbjct: 183 FMSSEAAKEYGLIDEVIATRADAFKA 208


>gi|253999170|ref|YP_003051233.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylovorus
           sp. SIP3-4]
 gi|313201272|ref|YP_004039930.1| ATP-dependent clp protease, proteolytic subunit clpp [Methylovorus
           sp. MP688]
 gi|253985849|gb|ACT50706.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylovorus
           sp. SIP3-4]
 gi|312440588|gb|ADQ84694.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylovorus
           sp. MP688]
          Length = 208

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 122/205 (59%), Positives = 160/205 (78%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
             +   E   LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLF
Sbjct: 2   SMQSQWEPQGLGYIPMVIEQSGRGERAYDIYSRLLRERVIFLVGPVNDMTANLVVAQLLF 61

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LEAENP K+ISLYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+LLL+AG K 
Sbjct: 62  LEAENPDKDISLYINSPGGSVTAGMAIYDTMQFIKPDVSTLCIGQAASMGALLLTAGAKD 121

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            RF LPN+R+++HQP GGF GQASDIE HA++I+ ++ +LN I   + G+  + +E+  D
Sbjct: 122 KRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILYLREKLNLILASHTGQPVDVIERDTD 181

Query: 186 RDHIMSASEACDWGVVDKVLMSRID 210
           RD+ MSA ++ ++G+VDKV+ SR D
Sbjct: 182 RDNFMSAQQSVNYGLVDKVIASRTD 206


>gi|260575566|ref|ZP_05843564.1| Endopeptidase Clp [Rhodobacter sp. SW2]
 gi|259022209|gb|EEW25507.1| Endopeptidase Clp [Rhodobacter sp. SW2]
          Length = 210

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 133/210 (63%), Positives = 172/210 (81%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  D ++  LVPMVVEQT+RGER+YDI+SR+LKERI+F++G + D M+ LICAQLLFL
Sbjct: 1   MRDPIDHYMNTLVPMVVEQTSRGERAYDIFSRMLKERIIFLSGPVHDGMSALICAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G++IYDTMQ+IKP IST  +GQAASMGSLLL+AG+KGM
Sbjct: 61  EAENPTKEISMYINSPGGVVTSGLSIYDTMQYIKPRISTLVIGQAASMGSLLLTAGQKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGG+ GQA+DI  HAQ+  K+K RLN IYVK+ G+  E V   L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGYQGQATDIMIHAQETQKLKDRLNGIYVKHTGQPMEAVVAALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           D+ MSA +A  WG++D+++ SR   EE  K
Sbjct: 181 DNFMSAEDAKSWGLIDEIVESRGKAEETPK 210


>gi|110834071|ref|YP_692930.1| ATP-dependent Clp protease, proteolytic subunitclpp [Alcanivorax
           borkumensis SK2]
 gi|110647182|emb|CAL16658.1| ATP-dependent Clp protease, proteolytic subunitClpP [Alcanivorax
           borkumensis SK2]
          Length = 218

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 129/199 (64%), Positives = 162/199 (81%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
            +   LGLVP+V+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA LI AQ+LFLE+EN
Sbjct: 19  KDPTNLGLVPVVIEQTARGERSFDIYSRLLKERVIFMIGQVEDHMANLIVAQMLFLESEN 78

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+AG  G RFAL
Sbjct: 79  PDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGAFLLTAGAAGKRFAL 138

Query: 131 PNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM 190
           PNAR+++HQP GGF GQASDIE HA++I+KIK +LN +   + G+  E++EK  DRD+ M
Sbjct: 139 PNARVMIHQPLGGFQGQASDIEIHAKEILKIKGQLNSLLAHHTGQPIEQLEKDTDRDNFM 198

Query: 191 SASEACDWGVVDKVLMSRI 209
           SA EA ++G++D VL  R 
Sbjct: 199 SADEAKEYGIIDAVLSQRP 217


>gi|113970830|ref|YP_734623.1| ATP-dependent Clp protease proteolytic subunit [Shewanella sp.
           MR-4]
 gi|123029527|sp|Q0HHA1|CLPP_SHESM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|113885514|gb|ABI39566.1| ATP-dependent Clp protease proteolytic subunit ClpP [Shewanella sp.
           MR-4]
          Length = 202

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 125/201 (62%), Positives = 162/201 (80%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             ++ D+   LVPMV+EQT +GERS+DIYSRLLKERI+F+ GQ+E+HMA LI AQLLFLE
Sbjct: 1   MHNASDIQSALVPMVIEQTAKGERSFDIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +E+P K+I LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+ GEKG R
Sbjct: 61  SESPDKDIFLYINSPGGSVTAGMAIYDTMQFIKPNVSTVCIGQAASMGAFLLAGGEKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GGF GQASDI  HAQ+I+ IK +LN +  ++ G+  E +E+  DRD
Sbjct: 121 FCLPNSRVMIHQPLGGFQGQASDIAIHAQEILGIKHKLNLMLSEHTGQPLELIERDTDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + MSA++A ++G+VD V+  R
Sbjct: 181 NFMSATQAVEYGLVDAVMTKR 201


>gi|90423893|ref|YP_532263.1| endopeptidase Clp [Rhodopseudomonas palustris BisB18]
 gi|116243159|sp|Q215J2|CLPP_RHOPB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90105907|gb|ABD87944.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Rhodopseudomonas palustris BisB18]
          Length = 210

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 137/205 (66%), Positives = 173/205 (84%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED M+TL  AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGPVEDGMSTLTVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP+ST C GQAASMGSLLL+AG   MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAGHPDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+RI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD
Sbjct: 121 FSLPNSRIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIE 212
             ++A  A D+G+VDKV+  R +  
Sbjct: 181 KFLTADMARDFGIVDKVIDKRSEEP 205


>gi|254504144|ref|ZP_05116295.1| Clp protease [Labrenzia alexandrii DFL-11]
 gi|222440215|gb|EEE46894.1| Clp protease [Labrenzia alexandrii DFL-11]
          Length = 213

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 136/210 (64%), Positives = 181/210 (86%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D+++  LVPMVVEQTNRGER++DIYSRLLKERI+F+TG +EDHMATL+ AQLL+L
Sbjct: 1   MKDPVDIYMNTLVPMVVEQTNRGERAFDIYSRLLKERIIFLTGPVEDHMATLVSAQLLYL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EA+NP KEI++YINSPGG+VT+G+AIYDTMQFI+P +ST C+GQAASMGSLLL+AGEK M
Sbjct: 61  EADNPSKEIAIYINSPGGLVTSGLAIYDTMQFIRPSVSTLCIGQAASMGSLLLAAGEKDM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF LPNAR+++HQPSGGF GQA+DI  HAQ+I+ +KRRLNEIYVK+ G++ ++VE+ L+R
Sbjct: 121 RFILPNARVMVHQPSGGFRGQAADIMLHAQEILAMKRRLNEIYVKHTGRSLDQVEEALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           D+ M+A +A ++G+VD V+  R  +  +++
Sbjct: 181 DNFMTAEKAKEFGIVDSVITDRTSLGGENE 210


>gi|197284027|ref|YP_002149899.1| ATP-dependent Clp protease proteolytic subunit [Proteus mirabilis
           HI4320]
 gi|226329068|ref|ZP_03804586.1| hypothetical protein PROPEN_02971 [Proteus penneri ATCC 35198]
 gi|227358102|ref|ZP_03842444.1| ATP-dependent Clp protease proteolytic subunit [Proteus mirabilis
           ATCC 29906]
 gi|226706465|sp|B4EU53|CLPP_PROMH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|194681514|emb|CAR40393.1| ATP-dependent Clp protease proteolytic subunit [Proteus mirabilis
           HI4320]
 gi|225202254|gb|EEG84608.1| hypothetical protein PROPEN_02971 [Proteus penneri ATCC 35198]
 gi|227161837|gb|EEI46869.1| ATP-dependent Clp protease proteolytic subunit [Proteus mirabilis
           ATCC 29906]
          Length = 207

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 127/201 (63%), Positives = 167/201 (83%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           ++     + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLEA
Sbjct: 7   QEQFAPNMALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLEA 66

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+K+I+LYINSPGGV+TAGM+IYDTMQ+IK  +ST CMGQA SMG+ LLSAG KG R 
Sbjct: 67  ENPEKDINLYINSPGGVITAGMSIYDTMQYIKADVSTICMGQACSMGAFLLSAGAKGKRI 126

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
            LPN+R+++HQP GG+ GQA+DI+ HAQ+I+K+K R+NE+  ++ GK+ EE+E+  +RD 
Sbjct: 127 CLPNSRVMIHQPLGGYQGQATDIQIHAQEILKVKSRMNELMAQHTGKSIEEIERDTERDR 186

Query: 189 IMSASEACDWGVVDKVLMSRI 209
            +SA+EA ++G+VDKV   R 
Sbjct: 187 FLSANEALEYGLVDKVYTQRS 207


>gi|320450477|ref|YP_004202573.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermus
           scotoductus SA-01]
 gi|320150646|gb|ADW22024.1| ATP-dependent Clp protease, proteolytic, subunit ClpP [Thermus
           scotoductus SA-01]
          Length = 212

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 107/192 (55%), Positives = 149/192 (77%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           ++P V+EQT RGER YDIYSRLLK+RI+F+   I+  +A +I AQLLFL+A+NP +EI L
Sbjct: 20  VIPYVIEQTARGERVYDIYSRLLKDRIIFLGTPIDSQVANIIVAQLLFLDAQNPNQEIRL 79

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V AG+AIYDTMQF++ P+ST  +G AASM +++L+AGEKG R+ALP++++++
Sbjct: 80  YINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHSKVMI 139

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  G ASDI   AQ+I+K K+ LNEI  K+ G+  E+VEK  DRD+ +SA EA +
Sbjct: 140 HQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALE 199

Query: 198 WGVVDKVLMSRI 209
           +G++D+V+    
Sbjct: 200 YGLIDQVVTREE 211


>gi|325577258|ref|ZP_08147742.1| ATP-dependent Clp protease, protease subunit [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160840|gb|EGC72961.1| ATP-dependent Clp protease, protease subunit [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 193

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 159/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P+K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPKKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDVRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G++ E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIERIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD VL+ R
Sbjct: 181 KAYGLVDDVLIKR 193


>gi|302817596|ref|XP_002990473.1| hypothetical protein SELMODRAFT_131898 [Selaginella moellendorffii]
 gi|300141641|gb|EFJ08350.1| hypothetical protein SELMODRAFT_131898 [Selaginella moellendorffii]
          Length = 253

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 119/209 (56%), Positives = 164/209 (78%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    A    +    GL+PMV+E T RGER+YDI+SRLLKERIV + G I D  A+L+ A
Sbjct: 13  ALSPPALDHHQRRLYGLIPMVIEHTARGERAYDIFSRLLKERIVCIHGPIADDTASLVVA 72

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLL+LE+ENP K I LYINSPGGVVTAG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL+A
Sbjct: 73  QLLYLESENPLKPIHLYINSPGGVVTAGLAIYDTMQYIRSPVSTLCVGQAASMGSLLLAA 132

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           GE G R +LPNAR+++HQPSGG SGQASDI   A++I+ ++ RLN++Y K+ G + E+++
Sbjct: 133 GEPGQRRSLPNARVMVHQPSGGASGQASDIAIQAREILDMRSRLNKLYAKHTGSSIEKID 192

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRID 210
           ++++RDH MS  EA ++G++D+V++ R +
Sbjct: 193 QSMERDHFMSPEEAKEFGLIDEVIVQRPE 221


>gi|284006421|emb|CBA71657.1| ATP-dependent Clp protease proteolytic subunit [Arsenophonus
           nasoniae]
          Length = 209

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 167/209 (79%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+     +D     + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA L+ 
Sbjct: 3   MSYHN--NQDQLAPHMALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLVV 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 61  AQMLFLEAENPDKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDIE HA++I+KIK R+NE+  K+ GK  +EV
Sbjct: 121 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIEIHAKEILKIKSRMNELMAKHTGKKIKEV 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E   +RD  ++A EA  +G+VDK+  +R 
Sbjct: 181 ENDTERDRFLTAEEAVSYGLVDKIYTNRN 209


>gi|253575504|ref|ZP_04852841.1| clp protease [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845151|gb|EES73162.1| clp protease [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 198

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 111/192 (57%), Positives = 150/192 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  +PMVVEQ+NRGER+YDIYSRLLK+RI+F+  Q+ D +A  I AQ+LFL+AE+P K+I
Sbjct: 1   MSYIPMVVEQSNRGERAYDIYSRLLKDRIIFLGSQVNDVVANSIIAQMLFLDAEDPTKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQFIK  +ST C+G AASMG+ LL+AG  G R+ALPN+ I
Sbjct: 61  HLYINSPGGSITAGMAIYDTMQFIKADVSTICVGLAASMGAFLLNAGAPGKRYALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE  A+ I+K++ +LN I  +  G+  E +EK  DRD+ MSA+EA
Sbjct: 121 MIHQPLGGAEGQATDIEIRARRILKMRDKLNRILSERTGQPLERIEKDTDRDYFMSAAEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+V+  
Sbjct: 181 KEYGLIDQVIEK 192


>gi|116243156|sp|Q21Y67|CLPP_RHOFD RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 202

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 109/198 (55%), Positives = 155/198 (78%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           +   LG+VPMV+EQ+ RGERSYDIYSRLLKER++F+ G + D++A L+ AQLLFLE++NP
Sbjct: 5   QTQALGMVPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDYVANLVVAQLLFLESDNP 64

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+IS YINSPGG V+AGMAI+DTM F+KP +ST C G AASMG+ LL+AG KG RF+LP
Sbjct: 65  DKDISFYINSPGGSVSAGMAIFDTMNFVKPDVSTLCTGMAASMGAFLLAAGAKGKRFSLP 124

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+++++HQPSGG  GQA++IE  A++I+K + +LN+I  +  G+    +E+  +RD+ MS
Sbjct: 125 NSKVMIHQPSGGSQGQATEIEIQAREILKTREQLNKILAERTGQPLARIERDTERDYYMS 184

Query: 192 ASEACDWGVVDKVLMSRI 209
           A E  ++G++D+V+  R 
Sbjct: 185 ADECKEYGLIDQVISKRA 202


>gi|213521159|gb|ACJ50516.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens]
          Length = 211

 Score =  241 bits (616), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 125/193 (64%), Positives = 159/193 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG +G RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAEGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G+T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDTNRDNFMSAEAAK 197

Query: 197 DWGVVDKVLMSRI 209
           ++G++D V+  R 
Sbjct: 198 EYGLIDAVIDKRP 210


>gi|86610014|ref|YP_478776.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Synechococcus
           sp. JA-2-3B'a(2-13)]
 gi|115311349|sp|Q2JIP1|CLPP2_SYNJB RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|86558556|gb|ABD03513.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Synechococcus
           sp. JA-2-3B'a(2-13)]
          Length = 200

 Score =  241 bits (615), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 102/193 (52%), Positives = 147/193 (76%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           ++P V+EQ+ RGER++DIYSRLL++RI+F+  Q++D +A LI AQ+L+LE+E+P+K+I L
Sbjct: 1   MIPTVIEQSARGERAFDIYSRLLRDRIIFLGTQVDDDIANLIVAQMLYLESEDPEKDIYL 60

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V AGMAIYDTMQ I+P +ST C+G AASMG+ LL+ G KG R ALP+ARI++
Sbjct: 61  YINSPGGSVYAGMAIYDTMQHIQPDVSTICIGLAASMGAFLLAGGTKGKRIALPHARIMI 120

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  G A+DIE  A++I+ IK  LN +   + G+  E +E+  DRD+ M+  +A +
Sbjct: 121 HQPLGGAQGPATDIEIQAKEILFIKNSLNSLLAYHTGQPLERIERDTDRDNFMTPEQAKE 180

Query: 198 WGVVDKVLMSRID 210
           +G++D+V+  R  
Sbjct: 181 YGLIDQVISKRPQ 193


>gi|282883083|ref|ZP_06291683.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Peptoniphilus
           lacrimalis 315-B]
 gi|300813694|ref|ZP_07094016.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Peptoniphilus
           sp. oral taxon 836 str. F0141]
 gi|281297060|gb|EFA89556.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Peptoniphilus
           lacrimalis 315-B]
 gi|300512236|gb|EFK39414.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Peptoniphilus
           sp. oral taxon 836 str. F0141]
          Length = 194

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 119/194 (61%), Positives = 158/194 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLK+RI+F +G++ D MA LI AQLLFLE+E+P K+I
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKDRIIFASGEVNDTMADLIVAQLLFLESEDPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG+AIYDTMQ+IKP +ST C+G AASMG++LLS+G KG RFALPN+ I
Sbjct: 61  QLYINSPGGSVSAGLAIYDTMQYIKPDVSTICIGMAASMGAILLSSGAKGKRFALPNSDI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  G A+DI+  A+ I+K ++ LN+I  KN G+  E++E+  DRD  + A+EA
Sbjct: 121 MIHQPSGGTQGMATDIQITAEKILKTRKSLNQILAKNTGQKLEKIERDADRDFWLDANEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++DKV+ +R 
Sbjct: 181 KEYGLIDKVIENRE 194


>gi|255284021|ref|ZP_05348576.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bryantella
           formatexigens DSM 14469]
 gi|255265474|gb|EET58679.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bryantella
           formatexigens DSM 14469]
          Length = 194

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 113/194 (58%), Positives = 149/194 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A LI AQLLFLE+E+P K+I
Sbjct: 1   MSFVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVTDVSANLIVAQLLFLESEDPAKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG AIYDTMQ+IK  +ST CMG AASMG+ LL+ G KG RFALPNA+I
Sbjct: 61  QLYINSPGGSVSAGWAIYDTMQYIKCDVSTICMGMAASMGAFLLAGGAKGKRFALPNAQI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+K ++RLNE    N G+  + +E   +RD+ M+A EA
Sbjct: 121 MIHQPSGGAKGQASDIKIVAEEILKSRKRLNEYLAANTGQPIDVIEADTERDNYMTAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G++D V+ +R 
Sbjct: 181 KAYGLIDAVIANRQ 194


>gi|114327971|ref|YP_745128.1| ATP-dependent endopeptidase Clp proteolytic subunit clpP
           [Granulibacter bethesdensis CGDNIH1]
 gi|114316145|gb|ABI62205.1| ATP-dependent endopeptidase clp proteolytic subunit clpP
           [Granulibacter bethesdensis CGDNIH1]
          Length = 248

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 134/216 (62%), Positives = 172/216 (79%), Gaps = 3/216 (1%)

Query: 4   EGCAKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQ 62
                +D  +V+   LVPMVVEQT RGERS+DIYSRLLKERI+F+TG + D ++ LICAQ
Sbjct: 32  RNMRDRDPVEVYSNTLVPMVVEQTARGERSFDIYSRLLKERIIFLTGAVYDQVSALICAQ 91

Query: 63  LLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAG 122
           LLFLE+ENPQKEIS YINSPGGVV+AG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL AG
Sbjct: 92  LLFLESENPQKEISFYINSPGGVVSAGLAIYDTMQYIRSPVSTVCIGQAASMGSLLLCAG 151

Query: 123 EKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK 182
           EK  RFALPNAR+++HQPSGG  GQA+DIE  A++I+ +++RLNEIY ++ G++ E +E+
Sbjct: 152 EKDKRFALPNARVMVHQPSGGAQGQATDIEIQAREILTLRKRLNEIYNRHTGQSIEAIER 211

Query: 183 TLDRDHIMSASEACDWGVVDKVLMSRI--DIEEKSK 216
            L+RD  MSA EA D+G+VD+V+  R      + SK
Sbjct: 212 KLERDTYMSAEEARDFGLVDQVVERRPVSSTPDSSK 247


>gi|121602655|ref|YP_988860.1| ATP-dependent Clp protease proteolytic subunit [Bartonella
           bacilliformis KC583]
 gi|166201800|sp|A1USA7|CLPP_BARBK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|120614832|gb|ABM45433.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bartonella
           bacilliformis KC583]
          Length = 210

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 149/209 (71%), Positives = 178/209 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D     L LVPMVVEQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLE
Sbjct: 1   MSDLVKTALSLVPMVVEQTNRGERAYDIFSRLLKERIIFINGPVEDSMAMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEISLYINSPGGVVT+GMAIYDTMQFI+PPIST CMGQAASMGSLLL+AG KG R
Sbjct: 61  AENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPISTLCMGQAASMGSLLLTAGAKGHR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPNARI++HQPSGGF GQASDIERHAQDI+++KR LNEIYV++ G+ YE +E TLDRD
Sbjct: 121 FSLPNARIMVHQPSGGFQGQASDIERHAQDIIRMKRHLNEIYVQHTGQDYEIIENTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           H M+A EA  +G++D V+  R + +++ K
Sbjct: 181 HFMTAEEAKMFGLIDDVIQYRAETKKEEK 209


>gi|170693532|ref|ZP_02884691.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           graminis C4D1M]
 gi|170141687|gb|EDT09856.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           graminis C4D1M]
          Length = 219

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 117/210 (55%), Positives = 154/210 (73%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
                     LGLVP V+EQ+ RGER+YDIYSRLL+ERIVF+ G + +  A+LI AQLLF
Sbjct: 1   MQSSYPPVTGLGLVPTVIEQSGRGERAYDIYSRLLRERIVFLVGPVNEQSASLIVAQLLF 60

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP K+IS YINSPGG V  G+AIYDTMQFIKP +ST C G AASMG+ LL AG++G
Sbjct: 61  LESENPDKDISFYINSPGGSVYDGLAIYDTMQFIKPEVSTLCTGFAASMGTFLLCAGQRG 120

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            R+ALPNARI++HQPSGG  G A+DI+  A++++ ++ RLN +  +  G++ EEV +  D
Sbjct: 121 KRYALPNARIMIHQPSGGSQGTAADIDIQAKEVLYLRERLNAMMAERTGRSIEEVARDTD 180

Query: 186 RDHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           RD+ MSAS A  +G+VD+VL +R  +   S
Sbjct: 181 RDNFMSASAAKTYGLVDEVLETRAALNSSS 210


>gi|161501794|ref|YP_767292.2| ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 209

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 160/207 (77%), Positives = 186/207 (89%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLE
Sbjct: 1   MRNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGAVEDHMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRD
Sbjct: 121 FATPNSRIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEK 214
           H M A EA  WGV+DKVL SR+++E +
Sbjct: 181 HFMDADEAQSWGVIDKVLTSRLEMEGE 207


>gi|89896100|ref|YP_519587.1| hypothetical protein DSY3354 [Desulfitobacterium hafniense Y51]
 gi|219670517|ref|YP_002460952.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Desulfitobacterium hafniense DCB-2]
 gi|116243113|sp|Q24S49|CLPP2_DESHY RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|89335548|dbj|BAE85143.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219540777|gb|ACL22516.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfitobacterium hafniense DCB-2]
          Length = 202

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 113/202 (55%), Positives = 152/202 (75%), Gaps = 3/202 (1%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMV+EQTNRGERSYDIYSRLLK+RI+F+ G + D +A L+ AQ+LFLEAE+P+K+
Sbjct: 1   MSYLVPMVIEQTNRGERSYDIYSRLLKDRIIFLGGPVTDDVANLVVAQMLFLEAEDPEKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGG ++AGMAIYDTMQ+I+  + T C+G AASMG+ LL+AG KG R ALPNA 
Sbjct: 61  IFLYINSPGGSISAGMAIYDTMQYIRADVHTICVGLAASMGAFLLTAGAKGKRQALPNAE 120

Query: 135 ILLHQPSG---GFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           IL+HQP     G SGQA++IE HA+ ++++K R+N I  +  G+T E +E   DRD  M+
Sbjct: 121 ILIHQPLIGGGGISGQATEIEIHAKHLLRVKERMNRILAERTGQTIERIEADTDRDRYMT 180

Query: 192 ASEACDWGVVDKVLMSRIDIEE 213
           A EA ++G++D+VL      ++
Sbjct: 181 AEEAKEYGLIDEVLEKPNQPKK 202


>gi|187477999|ref|YP_786023.1| ATP-dependent Clp protease proteolytic subunit [Bordetella avium
           197N]
 gi|115422585|emb|CAJ49110.1| ATP-dependent Clp protease proteolytic subunit [Bordetella avium
           197N]
          Length = 217

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 117/196 (59%), Positives = 153/196 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMVVEQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVVEQSGRGERAYDIYSRLLRERLIFLVGPVNDATANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V AGMAI+DTMQF+KP +ST C G AASMG+ LL+AG+KG RF+LPN+RI
Sbjct: 82  SFYINSPGGSVYAGMAIFDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFSLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  +N G++ E +    +RD  MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAKEILDLRERLNRILAENTGQSMERIAIDTERDTFMSAEDA 201

Query: 196 CDWGVVDKVLMSRIDI 211
             +G+VDKVL  R D+
Sbjct: 202 LSYGLVDKVLARREDV 217


>gi|188534634|ref|YP_001908431.1| Putative ATP-dependent Clp protease proteolytic subunit [Erwinia
           tasmaniensis Et1/99]
 gi|188029676|emb|CAO97555.1| Putative ATP-dependent Clp protease proteolytic subunit [Erwinia
           tasmaniensis Et1/99]
          Length = 207

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 171/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERELTAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+K K+ +NE+  K+ G+T E +
Sbjct: 119 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIDIHAREIIKTKQMMNELMAKHTGQTIETI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASE+ ++G+VD VL  R 
Sbjct: 179 ERDTNRDRFLSASESVEYGLVDSVLAQRN 207


>gi|114152202|sp|Q2L256|CLPP_BORA1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 201

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 117/196 (59%), Positives = 153/196 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMVVEQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 6   LGYIPMVVEQSGRGERAYDIYSRLLRERLIFLVGPVNDATANLVVAQLLFLESENPDKDI 65

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S YINSPGG V AGMAI+DTMQF+KP +ST C G AASMG+ LL+AG+KG RF+LPN+RI
Sbjct: 66  SFYINSPGGSVYAGMAIFDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFSLPNSRI 125

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  +N G++ E +    +RD  MSA +A
Sbjct: 126 MIHQPSGGAQGQASDIQIQAKEILDLRERLNRILAENTGQSMERIAIDTERDTFMSAEDA 185

Query: 196 CDWGVVDKVLMSRIDI 211
             +G+VDKVL  R D+
Sbjct: 186 LSYGLVDKVLARREDV 201


>gi|82703457|ref|YP_413023.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosospira
           multiformis ATCC 25196]
 gi|110816459|sp|Q2Y6J0|CLPP_NITMU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|82411522|gb|ABB75631.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrosospira
           multiformis ATCC 25196]
          Length = 213

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 119/203 (58%), Positives = 161/203 (79%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +++ E   LGL+PMV+E + RGER+YDIYSRLL+ER++F+ G + +  A LI AQLLFLE
Sbjct: 8   QRNHEPQDLGLIPMVIETSGRGERAYDIYSRLLRERVIFLVGPVTEASANLIVAQLLFLE 67

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +EN  K+I  YINSPGG+V+AGMA+YDTMQFIKP +ST C+GQAASMGSLLL+AG KG R
Sbjct: 68  SENADKDIHFYINSPGGLVSAGMAVYDTMQFIKPDVSTLCIGQAASMGSLLLAAGAKGKR 127

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GGF GQASDIE HA++I+ +K RLNE+  K+ G++ E +E+  DRD
Sbjct: 128 FCLPNSRVMIHQPLGGFQGQASDIEIHAREILYLKNRLNELLSKHTGQSMETIERDTDRD 187

Query: 188 HIMSASEACDWGVVDKVLMSRID 210
           + + A ++  +G+VD VL SR +
Sbjct: 188 NFLGAEDSVKYGLVDAVLTSRGE 210


>gi|319650519|ref|ZP_08004659.1| ATP-dependent Clp protease proteolytic subunit [Bacillus sp.
           2_A_57_CT2]
 gi|317397700|gb|EFV78398.1| ATP-dependent Clp protease proteolytic subunit [Bacillus sp.
           2_A_57_CT2]
          Length = 201

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 112/201 (55%), Positives = 154/201 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I AQLLFLEAENP+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVAQLLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG +TAGMAIYDTMQFIKP + T C+G AASMG+ LL+AGEKG RFALPN+ +
Sbjct: 61  SIYINSPGGSITAGMAIYDTMQFIKPKVQTICIGMAASMGAFLLAAGEKGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN I  +  G+  E + +  DRD+ M+A  A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLREKLNTILSERTGQPLEVIARDTDRDNFMTAERA 180

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
            ++G+VD+++      E+K K
Sbjct: 181 LEYGLVDQIITRNSLDEKKDK 201


>gi|188590743|ref|YP_001921998.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum E3 str. Alaska E43]
 gi|251778109|ref|ZP_04821029.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum E1 str. 'BoNT E Beluga']
 gi|226706443|sp|B2UX13|CLPP_CLOBA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|188501024|gb|ACD54160.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum E3 str. Alaska E43]
 gi|243082424|gb|EES48314.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum E1 str. 'BoNT E Beluga']
          Length = 199

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 118/199 (59%), Positives = 157/199 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+ ++G++ D  + LI +QLLFLE+E+P K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIFSRLLKERIIMLSGEVNDDSSNLIVSQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LLS+G KG R+ALPNA I
Sbjct: 61  SIYINSPGGSITAGMAIYDTMQYIKPDVSTICVGMAASMGAFLLSSGAKGKRYALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA  I+KIK  LN+I  +N  +  E +E  ++RD+ M+A EA
Sbjct: 121 MIHQPLGGFQGQATDIQIHANRILKIKESLNKILSENTNQPLEVIEADVERDNFMTADEA 180

Query: 196 CDWGVVDKVLMSRIDIEEK 214
             +G+VDKV+      ++K
Sbjct: 181 KAYGLVDKVITKNGTGKDK 199


>gi|297583414|ref|YP_003699194.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           selenitireducens MLS10]
 gi|297141871|gb|ADH98628.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           selenitireducens MLS10]
          Length = 197

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 113/197 (57%), Positives = 155/197 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I AQLLFL A++P K+I
Sbjct: 1   MNLVPTVIEQTNRGERAYDIYSRLLKDRIIMLGTPIDDNVANSIVAQLLFLAADDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAGMAIYDTMQFIKP + T C+G AASMG+ LL+AGE G R+ALPN+ +
Sbjct: 61  SLYINSPGGSITAGMAIYDTMQFIKPKVQTICIGMAASMGAFLLTAGEPGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE HA+ IV++K +LN+I  +  G+  E++ K  DRD+ +SA++A
Sbjct: 121 MIHQPLGGAQGQASDIEIHAKRIVEMKEKLNQILAERTGQDIEQIRKDTDRDNFLSAAQA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+V+    D +
Sbjct: 181 KEYGLIDEVMDKTPDTK 197


>gi|322418659|ref|YP_004197882.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter sp.
           M18]
 gi|320125046|gb|ADW12606.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter sp.
           M18]
          Length = 199

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 117/190 (61%), Positives = 157/190 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+D++A L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGGIDDNVANLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTM++IK P+ST C+GQAASMG+ LLS GEKG RF+L N+RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMRYIKAPVSTICIGQAASMGAFLLSGGEKGKRFSLANSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HA++I+++K +LNE+  ++ G+++E+V    +RD+ MS  EA  
Sbjct: 122 HQPLGGFQGQATDIHIHAKEILRMKDQLNELLAEHTGQSFEKVAADTERDYFMSGEEAKS 181

Query: 198 WGVVDKVLMS 207
           +G++D ++  
Sbjct: 182 YGIIDAIVTR 191


>gi|237747781|ref|ZP_04578261.1| ATP-dependent Clp protease proteolytic subunit [Oxalobacter
           formigenes OXCC13]
 gi|229379143|gb|EEO29234.1| ATP-dependent Clp protease proteolytic subunit [Oxalobacter
           formigenes OXCC13]
          Length = 207

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 126/197 (63%), Positives = 159/197 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           +   LG++PMV+EQ+ RGER+YDIYSRLLKERIVF+ G + D  A LI AQLLFLE+ENP
Sbjct: 10  DTRMLGMIPMVIEQSGRGERAYDIYSRLLKERIVFLVGPVMDQNANLIVAQLLFLESENP 69

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+ISLYINSPGG V+AGMAIYDTMQFIKP +ST C G AASMG+ LL+AGEKG RF+LP
Sbjct: 70  DKDISLYINSPGGSVSAGMAIYDTMQFIKPQVSTLCTGLAASMGAFLLAAGEKGKRFSLP 129

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+RI++HQPSGG  GQA+DIE HA++I+ ++ RLN I   N GK+ E+V +  +RD+ MS
Sbjct: 130 NSRIMIHQPSGGAQGQATDIEIHAREILYLRERLNGILADNTGKSIEQVARDTERDNFMS 189

Query: 192 ASEACDWGVVDKVLMSR 208
           A+EA D+G++D VL  R
Sbjct: 190 ANEAKDYGLIDDVLSKR 206


>gi|3318853|pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318854|pdb|1TYF|B Chain B, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318855|pdb|1TYF|C Chain C, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318856|pdb|1TYF|D Chain D, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318857|pdb|1TYF|E Chain E, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318858|pdb|1TYF|F Chain F, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318859|pdb|1TYF|G Chain G, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318860|pdb|1TYF|H Chain H, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318861|pdb|1TYF|I Chain I, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318862|pdb|1TYF|J Chain J, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318863|pdb|1TYF|K Chain K, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318864|pdb|1TYF|L Chain L, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318865|pdb|1TYF|M Chain M, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|3318866|pdb|1TYF|N Chain N, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 gi|93278456|pdb|1YG6|A Chain A, Clpp
 gi|93278457|pdb|1YG6|B Chain B, Clpp
 gi|93278458|pdb|1YG6|C Chain C, Clpp
 gi|93278459|pdb|1YG6|D Chain D, Clpp
 gi|93278460|pdb|1YG6|E Chain E, Clpp
 gi|93278461|pdb|1YG6|F Chain F, Clpp
 gi|93278462|pdb|1YG6|G Chain G, Clpp
 gi|93278463|pdb|1YG6|H Chain H, Clpp
 gi|93278464|pdb|1YG6|I Chain I, Clpp
 gi|93278465|pdb|1YG6|J Chain J, Clpp
 gi|93278466|pdb|1YG6|K Chain K, Clpp
 gi|93278467|pdb|1YG6|L Chain L, Clpp
 gi|93278468|pdb|1YG6|M Chain M, Clpp
 gi|93278469|pdb|1YG6|N Chain N, Clpp
 gi|109157730|pdb|2FZS|A Chain A, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157731|pdb|2FZS|B Chain B, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157732|pdb|2FZS|C Chain C, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157733|pdb|2FZS|D Chain D, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157734|pdb|2FZS|E Chain E, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157735|pdb|2FZS|F Chain F, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157736|pdb|2FZS|G Chain G, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157737|pdb|2FZS|H Chain H, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157738|pdb|2FZS|I Chain I, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157739|pdb|2FZS|J Chain J, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157740|pdb|2FZS|K Chain K, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157741|pdb|2FZS|L Chain L, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157742|pdb|2FZS|M Chain M, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 gi|109157743|pdb|2FZS|N Chain N, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
          Length = 193

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 125/193 (64%), Positives = 164/193 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 1   ALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 60

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R++
Sbjct: 61  LYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVM 120

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++E+  +RD  +SA EA 
Sbjct: 121 IHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAV 180

Query: 197 DWGVVDKVLMSRI 209
           ++G+VD +L  R 
Sbjct: 181 EYGLVDSILTHRN 193


>gi|254469734|ref|ZP_05083139.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudovibrio
           sp. JE062]
 gi|211961569|gb|EEA96764.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudovibrio
           sp. JE062]
          Length = 211

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 140/205 (68%), Positives = 176/205 (85%), Gaps = 1/205 (0%)

Query: 8   KKDSEDVF-LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             D  + F   LVPMVVEQTNRGER+YDI+SRLLKERI+F+TG +ED MATL+C+QLL+L
Sbjct: 1   MTDPVEYFTNSLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDTMATLVCSQLLYL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEI+LYINSPGGVVT+G+AIYDTMQFI+P IST C+GQAASMGSLLL+AGEKGM
Sbjct: 61  EAENPNKEIALYINSPGGVVTSGLAIYDTMQFIRPKISTLCIGQAASMGSLLLAAGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGGF GQA+DI  HAQ+I+K+KRRLNEIYV + G+T E VE+ L+R
Sbjct: 121 RFSLPNSRVMVHQPSGGFRGQAADIMLHAQEILKLKRRLNEIYVSHTGQTLEAVEEALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDI 211
           D+ MSA  A ++G++D V+ +R  +
Sbjct: 181 DNFMSADAAKEFGLIDNVIENRESL 205


>gi|70731346|ref|YP_261087.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens Pf-5]
 gi|110816462|sp|Q4K9J6|CLPP_PSEF5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|68345645|gb|AAY93251.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           fluorescens Pf-5]
          Length = 211

 Score =  241 bits (615), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 125/193 (64%), Positives = 159/193 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG  G RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAPGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G+T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDTNRDNFMSAEAAR 197

Query: 197 DWGVVDKVLMSRI 209
           ++G++D+V+  R 
Sbjct: 198 EYGLIDEVINQRP 210


>gi|254197976|ref|ZP_04904398.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei S13]
 gi|169654717|gb|EDS87410.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           pseudomallei S13]
          Length = 217

 Score =  241 bits (615), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 119/208 (57%), Positives = 156/208 (75%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ A
Sbjct: 10  TLASQAPRDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVA 69

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLLFLE+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL++
Sbjct: 70  QLLFLESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLAS 129

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G +G R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN +   + G+  E + 
Sbjct: 130 GARGKRYALPNARVMIHQPLGGARGQASDIEIQAREILYLRDRLNHLLAHHTGQDVERIA 189

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  DRD+ MS+ +A  +G++D V   R 
Sbjct: 190 RDTDRDNFMSSEDAKAYGLIDHVSTKRP 217


>gi|224824981|ref|ZP_03698087.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Lutiella
           nitroferrum 2002]
 gi|224602652|gb|EEG08829.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Lutiella
           nitroferrum 2002]
          Length = 207

 Score =  241 bits (615), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 126/201 (62%), Positives = 161/201 (80%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           +   LGLVPMVVEQ+ RGER+YDIYSRLLKERIVF+ G + D  A L+ AQ+LFLE+ENP
Sbjct: 6   DTQALGLVPMVVEQSGRGERAYDIYSRLLKERIVFLVGPVTDESANLVVAQMLFLESENP 65

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I  YINSPGG V+AGM+I+DTM FIKP +ST C+GQAASMG+ LLSAG KG RFALP
Sbjct: 66  DKDIYFYINSPGGSVSAGMSIFDTMNFIKPDVSTLCIGQAASMGAFLLSAGAKGKRFALP 125

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+RI++HQP GGF GQASD E HA++I+ +KRRLNE+   + G++ EE+E+  DRD+ MS
Sbjct: 126 NSRIMIHQPLGGFQGQASDFEIHAKNILYMKRRLNELLALHTGRSIEEIERDTDRDNFMS 185

Query: 192 ASEACDWGVVDKVLMSRIDIE 212
           + EA  +G++DK+L SR D +
Sbjct: 186 SEEALAYGLIDKMLQSRRDAQ 206


>gi|313906306|ref|ZP_07839649.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Eubacterium
           cellulosolvens 6]
 gi|313468862|gb|EFR64221.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Eubacterium
           cellulosolvens 6]
          Length = 193

 Score =  241 bits (615), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 114/193 (59%), Positives = 151/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQT RGERSYDIYSRLLK+RI+F+  ++ D  A L+ AQLLFLE+E+P K+I
Sbjct: 1   MPLIPYVIEQTGRGERSYDIYSRLLKDRIIFLGEEVNDVSANLVVAQLLFLESEDPSKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQ+IK  +ST C+G AASMG+ LL+ G KG R ALPNA I
Sbjct: 61  HLYINSPGGSVTAGMAIYDTMQYIKCDVSTICLGLAASMGAFLLAGGTKGKRLALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  G+ASDIE  A+ I+KIK+R+N I  +N G+TYE+V+   + D+ ++A EA
Sbjct: 121 MIHQPSGGAQGKASDIEIVAEQILKIKKRMNTILAENTGQTYEKVKADTELDNYLTAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D V+ +R
Sbjct: 181 KAYGIIDSVITNR 193


>gi|145628436|ref|ZP_01784237.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 22.1-21]
 gi|145633845|ref|ZP_01789567.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 3655]
 gi|145637965|ref|ZP_01793604.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittHH]
 gi|145639474|ref|ZP_01795079.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittII]
 gi|148826642|ref|YP_001291395.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittEE]
 gi|148827882|ref|YP_001292635.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittGG]
 gi|229845547|ref|ZP_04465675.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 6P18H1]
 gi|229847178|ref|ZP_04467282.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 7P49H1]
 gi|260583375|ref|ZP_05851146.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Haemophilus
           influenzae NT127]
 gi|319775445|ref|YP_004137933.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae F3047]
 gi|166201826|sp|A5UE11|CLPP_HAEIE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201827|sp|A5UHJ6|CLPP_HAEIG RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|144980211|gb|EDJ89870.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 22.1-21]
 gi|144985287|gb|EDJ92126.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 3655]
 gi|145268831|gb|EDK08795.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittHH]
 gi|145271521|gb|EDK11433.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittII]
 gi|148716802|gb|ABQ99012.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittEE]
 gi|148719124|gb|ABR00252.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittGG]
 gi|229809854|gb|EEP45576.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 7P49H1]
 gi|229811563|gb|EEP47264.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 6P18H1]
 gi|260093580|gb|EEW77497.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Haemophilus
           influenzae NT127]
 gi|309751687|gb|ADO81671.1| ATP-dependent Clp protease proteolytic subunit ClpP [Haemophilus
           influenzae R2866]
 gi|309973789|gb|ADO96990.1| ATP-dependent Clp protease proteolytic subunit ClpP [Haemophilus
           influenzae R2846]
 gi|317450036|emb|CBY86250.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae F3047]
          Length = 193

 Score =  241 bits (615), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LN+    + G++ E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQSIERIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 QAYGLVDEVLVKR 193


>gi|326795825|ref|YP_004313645.1| ATP-dependent Clp protease proteolytic subunit [Marinomonas
           mediterranea MMB-1]
 gi|326546589|gb|ADZ91809.1| ATP-dependent Clp protease proteolytic subunit [Marinomonas
           mediterranea MMB-1]
          Length = 210

 Score =  241 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 122/193 (63%), Positives = 156/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
            GLVPMV+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA L+ AQLLFLE+ENP K+I
Sbjct: 16  NGLVPMVIEQTARGERSFDIYSRLLKERVIFLVGQVEDHMANLVVAQLLFLESENPDKDI 75

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+LLL+AG  G R+ LPN+R+
Sbjct: 76  HLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGALLLTAGAAGKRYCLPNSRV 135

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQASDIE H ++I+ IK RLNEI   + G+  E+V +  DRD+ M+   A
Sbjct: 136 MIHQPLGGYQGQASDIEIHTREILSIKHRLNEIIAHHTGQPIEKVAEDTDRDNFMNPESA 195

Query: 196 CDWGVVDKVLMSR 208
            ++G++D +L  R
Sbjct: 196 KEYGLIDDILEKR 208


>gi|153871192|ref|ZP_02000426.1| Peptidase S14, ClpP [Beggiatoa sp. PS]
 gi|152072341|gb|EDN69573.1| Peptidase S14, ClpP [Beggiatoa sp. PS]
          Length = 228

 Score =  241 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 122/205 (59%), Positives = 164/205 (80%), Gaps = 5/205 (2%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+ A L+ AQLLFLE+ENP+K+I 
Sbjct: 21  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYTANLVVAQLLFLESENPEKDIH 80

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V+AG+AIYDTMQFIKP +ST C+GQAASMG+LLLS G    R+ LP++RI+
Sbjct: 81  LYINSPGGSVSAGLAIYDTMQFIKPDVSTLCIGQAASMGALLLSGGADKKRYCLPHSRIM 140

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQA+DI+ HA++I+K++ RLNEI  K+ G+  E+++K  +RD+ M+A  A 
Sbjct: 141 IHQPLGGFQGQATDIDIHAREILKVRERLNEILAKHSGQPLEKIQKDTERDNFMAAETAV 200

Query: 197 DWGVVDKVLMSR-----IDIEEKSK 216
           ++G+VD VL +R        EE++K
Sbjct: 201 EYGLVDAVLSTRHALTAAATEEQTK 225


>gi|20807119|ref|NP_622290.1| ATP-dependent Clp protease proteolytic subunit [Thermoanaerobacter
           tengcongensis MB4]
 gi|20515613|gb|AAM23894.1| Protease subunit of ATP-dependent Clp proteases [Thermoanaerobacter
           tengcongensis MB4]
          Length = 198

 Score =  241 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 108/197 (54%), Positives = 154/197 (78%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +F+ LVP+VVEQTNRGER+YDI+SRLLK+RIVF+  +I D  A+L+ AQ+LFLEAE+P K
Sbjct: 2   IFMSLVPIVVEQTNRGERAYDIFSRLLKDRIVFLGDEINDTTASLVIAQMLFLEAEDPDK 61

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I LYINSPGG +TAG+AIYDTMQ+IKP + T C+G AASM + LL+AG KG RFALPN+
Sbjct: 62  DIWLYINSPGGSITAGLAIYDTMQYIKPDVVTLCVGMAASMAAFLLAAGAKGKRFALPNS 121

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
            I++HQP GG  GQA+DI+ HA+ +++++ +L  I  +N G+  E+++  ++RD+ M+A 
Sbjct: 122 EIMIHQPWGGMQGQATDIKIHAERLLRLRDKLERILSENTGQPLEKIKADMERDYFMTAE 181

Query: 194 EACDWGVVDKVLMSRID 210
           EA  +G++D +L+    
Sbjct: 182 EAKTYGIIDDILVRHKK 198


>gi|71281884|ref|YP_270452.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Colwellia
           psychrerythraea 34H]
 gi|110816457|sp|Q47XL8|CLPP_COLP3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|71147624|gb|AAZ28097.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Colwellia
           psychrerythraea 34H]
          Length = 220

 Score =  241 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 126/195 (64%), Positives = 159/195 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
             LVPMVVEQT +GERSYDIYSRLLKER++F+ GQ+EDHMA LI AQLLFLE+E+P K+I
Sbjct: 25  SALVPMVVEQTAKGERSYDIYSRLLKERVIFLCGQVEDHMANLIIAQLLFLESESPDKDI 84

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTM+FIKP IST C+GQAASMG+ LLS GEKG R+ LPNAR+
Sbjct: 85  YLYINSPGGSVTAGMAIYDTMKFIKPNISTVCIGQAASMGAFLLSGGEKGKRYCLPNARV 144

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASD E HA++I+ IK +LN++  ++ G+T ++V +  DRD+ +SA  A
Sbjct: 145 MIHQPLGGFQGQASDFEIHAKEILFIKDKLNKLMAEHTGQTLDKVSQDTDRDNFLSAEAA 204

Query: 196 CDWGVVDKVLMSRID 210
            ++G+VD +L  R D
Sbjct: 205 VEYGLVDSILEQRND 219


>gi|33151467|ref|NP_872820.1| ATP-dependent Clp protease proteolytic subunit ClpP [Haemophilus
           ducreyi 35000HP]
 gi|60389738|sp|Q7VP78|CLPP_HAEDU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|33147687|gb|AAP95209.1| ATP-dependent Clp protease proteolytic subunit ClpP [Haemophilus
           ducreyi 35000HP]
          Length = 197

 Score =  241 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 122/196 (62%), Positives = 161/196 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT++GERSYDIYSRLLKERI+F+ G++EDHMA LI AQLLFLEAE+P+K+I
Sbjct: 1   MAVIPMVVEQTSKGERSYDIYSRLLKERIIFLNGEVEDHMANLIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQA SMG+ LLS G+KG RFALPNAR+
Sbjct: 61  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQACSMGAFLLSGGKKGKRFALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  AQ+I+K+K  L     ++ G+T+ +V    +RD+ MSA+EA
Sbjct: 121 MIHQPLGGARGQATDIQIQAQEILKLKEMLTRKMAEHSGQTFAKVAADTERDNFMSATEA 180

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G++DKVL SR ++
Sbjct: 181 KNYGLIDKVLTSRGEV 196


>gi|241204073|ref|YP_002975169.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857963|gb|ACS55630.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 209

 Score =  241 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 160/207 (77%), Positives = 186/207 (89%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLE
Sbjct: 1   MRNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGTVEDHMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRD
Sbjct: 121 FATPNSRIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEK 214
           H M A EA  WGV+DKVL SR+++E +
Sbjct: 181 HFMDADEAQSWGVIDKVLTSRLEMEGE 207


>gi|268592036|ref|ZP_06126257.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Providencia
           rettgeri DSM 1131]
 gi|291312428|gb|EFE52881.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Providencia
           rettgeri DSM 1131]
          Length = 206

 Score =  241 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 129/201 (64%), Positives = 167/201 (83%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            ++     + LVPMV+EQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI AQ+LFLE
Sbjct: 6   SQEQLASQMALVPMVIEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIVAQMLFLE 65

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG R
Sbjct: 66  AENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGTKGKR 125

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GG+ GQASDIE HAQ+I+K+K R+NE+   + GK+ EE+ +  +RD
Sbjct: 126 FCLPNSRVMIHQPLGGYQGQASDIEIHAQEILKVKSRMNELMALHTGKSIEEITRDTERD 185

Query: 188 HIMSASEACDWGVVDKVLMSR 208
             +SA+EA ++G+VD++  SR
Sbjct: 186 RFLSANEAKEYGLVDQIYSSR 206


>gi|238754235|ref|ZP_04615592.1| ATP-dependent Clp protease proteolytic subunit [Yersinia ruckeri
           ATCC 29473]
 gi|238707482|gb|EEP99842.1| ATP-dependent Clp protease proteolytic subunit [Yersinia ruckeri
           ATCC 29473]
          Length = 194

 Score =  241 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 128/194 (65%), Positives = 162/194 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIVAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 61  FLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+  K+ GK  EE+E+  +RD  +SA E+
Sbjct: 121 MIHQPLGGFQGQATDIEIHAREILKVKSRMNELMAKHTGKPLEEIERDTERDRFLSAEES 180

Query: 196 CDWGVVDKVLMSRI 209
             +G+VD +   R 
Sbjct: 181 VKYGLVDDIFNRRD 194


>gi|170760538|ref|YP_001788551.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A3 str. Loch Maree]
 gi|226706446|sp|B1L1D7|CLPP_CLOBM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|169407527|gb|ACA55938.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A3 str. Loch Maree]
          Length = 194

 Score =  241 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 116/194 (59%), Positives = 154/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+ ++ ++ D  A+LI AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GMAIYDTMQ+IKP +ST C+G AASMG+ LL AG KG R+ALPN+ +
Sbjct: 61  HLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLVAGAKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA+ I+K+K++LN I     GK  E+VE   +RDH +SA EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V+  + 
Sbjct: 181 KEYGLIDEVIDKKK 194


>gi|294083692|ref|YP_003550449.1| protease subunit of ATP-dependent Clp protease [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663264|gb|ADE38365.1| Protease subunit of ATP-dependent Clp protease [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 216

 Score =  241 bits (614), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 128/207 (61%), Positives = 172/207 (83%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           K + D    LVPMVVEQTNRGERSYDI+SRLLKERI+F+ G ++D  A+L+C+QLLFLE+
Sbjct: 8   KSNFDPMANLVPMVVEQTNRGERSYDIFSRLLKERIIFLNGPVDDTTASLVCSQLLFLES 67

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP K+IS+YINSPGG+VT+G+AIYDTM++I+P +ST CMGQAASMGSLLL AG  G R+
Sbjct: 68  ENPTKDISMYINSPGGIVTSGLAIYDTMEYIRPDVSTVCMGQAASMGSLLLMAGAAGKRY 127

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           +LPNARI+ HQPSGGFSGQASDIE HA++I+ +++RLN +YVK+ GKT ++VEK ++RD 
Sbjct: 128 SLPNARIMTHQPSGGFSGQASDIEIHAREILDLRKRLNGMYVKHTGKTLKDVEKIMERDT 187

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKS 215
            M+A +A  +G++D+V+  R   +++ 
Sbjct: 188 FMTAEDAQKFGLIDEVVEKRPAGKDEK 214


>gi|299143348|ref|ZP_07036428.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Peptoniphilus
           sp. oral taxon 386 str. F0131]
 gi|298517833|gb|EFI41572.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Peptoniphilus
           sp. oral taxon 386 str. F0131]
          Length = 194

 Score =  241 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 116/194 (59%), Positives = 153/194 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTN GERSYDIYSRLLKERI+F++G+I D  A L+ AQLLFLEAE+  K+I
Sbjct: 1   MALVPMVVEQTNHGERSYDIYSRLLKERIIFLSGEINDVTADLVVAQLLFLEAEDQNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG V+AG AIYDT+++IK  +ST  +G AASMG+ LL+AG KG RFALPNA I
Sbjct: 61  QIYINSPGGSVSAGFAIYDTIKYIKCDVSTMVIGLAASMGAFLLAAGTKGKRFALPNADI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI+ HA+ I++I+ R+N+I  +  G+  E+VE+  DRD+ +SA EA
Sbjct: 121 MIHQPLGGAQGQASDIKIHAEKILEIRERINKILSEETGQPLEKVERDTDRDYYLSAKEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++DKV+  R 
Sbjct: 181 VEYGLIDKVIEKRD 194


>gi|60416366|sp|Q8RC25|CLPP_THETN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 195

 Score =  241 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 107/195 (54%), Positives = 152/195 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGER+YDI+SRLLK+RIVF+  +I D  A+L+ AQ+LFLEAE+P K+I
Sbjct: 1   MSLVPIVVEQTNRGERAYDIFSRLLKDRIVFLGDEINDTTASLVIAQMLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAG+AIYDTMQ+IKP + T C+G AASM + LL+AG KG RFALPN+ I
Sbjct: 61  WLYINSPGGSITAGLAIYDTMQYIKPDVVTLCVGMAASMAAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA+ +++++ +L  I  +N G+  E+++  ++RD+ M+A EA
Sbjct: 121 MIHQPWGGMQGQATDIKIHAERLLRLRDKLERILSENTGQPLEKIKADMERDYFMTAEEA 180

Query: 196 CDWGVVDKVLMSRID 210
             +G++D +L+    
Sbjct: 181 KTYGIIDDILVRHKK 195


>gi|311107153|ref|YP_003980006.1| ATP-dependent Clp protease proteolytic subunit ClpP [Achromobacter
           xylosoxidans A8]
 gi|310761842|gb|ADP17291.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Achromobacter
           xylosoxidans A8]
          Length = 217

 Score =  241 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 117/195 (60%), Positives = 154/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDATANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V AGMAI+DTMQF+KP +ST C G AASMG+ LL+AG+KG RF LPN+RI
Sbjct: 82  SLYINSPGGSVYAGMAIFDTMQFVKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I  +N G+T E +    +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILDLRERLNRILAENTGQTMERIGIDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSRID 210
             +G+VDKV+ SR +
Sbjct: 202 VSYGLVDKVMTSRSE 216


>gi|188581623|ref|YP_001925068.1| ATP-dependent Clp protease proteolytic subunit [Methylobacterium
           populi BJ001]
 gi|226706462|sp|B1Z9C7|CLPP_METPB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|179345121|gb|ACB80533.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Methylobacterium populi BJ001]
          Length = 208

 Score =  241 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 131/204 (64%), Positives = 170/204 (83%), Gaps = 1/204 (0%)

Query: 8   KKDSEDVF-LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  D F   LVPMVVEQ++RGER++DIYSRLL+ERI+F+TG +ED  A+LI AQLLFL
Sbjct: 1   MRDPVDYFHNSLVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDQGASLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+KEIS YINSPGGVVT+G++IYDTMQFI+ P++T C+GQAASMGSLLL+AGE G 
Sbjct: 61  EAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVTTLCVGQAASMGSLLLAAGEAGH 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPNARI++HQPSGGF GQA+DI  HA++I  +K+RLNEIYVK+ G+ YE + + L+R
Sbjct: 121 RFALPNARIMVHQPSGGFQGQATDILIHAREIEALKKRLNEIYVKHTGRDYETIHQALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRID 210
           D+ M+A  A ++G++D +L  R +
Sbjct: 181 DNFMTADAAKEFGLIDDILHKRPE 204


>gi|148381180|ref|YP_001255721.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A str. ATCC 3502]
 gi|153933152|ref|YP_001385555.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A str. ATCC 19397]
 gi|153934525|ref|YP_001388961.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A str. Hall]
 gi|153939192|ref|YP_001392582.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum F str. Langeland]
 gi|168179119|ref|ZP_02613783.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum NCTC 2916]
 gi|168183548|ref|ZP_02618212.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum Bf]
 gi|170754567|ref|YP_001782870.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum B1 str. Okra]
 gi|226950659|ref|YP_002805750.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A2 str. Kyoto]
 gi|237796687|ref|YP_002864239.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum Ba4 str. 657]
 gi|166201814|sp|A7FYI2|CLPP_CLOB1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201815|sp|A5I6W1|CLPP_CLOBH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201816|sp|A7GIH2|CLPP_CLOBL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706445|sp|B1IND7|CLPP_CLOBK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763786|sp|C1FLA6|CLPP_CLOBJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|148290664|emb|CAL84793.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           botulinum A str. ATCC 3502]
 gi|152929196|gb|ABS34696.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A str. ATCC 19397]
 gi|152930439|gb|ABS35938.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A str. Hall]
 gi|152935088|gb|ABS40586.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum F str. Langeland]
 gi|169119779|gb|ACA43615.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum B1 str. Okra]
 gi|182670165|gb|EDT82141.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum NCTC 2916]
 gi|182673367|gb|EDT85328.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum Bf]
 gi|226842960|gb|ACO85626.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum A2 str. Kyoto]
 gi|229261301|gb|ACQ52334.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum Ba4 str. 657]
 gi|295320566|gb|ADG00944.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum F str. 230613]
 gi|322807545|emb|CBZ05120.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           botulinum H04402 065]
          Length = 194

 Score =  241 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 116/194 (59%), Positives = 155/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+ ++ ++ D  A+LI AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG R+ALPN+ +
Sbjct: 61  HLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA+ I+K+K++LN I     GK  E+VE   +RDH +SA EA
Sbjct: 121 MIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V+  + 
Sbjct: 181 KEYGLIDEVIDKKK 194


>gi|17546430|ref|NP_519832.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia
           solanacearum GMI1000]
 gi|83745913|ref|ZP_00942970.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia
           solanacearum UW551]
 gi|207724193|ref|YP_002254591.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase
           clp) protein [Ralstonia solanacearum MolK2]
 gi|207743049|ref|YP_002259441.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase
           clp) protein [Ralstonia solanacearum IPO1609]
 gi|300691404|ref|YP_003752399.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Ralstonia solanacearum PSI07]
 gi|300703972|ref|YP_003745574.1| proteolytic subunit of clpa-clpp ATP-dependent serine protease
           [Ralstonia solanacearum CFBP2957]
 gi|22653696|sp|Q8XYP7|CLPP_RALSO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|17428728|emb|CAD15413.1| probable atp-atp-dependent clp protease proteolytic subunit
           (endopeptidase clp). transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|83727603|gb|EAP74724.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia
           solanacearum UW551]
 gi|206589403|emb|CAQ36365.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase
           clp) protein [Ralstonia solanacearum MolK2]
 gi|206594446|emb|CAQ61373.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase
           clp) protein [Ralstonia solanacearum IPO1609]
 gi|299066731|emb|CBJ37925.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Ralstonia solanacearum CMR15]
 gi|299071635|emb|CBJ42959.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Ralstonia solanacearum CFBP2957]
 gi|299078464|emb|CBJ51116.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Ralstonia solanacearum PSI07]
          Length = 217

 Score =  241 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 117/193 (60%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 23  LGLVPMVVEQSGRGERAYDIYSRLLKERVIFMVGEVNDQTANLVVAQLLFLESENPDKDI 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AG+A+YDTMQF+KP +ST CMG AASMG+ LL+AG KG R+ALPN+RI
Sbjct: 83  SLYINSPGGSVSAGLAMYDTMQFVKPDVSTLCMGMAASMGAFLLAAGAKGKRYALPNSRI 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN I  +  G+  +++ +  DRD+ MS  +A
Sbjct: 143 MIHQPLGGARGQASDIEIQAREILYLRERLNTILSEVTGQPVDKIARDTDRDNFMSGDQA 202

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKVL  R
Sbjct: 203 KEYGLIDKVLARR 215


>gi|238795542|ref|ZP_04639057.1| ATP-dependent Clp protease proteolytic subunit [Yersinia mollaretii
           ATCC 43969]
 gi|238720661|gb|EEQ12462.1| ATP-dependent Clp protease proteolytic subunit [Yersinia mollaretii
           ATCC 43969]
          Length = 194

 Score =  241 bits (614), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 129/194 (66%), Positives = 162/194 (83%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI AQ+LFLEAENP+K+I
Sbjct: 1   MALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+AG KG RF LPN+R+
Sbjct: 61  FLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLTAGAKGKRFCLPNSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DIE HA++I+K+K R+NE+   + GK+ EE+E+  +RD  +SA EA
Sbjct: 121 MIHQPLGGFQGQATDIEIHAREILKVKSRMNELMALHTGKSLEEIERDTERDRFLSAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G+VD V   R 
Sbjct: 181 VGYGLVDSVFTRRD 194


>gi|114569888|ref|YP_756568.1| ATP-dependent Clp protease proteolytic subunit ClpP [Maricaulis
           maris MCS10]
 gi|122316141|sp|Q0AQ07|CLPP_MARMM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|114340350|gb|ABI65630.1| ATP-dependent Clp protease proteolytic subunit ClpP [Maricaulis
           maris MCS10]
          Length = 211

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 147/207 (71%), Positives = 179/207 (86%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D +DV + LVP+VVEQT+RGERS+DIYSRLLKERI+F+TG IEDHMA+LI AQLLFLE
Sbjct: 1   MHDPQDVMMNLVPIVVEQTSRGERSFDIYSRLLKERIIFITGPIEDHMASLIIAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP+KEIS+YINSPGGVV+AG+ IYDTMQ+I+ P+ST C+G AASMGSLLL+AGEK MR
Sbjct: 61  SENPKKEISMYINSPGGVVSAGLGIYDTMQYIRSPVSTMCLGMAASMGSLLLTAGEKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PNARI++HQPSGGF GQASDIERHA DI KIKRRLNEIYV + G+TY+E+E  LDRD
Sbjct: 121 FAAPNARIMVHQPSGGFRGQASDIERHAADIQKIKRRLNEIYVHHTGRTYDEIESALDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEK 214
           + MSA E  ++G+VDKV+  R + E++
Sbjct: 181 NFMSAQEGLEFGLVDKVIERRAEDEKE 207


>gi|315644534|ref|ZP_07897666.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           vortex V453]
 gi|315280041|gb|EFU43338.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           vortex V453]
          Length = 198

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 110/192 (57%), Positives = 149/192 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  +PMVVEQ+NRGER+YDIYSRLLK+RI+F+   + D +A  I AQ+LFL AE+P+K+I
Sbjct: 1   MSFIPMVVEQSNRGERAYDIYSRLLKDRIIFLGSDVNDVVANSIIAQMLFLSAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAI+DTMQFIKP +ST C+G AASMG+ LL+AG KG R+ LPN+ I
Sbjct: 61  HLYINSPGGSITAGMAIFDTMQFIKPDVSTICVGMAASMGAFLLNAGAKGKRYGLPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE  A+ I+K++ +LN I     G+  E +EK  DRD+ M+A EA
Sbjct: 121 MIHQPLGGAQGQATDIEIRARRILKMRDKLNRILSDRTGQPLERIEKDTDRDYFMTADEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+VL +
Sbjct: 181 KEYGLIDQVLEN 192


>gi|86357224|ref|YP_469116.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli CFN
           42]
 gi|190891272|ref|YP_001977814.1| endopeptidase Clp protein, subunit 2 [Rhizobium etli CIAT 652]
 gi|209548850|ref|YP_002280767.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|116243117|sp|Q2K9U7|CLPP2_RHIEC RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|86281326|gb|ABC90389.1| endopeptidase Clp, subunit 2 protein [Rhizobium etli CFN 42]
 gi|190696551|gb|ACE90636.1| endopeptidase Clp protein, subunit 2 [Rhizobium etli CIAT 652]
 gi|209534606|gb|ACI54541.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|327188463|gb|EGE55677.1| ATP-dependent Clp protease proteolytic subunit [Rhizobium etli
           CNPAF512]
          Length = 209

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 160/207 (77%), Positives = 186/207 (89%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            ++  D  + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLE
Sbjct: 1   MRNPVDTAMALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGAVEDHMATLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEI+LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MR
Sbjct: 61  AENPKKEIALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FA PN+RI++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRD
Sbjct: 121 FATPNSRIMVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEK 214
           H M A EA  WGV+DKVL SR+++E +
Sbjct: 181 HFMDADEAQGWGVIDKVLTSRLEMEGE 207


>gi|83589392|ref|YP_429401.1| ATP-dependent Clp protease proteolytic subunit [Moorella
           thermoacetica ATCC 39073]
 gi|115311785|sp|Q2RL31|CLPP_MOOTA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|83572306|gb|ABC18858.1| ATP-dependent Clp protease proteolytic subunit ClpP [Moorella
           thermoacetica ATCC 39073]
          Length = 199

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 115/195 (58%), Positives = 152/195 (77%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQT+RGER+YDIYSRLLK+RI+F+   I+DH+A L+ AQ+LFLEAE+P K+
Sbjct: 1   MSVLVPMVVEQTSRGERAYDIYSRLLKDRIIFLGSAIDDHVANLVIAQMLFLEAEDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGG ++AGMAI+DTMQ+I+P +ST C+G AASMG+ LL+AG KG RFALPN+ 
Sbjct: 61  IHLYINSPGGSISAGMAIFDTMQYIRPDVSTICVGLAASMGAFLLAAGAKGKRFALPNSE 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQA DIE HA+ I+ I+  LN I  +  GK  E++ +  DRDH M+A E
Sbjct: 121 IMIHQPMGGTQGQAVDIEIHAKRILAIRDNLNRILSEITGKPLEQIARDTDRDHFMTARE 180

Query: 195 ACDWGVVDKVLMSRI 209
           A ++G++D+V+  R 
Sbjct: 181 AREYGLIDEVITKRE 195


>gi|197117660|ref|YP_002138087.1| ATP-dependent Clp protease proteolytic subunit [Geobacter
           bemidjiensis Bem]
 gi|226706452|sp|B5EI27|CLPP_GEOBB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|197087020|gb|ACH38291.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter
           bemidjiensis Bem]
          Length = 199

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 115/190 (60%), Positives = 156/190 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+D++A L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGGIDDNVANLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTM++IK P+ST C+GQAASMG+ LLS GEKG R++L N+RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMRYIKAPVSTICVGQAASMGAFLLSGGEKGKRYSLVNSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HA++I+++K +LN +  ++ G++ E+V    +RD+ MS  EA +
Sbjct: 122 HQPLGGFQGQATDIHIHAKEILRMKDQLNALLAEHTGQSVEKVAADTERDYFMSGEEAKN 181

Query: 198 WGVVDKVLMS 207
           +G++D ++  
Sbjct: 182 YGIIDAIVTR 191


>gi|163743918|ref|ZP_02151288.1| Protease subunit of ATP-dependent Clp protease [Phaeobacter
           gallaeciensis 2.10]
 gi|161382763|gb|EDQ07162.1| Protease subunit of ATP-dependent Clp protease [Phaeobacter
           gallaeciensis 2.10]
          Length = 202

 Score =  240 bits (613), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 125/201 (62%), Positives = 170/201 (84%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KE
Sbjct: 1   MNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKE 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           IS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R
Sbjct: 61  ISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           +++HQPSGGF GQA+DI  HA++ +K+K+RLNEIYVK+ G+ Y+++   L+RD+ MS  E
Sbjct: 121 VMVHQPSGGFQGQATDIMIHAEETLKLKKRLNEIYVKHTGQEYDKIVDALERDNFMSPEE 180

Query: 195 ACDWGVVDKVLMSRIDIEEKS 215
           A D+G++D+++ +R  ++++ 
Sbjct: 181 AKDFGLIDEIVENRSKLDDQD 201


>gi|258514515|ref|YP_003190737.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257778220|gb|ACV62114.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 194

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 120/194 (61%), Positives = 158/194 (81%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVP+VVEQTNRGERSYDIYSRLLK+RI+F+ G IED+ A LI AQLLFLEAE+P+K+
Sbjct: 1   MSTLVPIVVEQTNRGERSYDIYSRLLKDRIIFIGGPIEDYTANLIIAQLLFLEAEDPEKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGGVVTAGMAIYDTMQ+IKPP+ST C+GQAASMGS LL+AG  G RFALP AR
Sbjct: 61  IHLYINSPGGVVTAGMAIYDTMQYIKPPVSTICLGQAASMGSFLLAAGAPGKRFALPYAR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQPSGG  GQA+DI  HA++I+++K  LN++  K+  +  +++ +  +RD  MSA +
Sbjct: 121 IMIHQPSGGMQGQATDIGIHAKEILRMKEILNKLLSKHTKQPLDKITRDSERDFFMSAED 180

Query: 195 ACDWGVVDKVLMSR 208
           A ++G++D+++  +
Sbjct: 181 AKEYGIIDQIVTRK 194


>gi|145642383|ref|ZP_01797943.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae R3021]
 gi|145272926|gb|EDK12812.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 22.4-21]
          Length = 193

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 123/193 (63%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIK  I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKSDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LN+    + G++ E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQSIERIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 QAYGLVDEVLVKR 193


>gi|292487467|ref|YP_003530339.1| ATP-dependent Clp protease proteolytic subunit ClpP [Erwinia
           amylovora CFBP1430]
 gi|292898709|ref|YP_003538078.1| ATP-dependent clp protease proteolytic subunit [Erwinia amylovora
           ATCC 49946]
 gi|291198557|emb|CBJ45665.1| ATP-dependent clp protease proteolytic subunit [Erwinia amylovora
           ATCC 49946]
 gi|291552886|emb|CBA19931.1| ATP-dependent Clp protease proteolytic subunit clpP [Erwinia
           amylovora CFBP1430]
 gi|312171571|emb|CBX79829.1| ATP-dependent Clp protease proteolytic subunit clpP [Erwinia
           amylovora ATCC BAA-2158]
          Length = 207

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 171/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSG--ERELTAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 59  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+K K+ +NE+  K+ G+T E +
Sbjct: 119 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIDIHAREIIKTKQMMNELMAKHTGQTIENI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASE+ ++G+VD VL  R 
Sbjct: 179 ERDTNRDRFLSASESVEYGLVDSVLSQRN 207


>gi|253579815|ref|ZP_04857083.1| clp protease [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848814|gb|EES76776.1| clp protease [Ruminococcus sp. 5_1_39BFAA]
          Length = 193

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 114/193 (59%), Positives = 148/193 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A LI +QLLFLEAE+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVNDVSAGLIVSQLLFLEAEDPGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQ+IK  +ST C+G AASMG+ LL+ G KG RFALP++ I
Sbjct: 61  QLYINSPGGSVTAGMAIYDTMQYIKCDVSTICLGMAASMGAFLLAGGAKGKRFALPHSTI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A  I + KR LNE+   N G+  E VE+  DRD+ M+A EA
Sbjct: 121 MIHQPSGGAQGQATEIQIVADHIAQTKRTLNELLAANTGQPIEVVERDTDRDNYMTAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D V+M +
Sbjct: 181 KAYGLIDGVVMHK 193


>gi|253701609|ref|YP_003022798.1| ATP-dependent Clp protease proteolytic subunit [Geobacter sp. M21]
 gi|259585955|sp|C6E2T0|CLPP_GEOSM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|251776459|gb|ACT19040.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter sp.
           M21]
          Length = 199

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 115/190 (60%), Positives = 155/190 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+D++A L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGGIDDNVANLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTM++IK P+ST C+GQAASMG+ LLS GEKG R++L N+RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMRYIKAPVSTICVGQAASMGAFLLSGGEKGKRYSLVNSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HA++I+++K  LN +  ++ G++ E+V    +RD+ MS  EA +
Sbjct: 122 HQPLGGFQGQATDIHIHAKEILRMKDELNALLAEHTGQSVEKVAADTERDYFMSGEEAKN 181

Query: 198 WGVVDKVLMS 207
           +G++D ++  
Sbjct: 182 YGIIDAIVTR 191


>gi|186475312|ref|YP_001856782.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           phymatum STM815]
 gi|184191771|gb|ACC69736.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           phymatum STM815]
          Length = 217

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 114/203 (56%), Positives = 152/203 (74%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
              +    LVP V+EQ+ RGER+YDIYSRLL+ERIVF+ G + D  A+LI AQLLFLE+E
Sbjct: 7   SPANTGFNLVPTVIEQSGRGERAYDIYSRLLRERIVFLVGPVNDQSASLIVAQLLFLESE 66

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+IS YINSPGG V  G+AI+DTMQFIKP +ST C G AASMG+ LL+AG  G R+A
Sbjct: 67  NPDKDISFYINSPGGSVYDGLAIFDTMQFIKPDVSTLCTGFAASMGTFLLAAGAPGKRYA 126

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNARI++HQPSGG  G ASD+E HA++++ ++ RLN++  +  G++  ++EK  DRD+ 
Sbjct: 127 LPNARIMIHQPSGGGQGTASDVEIHAKEVLYLRERLNDVLAQRTGQSIAQIEKDTDRDNF 186

Query: 190 MSASEACDWGVVDKVLMSRIDIE 212
           MSA  A  +G+VD VL +R+ + 
Sbjct: 187 MSAEAAKTYGLVDDVLTTRVPLP 209


>gi|39996891|ref|NP_952842.1| ATP-dependent Clp protease proteolytic subunit [Geobacter
           sulfurreducens PCA]
 gi|60389697|sp|Q74C82|CLPP_GEOSL RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|39983779|gb|AAR35169.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter
           sulfurreducens PCA]
 gi|298505904|gb|ADI84627.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter
           sulfurreducens KN400]
          Length = 199

 Score =  240 bits (613), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 122/192 (63%), Positives = 159/192 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G ++DH+A L+ AQ+LFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGPVDDHVANLVIAQMLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVT+GMAIYDTMQ+IK P+ST C+GQAASMG+LLLS GEKG RF+L ++RI++
Sbjct: 62  YINSPGGVVTSGMAIYDTMQYIKAPVSTICVGQAASMGALLLSGGEKGKRFSLKHSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HAQ+I+K+K+RLNEI  +N G+   +VE   +RD+ MS +EA D
Sbjct: 122 HQPLGGFQGQATDIHIHAQEILKLKKRLNEILAENTGQQLAKVEADTERDYFMSGAEAKD 181

Query: 198 WGVVDKVLMSRI 209
           +G++D ++    
Sbjct: 182 YGIIDNIIERNT 193


>gi|303239032|ref|ZP_07325562.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acetivibrio
           cellulolyticus CD2]
 gi|302593370|gb|EFL63088.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Acetivibrio
           cellulolyticus CD2]
          Length = 194

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 112/194 (57%), Positives = 150/194 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDI+SRLLK+RI+ ++ ++ D  A+L+ AQ+LFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIFSRLLKDRIILLSDEVNDVTASLVVAQMLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG AIYDTMQ++KP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  QLYINSPGGSVSAGFAIYDTMQYVKPDVSTICIGMAASMGAFLLNAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++I+ HA+ I+K + RLN I  +  G+  E++E   +RD  MSA EA
Sbjct: 121 MIHQPLGGTRGQATEIKIHAEHILKTRDRLNRILSEKTGQPLEKIEADTERDFFMSAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G+VD V+  R 
Sbjct: 181 KAYGLVDDVMERRK 194


>gi|86137328|ref|ZP_01055905.1| Protease subunit of ATP-dependent Clp protease [Roseobacter sp.
           MED193]
 gi|85825663|gb|EAQ45861.1| Protease subunit of ATP-dependent Clp protease [Roseobacter sp.
           MED193]
          Length = 202

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 125/201 (62%), Positives = 167/201 (83%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KE
Sbjct: 1   MNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKE 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           IS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R
Sbjct: 61  ISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           +++HQPSGGF GQA+DI  HA++ +K+KRRLNEIYVK+ G+  ++VE  L+RD+ M   E
Sbjct: 121 VMVHQPSGGFQGQATDIMIHAEETLKLKRRLNEIYVKHTGQELDKVEAALERDNFMDPEE 180

Query: 195 ACDWGVVDKVLMSRIDIEEKS 215
           A  +G++D+++ +R   +++ 
Sbjct: 181 AKAFGLIDEIVENRAKGDDEE 201


>gi|218133242|ref|ZP_03462046.1| hypothetical protein BACPEC_01107 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992115|gb|EEC58119.1| hypothetical protein BACPEC_01107 [Bacteroides pectinophilus ATCC
           43243]
          Length = 193

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 110/193 (56%), Positives = 145/193 (75%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A+LI AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVTDVSASLIVAQLLFLESEDPGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGG VTAGMAIYDTM ++K  +ST C+G AASMG+ LLS G KG R ALPNA I
Sbjct: 61  NFYINSPGGSVTAGMAIYDTMNYVKCDVSTICIGMAASMGAFLLSGGTKGKRLALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI+  +  I+K + +LN I   N GK  + +    +RD+ MSA EA
Sbjct: 121 MIHQPSGGAQGQATDIKIVSDHIIKTRHKLNTILAANTGKPLDVIAVDTERDNYMSAQEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D V+  R
Sbjct: 181 VEYGLIDSVIEKR 193


>gi|121611285|ref|YP_999092.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Verminephrobacter eiseniae EF01-2]
 gi|166214720|sp|A1WR17|CLPP_VEREI RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|121555925|gb|ABM60074.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Verminephrobacter eiseniae EF01-2]
          Length = 202

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 112/202 (55%), Positives = 156/202 (77%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
               E   LG++PMV+EQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ AQLLFLE
Sbjct: 1   MNALETQGLGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDQTANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+IS YINSPGG V+AGMAI+DTM FIKP +ST C G AASMG+ LL+AG KG R
Sbjct: 61  SENPDKDISFYINSPGGSVSAGMAIFDTMNFIKPDVSTLCTGMAASMGAFLLAAGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPN+++++HQP GG  GQA++IE HA++I+K + +LN+I  +  G+  E++++  +RD
Sbjct: 121 FALPNSKVMIHQPLGGMQGQATEIEIHAREILKTREQLNKILAERTGQPLEKIQRDTERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + +SA E+ ++G+VD+V+  R 
Sbjct: 181 YFLSADESREYGLVDQVIHRRS 202


>gi|187925164|ref|YP_001896806.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           phytofirmans PsJN]
 gi|187716358|gb|ACD17582.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           phytofirmans PsJN]
          Length = 215

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 112/206 (54%), Positives = 151/206 (73%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
                     LGLVP V+EQ+ RGER+YDIYSRLL+ERIVF+ G + +  A+LI AQLLF
Sbjct: 1   MHSNYPNITGLGLVPTVIEQSGRGERAYDIYSRLLRERIVFLVGPVNEQSASLIVAQLLF 60

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP K+I  YINSPGG V  G+AIYDTMQFIKP +ST C G AASMG+ LL+AG++G
Sbjct: 61  LESENPDKDICFYINSPGGSVYDGLAIYDTMQFIKPEVSTLCTGFAASMGTFLLTAGQRG 120

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            R+ALPNARI++HQPSGG  G A+D+E  A++++ ++ RLN +  +  G++ E + +  D
Sbjct: 121 KRYALPNARIMIHQPSGGSQGTAADVEIQAKEVLYLRERLNAMMAERTGRSIEAIARDTD 180

Query: 186 RDHIMSASEACDWGVVDKVLMSRIDI 211
           RD+ MSA  A  +G+VD+VL +R  +
Sbjct: 181 RDNFMSAQSAKTYGLVDEVLETRAAL 206


>gi|315645729|ref|ZP_07898853.1| hypothetical protein PVOR_09635 [Paenibacillus vortex V453]
 gi|315279207|gb|EFU42517.1| hypothetical protein PVOR_09635 [Paenibacillus vortex V453]
          Length = 196

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 120/192 (62%), Positives = 153/192 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDIYSRLLK+RI+F++  I+D +A L+ AQLLFL AE+P+K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIYSRLLKDRIIFLSSAIDDDVANLVIAQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGM IYDTMQ IKP +ST C+G AASMGSLLL+AG  G R+AL N+ +
Sbjct: 61  SLYINSPGGSVTAGMGIYDTMQLIKPDVSTICVGMAASMGSLLLTAGAPGKRYALENSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI+ HA  I+K + +LN+IYV+  G+  E++E+  DRD  MSA EA
Sbjct: 121 MIHQPLGGIQGQASDIQIHADWIIKTRHKLNQIYVERTGQPLEKIERDTDRDFFMSAEEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++D VL S
Sbjct: 181 KAYGIIDDVLSS 192


>gi|120554758|ref|YP_959109.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Marinobacter
           aquaeolei VT8]
 gi|120324607|gb|ABM18922.1| ATP-dependent Clp protease proteolytic subunit ClpP [Marinobacter
           aquaeolei VT8]
          Length = 211

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 112/197 (56%), Positives = 156/197 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
            GLVP+V+EQT RGERS+DIYSRLLKER++F+ G +EDHMA L+ AQLLFLE+ENP K+I
Sbjct: 15  SGLVPIVIEQTARGERSFDIYSRLLKERVIFLVGPVEDHMANLVVAQLLFLESENPDKDI 74

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AGM+IYDTMQF+KP ++T C+GQAASMG+ LLS G KG R  LP++R+
Sbjct: 75  HLYINSPGGSVSAGMSIYDTMQFVKPDVATLCIGQAASMGAFLLSGGAKGKRACLPHSRV 134

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQA+DIE H ++I+KI+  LNE+  ++ G+  E + +  DRD+ M  ++A
Sbjct: 135 MIHQPLGGYQGQATDIEIHTREILKIRNTLNELLAEHTGQDIETIARDTDRDNFMDPAQA 194

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D +L  R+  +
Sbjct: 195 KEYGLIDTILDKRVSNK 211


>gi|254467045|ref|ZP_05080456.1| Clp protease [Rhodobacterales bacterium Y4I]
 gi|206687953|gb|EDZ48435.1| Clp protease [Rhodobacterales bacterium Y4I]
          Length = 202

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 128/200 (64%), Positives = 168/200 (84%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQT+RGER+YDI+SRLLKERI+FV G + D M++LI AQLL LEAENP KE
Sbjct: 1   MNTLVPMVVEQTSRGERAYDIFSRLLKERIIFVNGPVHDGMSSLIVAQLLHLEAENPSKE 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           IS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGEKGMRF+LPN+R
Sbjct: 61  ISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEKGMRFSLPNSR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           +++HQPSGGF GQA+DI  HA++ +K+K+RLNEIYVK+ G+ YE V   L+RD+ MS  E
Sbjct: 121 VMVHQPSGGFQGQATDIMIHAEETLKLKKRLNEIYVKHTGQDYETVVNALERDNFMSPEE 180

Query: 195 ACDWGVVDKVLMSRIDIEEK 214
           A  +G++D+++ +R   +++
Sbjct: 181 AKAFGLIDEIVENRAKGDDE 200


>gi|254282219|ref|ZP_04957187.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium NOR51-B]
 gi|219678422|gb|EED34771.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium NOR51-B]
          Length = 220

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 125/216 (57%), Positives = 165/216 (76%), Gaps = 3/216 (1%)

Query: 2   SFEGCAKKDSED---VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATL 58
           S E    +D+       LGLVPMV+EQT+RGERS+DIYSRLLKER++FV G IEDHMA L
Sbjct: 5   SIEKAMIRDTSPGDIQNLGLVPMVIEQTSRGERSFDIYSRLLKERVIFVVGGIEDHMANL 64

Query: 59  ICAQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLL 118
           I AQLLFLE+ENP K+I +YINSPGG VTAG++IYDTMQF+KP +ST C+GQAASMG+ L
Sbjct: 65  IVAQLLFLESENPDKDIHIYINSPGGSVTAGLSIYDTMQFVKPDVSTMCIGQAASMGAFL 124

Query: 119 LSAGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYE 178
           LS G KG R+ LPNAR ++HQPSGG  GQASDIE  A++I+ ++ RLN +   + G+T E
Sbjct: 125 LSGGAKGKRYILPNARTMIHQPSGGAQGQASDIEIQAKEILYLRERLNRLMADHTGQTLE 184

Query: 179 EVEKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEK 214
            +E+  +RD  MSA ++ ++G+VD+V+ +R+   + 
Sbjct: 185 TIERDTERDRFMSAEQSVEYGLVDEVVENRVAAPDA 220


>gi|330808572|ref|YP_004353034.1| endopeptidase Clp (ATP-dependent Clp protease proteolytic subunit
           ClpP) [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327376680|gb|AEA68030.1| endopeptidase Clp (ATP-dependent Clp protease proteolytic subunit
           ClpP) [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 211

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 123/193 (63%), Positives = 159/193 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG  G R+ LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAHGKRYCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G+T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDTNRDNFMSAEAAR 197

Query: 197 DWGVVDKVLMSRI 209
           ++G++D+V+  R 
Sbjct: 198 EYGLIDEVINQRP 210


>gi|254468869|ref|ZP_05082275.1| ATP-dependent Clp protease, proteolytic subunit ClpP [beta
           proteobacterium KB13]
 gi|207087679|gb|EDZ64962.1| ATP-dependent Clp protease, proteolytic subunit ClpP [beta
           proteobacterium KB13]
          Length = 207

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 125/201 (62%), Positives = 158/201 (78%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            + +  V LG +PMVVEQ+ RGERSYDIYSRLLKER+VF+ G ++D  A L+ AQLLFLE
Sbjct: 7   SRSNTPVGLGYIPMVVEQSGRGERSYDIYSRLLKERVVFLVGPVDDMTANLVVAQLLFLE 66

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP K+ISLYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+LLL+AG K  R
Sbjct: 67  AENPDKDISLYINSPGGSVTAGMAIYDTMQFIKPDVSTLCIGQAASMGALLLTAGAKDKR 126

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GGF GQASDIE HA++I+ +K +LN I   + G+  + + K  DRD
Sbjct: 127 FCLPNSRVMIHQPLGGFQGQASDIEIHAKEILYLKDKLNRILSHHTGQDIKTISKDTDRD 186

Query: 188 HIMSASEACDWGVVDKVLMSR 208
           + MS+ +A  +G+VDKV+  R
Sbjct: 187 NFMSSEDAVKYGLVDKVINER 207


>gi|94310823|ref|YP_584033.1| ATP-dependent Clp protease proteolytic subunit [Cupriavidus
           metallidurans CH34]
 gi|116243154|sp|Q1LM62|CLPP_RALME RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|93354675|gb|ABF08764.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Cupriavidus metallidurans CH34]
          Length = 216

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 119/194 (61%), Positives = 153/194 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K++
Sbjct: 23  LGLVPMVVEQSGRGERAYDIYSRLLKERVVFMVGEVNDQTANLVVAQLLFLESENPDKDV 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AG+AIYDTMQFIKP + T CMG AASMG+ LL+AG KG R ALPN+RI
Sbjct: 83  SLYINSPGGSVSAGLAIYDTMQFIKPDVQTLCMGMAASMGAFLLAAGAKGKRSALPNSRI 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN I  +  G+  E++ +  DRD+ MS  +A
Sbjct: 143 MIHQPLGGARGQASDIEIQAREILYLRERLNSILSEVTGQPVEKIARDTDRDNFMSGDQA 202

Query: 196 CDWGVVDKVLMSRI 209
            D+G++DKV+  R 
Sbjct: 203 VDYGLIDKVITRRS 216


>gi|75676090|ref|YP_318511.1| peptidase S14, ClpP [Nitrobacter winogradskyi Nb-255]
 gi|90101410|sp|Q3SRD2|CLPP_NITWN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|74420960|gb|ABA05159.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrobacter
           winogradskyi Nb-255]
          Length = 212

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 139/209 (66%), Positives = 176/209 (84%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  + ++ LVPMVVEQTNRGER+YDI+SRLLKERI+FVTG +ED+M+ L+ AQLLFLE
Sbjct: 1   MRDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFVTGGVEDNMSMLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGGVVT+G+AIYDTMQFI+PP++T C GQAASMGSLLL+AGEK MR
Sbjct: 61  AENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVATLCTGQAASMGSLLLAAGEKDMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
            ALPNARI++HQPSGGF GQA+DI  HAQ+I+ +K+RLNEIYVK+ G+TY+ +E  L+RD
Sbjct: 121 HALPNARIMVHQPSGGFQGQATDIMLHAQEILSLKKRLNEIYVKHTGQTYQAIEDALERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
             ++A  A D+G+VDKV+  R +     K
Sbjct: 181 KFLTADMARDFGIVDKVIDKRAEDPAAPK 209


>gi|52082006|ref|YP_080797.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           licheniformis ATCC 14580]
 gi|52787393|ref|YP_093222.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           licheniformis ATCC 14580]
 gi|319647870|ref|ZP_08002088.1| ATP-dependent Clp protease proteolytic subunit 1 [Bacillus sp.
           BT1B_CT2]
 gi|67460468|sp|Q65EI5|CLPP1_BACLD RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|52005217|gb|AAU25159.1| ATP-dependent Clp protease proteolytic subunit (class III
           heat-shock protein) [Bacillus licheniformis ATCC 14580]
 gi|52349895|gb|AAU42529.1| ClpP [Bacillus licheniformis ATCC 14580]
 gi|317390211|gb|EFV71020.1| ATP-dependent Clp protease proteolytic subunit 1 [Bacillus sp.
           BT1B_CT2]
          Length = 198

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 112/198 (56%), Positives = 156/198 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLEAE+P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG +TAGMAIYDTMQFIKP +ST C G AASMG+ LL+AGEKG R+ALPN+ +
Sbjct: 61  SIYINSPGGSITAGMAIYDTMQFIKPQVSTICTGMAASMGAFLLAAGEKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN+I  +  G+  E +E+  DRD+  +A EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILSLRDKLNKILAERTGQPLEVIERDTDRDNFKTAEEA 180

Query: 196 CDWGVVDKVLMSRIDIEE 213
            ++G++DKVL   ID ++
Sbjct: 181 KEYGLIDKVLTRNIDAQK 198


>gi|319408364|emb|CBI82017.1| ATP-dependent Clp protease, proteolytic subunit [Bartonella
           schoenbuchensis R1]
          Length = 210

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 148/208 (71%), Positives = 178/208 (85%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D     L LVPMVVEQTNRGER+YDI+SRLLKERI+F+ G +ED MA L+CAQLLFLE
Sbjct: 1   MSDPIKTALNLVPMVVEQTNRGERAYDIFSRLLKERIIFINGPVEDGMAMLVCAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEISLYINSPGGVVT+GMAIYDTMQFI+PP+ST CMGQAASMGSLLL+AG KG R
Sbjct: 61  AENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPVSTLCMGQAASMGSLLLTAGAKGHR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPNARI++HQPSGGF GQ SDIERHAQDI+K+K+RLNEIYV++ G+ YE +EKTLDRD
Sbjct: 121 FSLPNARIMVHQPSGGFQGQVSDIERHAQDIIKMKQRLNEIYVQHTGQDYEIIEKTLDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKS 215
           H M+A E+ ++G++D V+  R   E++ 
Sbjct: 181 HFMTAEESKNFGLIDDVIQYRTVTEKEE 208


>gi|255067667|ref|ZP_05319522.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           sicca ATCC 29256]
 gi|255048141|gb|EET43605.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           sicca ATCC 29256]
          Length = 206

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 120/197 (60%), Positives = 156/197 (79%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPNVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 128

Query: 138 HQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 189 KEYGLIDQVLENRASLQ 205


>gi|229827570|ref|ZP_04453639.1| hypothetical protein GCWU000182_02959 [Abiotrophia defectiva ATCC
           49176]
 gi|229788208|gb|EEP24322.1| hypothetical protein GCWU000182_02959 [Abiotrophia defectiva ATCC
           49176]
          Length = 194

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 112/194 (57%), Positives = 151/194 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLL++RI+F+  ++ D  A++I AQLLFLEAE+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLEDRIIFLGEEVTDVSASVIIAQLLFLEAEDPSKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTM +IK  +ST CMG AASMG+ LL+ G KG R ALPN+ I
Sbjct: 61  HLYINSPGGSVTAGMAIYDTMNYIKCDVSTICMGLAASMGAFLLAGGTKGKRLALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A +I+K ++RLNE+   N G+  E++E+  +RD+ M+A EA
Sbjct: 121 MIHQPSGGARGQASDIKIVADNIIKTRKRLNEMLAANTGRPLEDIERDTERDNFMTAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G++D+++  R 
Sbjct: 181 KAYGLIDEIVTKRA 194


>gi|261405359|ref|YP_003241600.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           sp. Y412MC10]
 gi|329923469|ref|ZP_08278950.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Paenibacillus sp. HGF5]
 gi|261281822|gb|ACX63793.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Paenibacillus
           sp. Y412MC10]
 gi|328941269|gb|EGG37564.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Paenibacillus sp. HGF5]
          Length = 196

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 120/192 (62%), Positives = 154/192 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDIYSRLLK+RI+F++  I+D +A L+ AQLLFL AE+P+K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIYSRLLKDRIIFLSSAIDDDVANLVIAQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGM IYDTMQ IKP +ST C+G AASMGSLLL+AG  G R+AL N+ +
Sbjct: 61  SLYINSPGGSVTAGMGIYDTMQLIKPDVSTICVGMAASMGSLLLTAGAPGKRYALENSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDI+ HA  I+K +++LN+IYV+  G+  E++E+  DRD  MSA EA
Sbjct: 121 MIHQPLGGIQGQASDIQIHADWIIKTRQKLNQIYVERTGQPLEKIERDTDRDFFMSAEEA 180

Query: 196 CDWGVVDKVLMS 207
             +G++D VL S
Sbjct: 181 KAYGIIDDVLSS 192


>gi|187776850|ref|ZP_02993323.1| hypothetical protein CLOSPO_00389 [Clostridium sporogenes ATCC
           15579]
 gi|187775509|gb|EDU39311.1| hypothetical protein CLOSPO_00389 [Clostridium sporogenes ATCC
           15579]
          Length = 194

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 116/194 (59%), Positives = 155/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RI+ ++ ++ D  A+LI AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+GMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG R+ALPN+ +
Sbjct: 61  YLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA+ I+K+K++LN I     GK  E+VE   +RDH +SA EA
Sbjct: 121 MIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V+  + 
Sbjct: 181 KEYGLIDEVIDKKK 194


>gi|84499432|ref|ZP_00997720.1| Protease subunit of ATP-dependent Clp protease [Oceanicola
           batsensis HTCC2597]
 gi|84392576|gb|EAQ04787.1| Protease subunit of ATP-dependent Clp protease [Oceanicola
           batsensis HTCC2597]
          Length = 210

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 125/209 (59%), Positives = 162/209 (77%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
                E+    LVPMVVEQT+RGER+YDI+SRLLKERI+FV+G + D M++LI AQLL L
Sbjct: 1   MSDLYENYMNNLVPMVVEQTSRGERAYDIFSRLLKERIIFVSGPVHDGMSSLIVAQLLHL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP K+IS+YINSPGGVVT+G++IYDTMQ+IKP + T  +GQAASMGSLLL+ G  GM
Sbjct: 61  EAENPTKDISMYINSPGGVVTSGLSIYDTMQYIKPKVGTLVIGQAASMGSLLLAGGAAGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ALPNA I++HQPSGG+ GQA+DI  HA+   K+K RLN+IYVK+ G+ +E V   L+R
Sbjct: 121 RYALPNAEIMVHQPSGGYRGQATDIMIHARHTEKLKERLNKIYVKHTGQDFETVVDALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ M+A EA DWG++D++  SR   +   
Sbjct: 181 DNFMTAEEAKDWGLIDEIFESRPKADGDD 209


>gi|289577854|ref|YP_003476481.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Thermoanaerobacter italicus Ab9]
 gi|297544142|ref|YP_003676444.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|289527567|gb|ADD01919.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter italicus Ab9]
 gi|296841917|gb|ADH60433.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 195

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 111/194 (57%), Positives = 150/194 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDI+SRLLK+RIVF+  +I D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPIVVEQTNRGERSYDIFSRLLKDRIVFLGEEINDTTASLVIAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAG AIYDTMQ+IKP + T C+G AASM + LL+AG KG RFALPN+ I
Sbjct: 61  WLYINSPGGSITAGFAIYDTMQYIKPDVVTLCVGMAASMAAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA+ I+K++ +L+ I  +N G+  E+++   +RD  M A +A
Sbjct: 121 MIHQPLGGMHGQATDIKIHAERILKLRDKLDRILAENTGQPIEKIKADTERDFFMDAEDA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G++D+VL+   
Sbjct: 181 KAYGIIDEVLIRNK 194


>gi|160893842|ref|ZP_02074625.1| hypothetical protein CLOL250_01396 [Clostridium sp. L2-50]
 gi|156864494|gb|EDO57925.1| hypothetical protein CLOL250_01396 [Clostridium sp. L2-50]
          Length = 193

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 114/193 (59%), Positives = 149/193 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A+++ AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVNDTSASIVIAQLLFLESEDPSKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAG+ IYDTMQ+IK  +ST C G AASMG+ LL+ G KG RFALPNA I
Sbjct: 61  SLYINSPGGSVTAGLGIYDTMQYIKCDVSTICCGMAASMGAFLLAGGAKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++IE  A+ I+K K +LN +  +N GK YE +    +RD+ MSA EA
Sbjct: 121 MIHQPSGGSQGQATEIEIAAKHILKTKEKLNRMLSENTGKPYETIAADTERDNWMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
           C +G++D V+  R
Sbjct: 181 CAYGLIDSVIAKR 193


>gi|78223080|ref|YP_384827.1| ATP-dependent Clp protease proteolytic subunit [Geobacter
           metallireducens GS-15]
 gi|90101408|sp|Q39UH2|CLPP_GEOMG RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|78194335|gb|ABB32102.1| ATP-dependent Clp protease proteolytic subunit ClpP [Geobacter
           metallireducens GS-15]
          Length = 199

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 125/192 (65%), Positives = 159/192 (82%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+DH+A L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGPIDDHVANLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTMQ+IK P+ST C+GQAASMG+LLLS GEKG RF+L ++RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMQYIKAPVSTICVGQAASMGALLLSGGEKGKRFSLTHSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HAQ+I+K+K+RLNEI  +N G+  E+VE   +RD+ MS  EA  
Sbjct: 122 HQPLGGFQGQATDIHIHAQEILKMKKRLNEIIAENSGQALEKVEADTERDYFMSGEEAKS 181

Query: 198 WGVVDKVLMSRI 209
           +G++D ++  + 
Sbjct: 182 YGIIDAIIARKP 193


>gi|85713354|ref|ZP_01044368.1| Protease subunit of ATP-dependent Clp protease [Idiomarina baltica
           OS145]
 gi|85692821|gb|EAQ30805.1| Protease subunit of ATP-dependent Clp protease [Idiomarina baltica
           OS145]
          Length = 205

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 128/204 (62%), Positives = 161/204 (78%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
              D +D    LVPMVVEQT++GERSYDIYSRLLKER++F  GQ+EDHMA LI AQLLFL
Sbjct: 1   MSNDIQDPMAQLVPMVVEQTSKGERSYDIYSRLLKERVIFCCGQVEDHMANLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E++NP K+I LYINSPGGVVTAGMAIYDTM+FIKP +ST CMGQAASMG+ LL+ G +G 
Sbjct: 61  ESDNPDKDIYLYINSPGGVVTAGMAIYDTMRFIKPDVSTVCMGQAASMGAFLLAGGAQGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ LPN+R+++HQP GGF GQASD E HA+ I+ +K RLN +  +N G+ YE+V +  DR
Sbjct: 121 RYCLPNSRVMIHQPLGGFQGQASDFEIHAKQILDLKERLNRMLAENTGQDYEKVARDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRID 210
           DH ++A EA D+G+VD +L  R +
Sbjct: 181 DHFLTAPEAVDYGLVDGILNKRGE 204


>gi|88800033|ref|ZP_01115603.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Reinekea sp.
           MED297]
 gi|88777159|gb|EAR08364.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Reinekea sp.
           MED297]
          Length = 209

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 126/192 (65%), Positives = 164/192 (85%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQT+RGERS+DIYSRLLKE ++F+ GQ+ED+MA L+ AQLLFLE+ENP K+I 
Sbjct: 18  GLVPMVVEQTSRGERSFDIYSRLLKENVIFLVGQVEDYMANLVVAQLLFLESENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+LLL+ G KG R+ LPN+R++
Sbjct: 78  LYINSPGGSVTAGMAIYDTMQFIKPDVSTMCIGQAASMGALLLTGGAKGKRYCLPNSRMM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++I+++KRRLNEI   + G+  E+VE+  DRD+ M+A +A 
Sbjct: 138 IHQPLGGYQGQATDIEIHAREILEMKRRLNEIMAHHTGRPLEDVERDTDRDNFMTAEQAV 197

Query: 197 DWGVVDKVLMSR 208
           D+G+VD+V+ +R
Sbjct: 198 DYGLVDQVITNR 209


>gi|167746334|ref|ZP_02418461.1| hypothetical protein ANACAC_01043 [Anaerostipes caccae DSM 14662]
 gi|317470744|ref|ZP_07930129.1| Clp protease [Anaerostipes sp. 3_2_56FAA]
 gi|167654327|gb|EDR98456.1| hypothetical protein ANACAC_01043 [Anaerostipes caccae DSM 14662]
 gi|316901879|gb|EFV23808.1| Clp protease [Anaerostipes sp. 3_2_56FAA]
          Length = 196

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 117/195 (60%), Positives = 151/195 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A+LI +QLLFLEAE+P+K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVTDVSASLIVSQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGMAIYDTM FIK  +ST CMG AASMGS LLS G KG R ALPNA I
Sbjct: 61  SLYINSPGGSVTAGMAIYDTMNFIKCDVSTICMGMAASMGSFLLSGGAKGKRMALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++I+  A+ I++ K+RLN I  +N GK  E +E+  DRD+ ++A EA
Sbjct: 121 MIHQPMGGAQGQATEIQIAAEHILQTKKRLNRILSENTGKPLEVIERDTDRDNWLTAEEA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D V   + +
Sbjct: 181 VEYGLIDAVFDKKRE 195


>gi|285017388|ref|YP_003375099.1| ATP-dependent clp protease proteolytic subunit protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472606|emb|CBA15111.1| probable atp-dependent clp protease proteolytic subunit protein
           [Xanthomonas albilineans]
          Length = 208

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 124/201 (61%), Positives = 166/201 (82%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D+    L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+DHMA ++ AQLLFLEA+
Sbjct: 2   DNVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVVVAQLLFLEAD 61

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+K+ISLYINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+A
Sbjct: 62  NPEKDISLYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYA 121

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQA+DI+ HA++I+ ++ RLNE+  K+ G++ E + +  +RD+ 
Sbjct: 122 LPNSRVMIHQPLGGFQGQATDIDIHAREILTLRARLNEVLAKHTGQSLETIARDTERDNF 181

Query: 190 MSASEACDWGVVDKVLMSRID 210
            SA +A  +G+VD+VL  R D
Sbjct: 182 KSAIDAQAYGLVDQVLERRPD 202


>gi|253996690|ref|YP_003048754.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylotenera
           mobilis JLW8]
 gi|253983369|gb|ACT48227.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylotenera
           mobilis JLW8]
          Length = 214

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 120/209 (57%), Positives = 165/209 (78%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
             +  A+ +     LG +PMV+EQ+ RGERS+DIYSRLLKER++F+ G + D  A L+ A
Sbjct: 4   HLQPQAQSELITTGLGYIPMVIEQSGRGERSFDIYSRLLKERVIFLVGPVNDMSANLVVA 63

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLLFLEAENP K+ISLYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+ LL+A
Sbjct: 64  QLLFLEAENPDKDISLYINSPGGSVTAGMSIYDTMQFIKPDVSTLCIGQAASMGAFLLAA 123

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G K  R++LPN+RI++HQPSGGF GQ+SDIE HA++I+ ++ +LN+I   + G+T EE++
Sbjct: 124 GAKDKRYSLPNSRIMIHQPSGGFQGQSSDIEIHAKEILYLRAKLNDILAHHTGRTAEEID 183

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRID 210
           +  +RD+ MSA ++  +G++DKV+ SR +
Sbjct: 184 RDTERDNFMSAEQSVAYGLIDKVIGSRNE 212


>gi|78485521|ref|YP_391446.1| ATP-dependent Clp protease proteolytic subunit [Thiomicrospira
           crunogena XCL-2]
 gi|110816468|sp|Q31GF1|CLPP_THICR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|78363807|gb|ABB41772.1| ATP-dependent Clp protease proteolytic subunit ClpP [Thiomicrospira
           crunogena XCL-2]
          Length = 200

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 131/192 (68%), Positives = 162/192 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMV+EQT+RGERS+DIYSRLLKER++F+ GQ+EDHMA LI AQLLFLE+ENP K+I 
Sbjct: 9   ALVPMVIEQTSRGERSFDIYSRLLKERVIFLVGQVEDHMANLIVAQLLFLESENPDKDIH 68

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTM+FIKP +ST C+GQAASMGS LLSAG +G R+ALPN+R++
Sbjct: 69  LYINSPGGSVTAGMAIYDTMRFIKPDVSTMCIGQAASMGSFLLSAGAEGKRYALPNSRVM 128

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I++IK++LN+    + G+  E +E   DRD+ MSA EAC
Sbjct: 129 IHQPLGGFQGQASDIEIHAKEIIQIKQKLNKALADHTGQPIEVIENDTDRDNFMSADEAC 188

Query: 197 DWGVVDKVLMSR 208
           D+G+VDKVL  R
Sbjct: 189 DYGLVDKVLTRR 200


>gi|167038050|ref|YP_001665628.1| ATP-dependent Clp protease proteolytic subunit [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167040915|ref|YP_001663900.1| ATP-dependent Clp protease proteolytic subunit [Thermoanaerobacter
           sp. X514]
 gi|256752437|ref|ZP_05493296.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914951|ref|ZP_07132267.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter sp. X561]
 gi|307723815|ref|YP_003903566.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter sp. X513]
 gi|320116459|ref|YP_004186618.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|226706551|sp|B0KBA4|CLPP_THEP3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706552|sp|B0K533|CLPP_THEPX RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166855155|gb|ABY93564.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter sp. X514]
 gi|166856884|gb|ABY95292.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256748706|gb|EEU61751.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889886|gb|EFK85032.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter sp. X561]
 gi|307580876|gb|ADN54275.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter sp. X513]
 gi|319929550|gb|ADV80235.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 195

 Score =  240 bits (612), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 111/194 (57%), Positives = 151/194 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDI+SRLLK+RIVF+  +I D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPIVVEQTNRGERSYDIFSRLLKDRIVFLGEEINDTTASLVIAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAG AIYDTMQ+IKP + T C+G AASM + LL+AG KG RFALPN+ I
Sbjct: 61  WLYINSPGGSITAGFAIYDTMQYIKPDVVTLCVGMAASMAAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA+ I+K++ +L++I  +N G+  E+++   +RD  M A +A
Sbjct: 121 MIHQPLGGMQGQATDIKIHAERILKLRDKLDKILAENTGQPIEKIKADTERDFFMDAEDA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G++D+VL+   
Sbjct: 181 KAYGIIDEVLIRNK 194


>gi|255565556|ref|XP_002523768.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus
           communis]
 gi|223536980|gb|EEF38617.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus
           communis]
          Length = 296

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 111/193 (57%), Positives = 153/193 (79%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E ++RGER+YDI+SRLLKERIV + G I D  A ++ AQLLFLE+ENP K I 
Sbjct: 86  GLVPMVIEHSSRGERAYDIFSRLLKERIVCINGPINDDTAHVVVAQLLFLESENPSKPIH 145

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +Y+NSPGG VTAG+AIYDTMQ+I+ PI+T C+GQAASM SLLL+AG KG R +LPNA I+
Sbjct: 146 MYLNSPGGQVTAGLAIYDTMQYIRSPINTICLGQAASMASLLLAAGAKGERKSLPNATIM 205

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG+SGQA D+  H + IV++   LN++Y K+ G++ + ++K +DRD+ M+  EA 
Sbjct: 206 IHQPSGGYSGQAKDMTIHTKQIVRVWDSLNQLYSKHTGQSVDVIQKNMDRDYFMTPEEAK 265

Query: 197 DWGVVDKVLMSRI 209
           ++G++D+V+  R 
Sbjct: 266 EFGIIDEVIDQRP 278


>gi|160878535|ref|YP_001557503.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           phytofermentans ISDg]
 gi|160427201|gb|ABX40764.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           phytofermentans ISDg]
          Length = 193

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 120/193 (62%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A++I AQLLFLEAE+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVTDVSASVIVAQLLFLEAEDPGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGMAIYDTM +IK  +ST C+G AASMG+ LL+ G KG RFALPNA +
Sbjct: 61  SLYINSPGGSVTAGMAIYDTMNYIKCDVSTICIGMAASMGAFLLAGGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI+  A++I+KIK++LN I  +N GK  E VE   +RD+ MSA EA
Sbjct: 121 MIHQPSGGAKGQATDIQIVAENILKIKKKLNTILSENTGKPLEVVEVDTERDYYMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D V+ SR
Sbjct: 181 KNYGIIDSVIASR 193


>gi|220927143|ref|YP_002502445.1| ATP-dependent Clp protease proteolytic subunit [Methylobacterium
           nodulans ORS 2060]
 gi|254763797|sp|B8IN26|CLPP_METNO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|219951750|gb|ACL62142.1| peptidase S14 ClpP [Methylobacterium nodulans ORS 2060]
          Length = 209

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 132/204 (64%), Positives = 172/204 (84%), Gaps = 1/204 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  + +   LVPMVVEQ++RGER++DIYSRLL+ERI+F+TG +ED+ A+LI AQLLFL
Sbjct: 1   MRDPVEFYNSALVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDYSASLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+KEIS YINSPGGVVT+G++IYDTMQFI+ P++T C+GQAASMGSLLL+AGE G 
Sbjct: 61  EAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVATLCVGQAASMGSLLLAAGEPGH 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPNARI++HQPSGGF GQA+DI  HA++I  +KRRLNEIYVK+ G+ Y+ +E  L+R
Sbjct: 121 RFALPNARIMVHQPSGGFQGQATDILIHAREIEALKRRLNEIYVKHTGRDYDTIELGLER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRID 210
           D+ M+A  A +WG++D+VL  R +
Sbjct: 181 DNFMTADAAREWGLIDEVLQKRAE 204


>gi|302878843|ref|YP_003847407.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Gallionella
           capsiferriformans ES-2]
 gi|302581632|gb|ADL55643.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Gallionella
           capsiferriformans ES-2]
          Length = 202

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 123/199 (61%), Positives = 163/199 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           + E   +G++PMVVE + RGER+YDIYSRLLKER+VF+ G++ DH A LI AQ+LFLE+E
Sbjct: 3   NLEPQNIGMIPMVVETSGRGERAYDIYSRLLKERVVFLVGEVNDHSANLIVAQMLFLESE 62

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I  YINSPGG VTAGMAIYDTMQFIKP +ST C+GQAASMG+ LL+AGEKG RFA
Sbjct: 63  NPDKDIHFYINSPGGSVTAGMAIYDTMQFIKPAVSTLCIGQAASMGAFLLTAGEKGKRFA 122

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQASDIE HA++I+ +K++LN++   + G+T E +E+  DRD+ 
Sbjct: 123 LPNSRVMIHQPLGGFRGQASDIEIHAREILYLKQKLNQMLADHTGQTVEAIERDTDRDNF 182

Query: 190 MSASEACDWGVVDKVLMSR 208
           +SA++A  +G+VD+VL  R
Sbjct: 183 LSAADAVAYGLVDQVLEKR 201


>gi|194098886|ref|YP_002001950.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae NCCP11945]
 gi|193934176|gb|ACF30000.1| putative endopeptidase [Neisseria gonorrhoeae NCCP11945]
 gi|317164458|gb|ADV07999.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 209

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 122/208 (58%), Positives = 157/208 (75%), Gaps = 2/208 (0%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            K D       LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFL
Sbjct: 1   MKGDEMSFDNHLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I  YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG 
Sbjct: 61  ESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGK 120

Query: 127 RFALPNARILLHQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL 184
           RFALPN+RI++HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  
Sbjct: 121 RFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDT 180

Query: 185 DRDHIMSASEACDWGVVDKVLMSRIDIE 212
           DRD+ MSA EA ++G++D+VL +R  + 
Sbjct: 181 DRDNFMSAEEAKEYGLIDQVLENRASLR 208


>gi|332172903|gb|AEE22157.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 212

 Score =  239 bits (611), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 127/209 (60%), Positives = 160/209 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
                 D    LVPMVVEQT +GERSYDIYSRLLKE ++F+ GQ+EDHMA LI AQ+LFL
Sbjct: 1   MMNTPFDPTNALVPMVVEQTAKGERSYDIYSRLLKENVIFMVGQVEDHMANLIVAQMLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+K+I LYINSPGG VTAGMAIYDTM FIKP +ST C+GQAASMG+ LLS G KG 
Sbjct: 61  EAENPEKDIFLYINSPGGSVTAGMAIYDTMNFIKPDVSTVCIGQAASMGAFLLSGGTKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ LPNAR+++HQP GGF GQASD E HA++I+ IK ++N +  ++ G+ YE+V +  DR
Sbjct: 121 RYCLPNARVMIHQPLGGFQGQASDFEIHAKEILSIKEKMNRLMAEHTGQDYEKVARDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ +SA E+ D+G+VD+VL +R D     
Sbjct: 181 DNFLSAQESVDYGLVDQVLANRPDASSSD 209


>gi|172039352|ref|YP_001805853.1| ATP-dependent Clp protease proteolytic subunit [Cyanothece sp. ATCC
           51142]
 gi|171700806|gb|ACB53787.1| ATP-dependent Clp protease, proteolytic subunit [Cyanothece sp.
           ATCC 51142]
          Length = 229

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 110/213 (51%), Positives = 154/213 (72%), Gaps = 4/213 (1%)

Query: 4   EGCAKKDSEDVFL---GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
              + K   +++     +VPMVVEQ+  GER++DIYSRLL+ERIVF+   ++D +A  I 
Sbjct: 9   HTISSKRPSEIYATAKNVVPMVVEQSGVGERAFDIYSRLLRERIVFLGTPVDDQVADSIV 68

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFL+AE+P+K+I LYINSPGG V AG+AIYDTMQ I+P + T C G AASMG+ LLS
Sbjct: 69  AQLLFLDAEDPEKDIQLYINSPGGSVYAGLAIYDTMQQIRPDVVTICFGLAASMGAFLLS 128

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G KG R ALP++RI++HQP GG  GQA +IE  A++I+ IK+RLN++  ++ G+  E +
Sbjct: 129 GGAKGKRMALPSSRIMIHQPLGGAQGQAVEIEIQAKEILYIKKRLNDMLAEHTGQPLETI 188

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEE 213
               +RD  MSA EA D+G++D+V+ SR D+ +
Sbjct: 189 AADTERDFFMSAQEAVDYGLIDQVI-SRPDLSD 220


>gi|291563765|emb|CBL42581.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [butyrate-producing bacterium SS3/4]
          Length = 193

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 107/191 (56%), Positives = 148/191 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+E T+RGERSYDIYSRLLK+RI+F+  ++ D  A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVLESTSRGERSYDIYSRLLKDRIIFLGEEVNDVTASLVVAQLLFLESEDPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGG VTAGMAIYDTM +IK  + T C+G AASMG+ LLS+G KG RFALPNA +
Sbjct: 61  NLYINSPGGSVTAGMAIYDTMNYIKCDVCTTCIGMAASMGAFLLSSGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A+ I+K K +LN+I   N G+  + + +  +RD+ M+A EA
Sbjct: 121 MIHQPSGGAQGQATEIKIVAEQILKTKEKLNKILAANTGQPLDVIARDTERDNYMTAEEA 180

Query: 196 CDWGVVDKVLM 206
             +G++D+V+ 
Sbjct: 181 AAYGLIDRVIS 191


>gi|238919011|ref|YP_002932525.1| ATP-dependent Clp protease, proteolytic subunit ClpP, putative
           [Edwardsiella ictaluri 93-146]
 gi|259585951|sp|C5BCJ6|CLPP_EDWI9 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|238868579|gb|ACR68290.1| ATP-dependent Clp protease, proteolytic subunit ClpP, putative
           [Edwardsiella ictaluri 93-146]
          Length = 206

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 130/209 (62%), Positives = 165/209 (78%), Gaps = 3/209 (1%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+    +       + LVPMVVEQT+RGERSYDI+SRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 1   MSYSDQRELAP---HMALVPMVVEQTSRGERSYDIFSRLLKERIIFLTGQVEDHMANLIV 57

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMGS LL+
Sbjct: 58  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGSFLLA 117

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG +G RF LPN+R+++HQP GGF GQA+DIE HA++I+ IK R+N +  K+ G+  E +
Sbjct: 118 AGAQGKRFCLPNSRVMIHQPLGGFQGQATDIEIHAKEILSIKARMNTLMAKHSGQPIEVI 177

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  MSA +A ++G+VD VL  R 
Sbjct: 178 ERDTERDRFMSAQDAVEYGLVDAVLTQRA 206


>gi|28211967|ref|NP_782911.1| ATP-dependent Clp protease proteolytic subunit [Clostridium tetani
           E88]
 gi|28204410|gb|AAO36848.1| ATP-dependent clp protease proteolytic subunit [Clostridium tetani
           E88]
          Length = 202

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 118/202 (58%), Positives = 158/202 (78%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
               E+ F+ LVP+VVEQTNRGERSYDIYSRLLK+RI+ ++ Q+ D  A+LI AQLLFLE
Sbjct: 1   MNYKEEKFMSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSDQVNDVTASLIVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AE+P K+I LYINSPGG +T+GMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG R
Sbjct: 61  AEDPDKDIFLYINSPGGSITSGMAIYDTMQYIKPDVSTICIGMAASMGAFLLAAGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPN+ I++HQP GGF GQA+DI  HA  I+KIK+ LN I  +  G+  E +++  +RD
Sbjct: 121 FALPNSEIMIHQPLGGFQGQATDIGIHADRILKIKQNLNSILSEKTGQPLEVIQRDTERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + M A++A D+G++D+V++ + 
Sbjct: 181 NFMDANQAKDYGLIDEVMVKKK 202


>gi|218779308|ref|YP_002430626.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfatibacillum alkenivorans AK-01]
 gi|259585946|sp|B8FA62|CLPP_DESAA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|218760692|gb|ACL03158.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfatibacillum alkenivorans AK-01]
          Length = 201

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 114/201 (56%), Positives = 159/201 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  +P VVEQT+RGER+YDIYSRLLK+RI+F+  ++ D +A  I AQLLFLE+++P+K+I
Sbjct: 1   MSYIPYVVEQTSRGERTYDIYSRLLKDRIIFLGTEVNDVVANSIIAQLLFLESDDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGG VTAGMAIYDTM +IKP I+T C+GQAASMG++LL+AG  G R++LPNARI
Sbjct: 61  NFYINSPGGSVTAGMAIYDTMAYIKPEITTVCIGQAASMGAVLLAAGNHGKRYSLPNARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           L+HQP GGF GQASDI   AQ+I+++K  LNEI   + GK  ++V++  DRD+ MS  EA
Sbjct: 121 LIHQPMGGFQGQASDIAIQAQEILRMKEALNEILASHTGKPLKQVQQDTDRDYFMSPLEA 180

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
            ++G++D V+++R D++   +
Sbjct: 181 KEYGLIDHVILNREDLDSIEE 201


>gi|90021255|ref|YP_527082.1| ATP-dependent Clp protease proteolytic subunit [Saccharophagus
           degradans 2-40]
 gi|116243165|sp|Q21KA9|CLPP_SACD2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|89950855|gb|ABD80870.1| ATP-dependent Clp protease proteolytic subunit ClpP [Saccharophagus
           degradans 2-40]
          Length = 212

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 126/193 (65%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
             LVPMVVEQT RGERSYDIYSRLLKER++F+ GQ+EDHMA L+ AQ+LFLEAENP K+I
Sbjct: 16  NTLVPMVVEQTARGERSYDIYSRLLKERVIFLVGQVEDHMANLVVAQMLFLEAENPDKDI 75

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG++IYDTMQFIKP +ST C+GQA SMG+ LL+AG KG RF LPNAR 
Sbjct: 76  HLYINSPGGSVTAGLSIYDTMQFIKPDVSTMCIGQACSMGAFLLTAGAKGKRFCLPNART 135

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI   AQ+I+K++ RLNEI   + G+  EE+ +  +RD  MSA E+
Sbjct: 136 MIHQPSGGAQGQASDIHIQAQEILKLRERLNEIMAGHTGRGVEEIARDTERDRFMSAHES 195

Query: 196 CDWGVVDKVLMSR 208
            ++G++DKVL  R
Sbjct: 196 VEYGLIDKVLERR 208


>gi|163851839|ref|YP_001639882.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Methylobacterium extorquens PA1]
 gi|218530631|ref|YP_002421447.1| ATP-dependent Clp protease proteolytic subunit [Methylobacterium
           chloromethanicum CM4]
 gi|240139003|ref|YP_002963478.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Methylobacterium extorquens AM1]
 gi|254561598|ref|YP_003068693.1| ATP-dependent Clp protease proteolytic subunit [Methylobacterium
           extorquens DM4]
 gi|226706461|sp|A9W5F5|CLPP_METEP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763796|sp|B7KNT0|CLPP_METC4 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|163663444|gb|ABY30811.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Methylobacterium extorquens PA1]
 gi|218522934|gb|ACK83519.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Methylobacterium chloromethanicum CM4]
 gi|240008975|gb|ACS40201.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Methylobacterium extorquens AM1]
 gi|254268876|emb|CAX24837.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp)
           [Methylobacterium extorquens DM4]
          Length = 208

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 131/204 (64%), Positives = 170/204 (83%), Gaps = 1/204 (0%)

Query: 8   KKDSEDVF-LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  D F   LVPMVVEQ++RGER++DIYSRLL+ERI+F+TG +ED  A+LI AQLLFL
Sbjct: 1   MRDPVDYFHNSLVPMVVEQSSRGERAFDIYSRLLRERIIFLTGPVEDQGASLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+KEIS YINSPGGVVT+G++IYDTMQFI+ P++T C+GQAASMGSLLL+AGE G 
Sbjct: 61  EAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVTTLCVGQAASMGSLLLAAGEAGH 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPNARI++HQPSGGF GQA+DI  HA++I  +K+RLNEIYVK+ G+ YE + + L+R
Sbjct: 121 RFALPNARIMVHQPSGGFQGQATDILIHAREIEALKKRLNEIYVKHTGREYETIHQALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRID 210
           D+ M+A  A ++G++D +L  R +
Sbjct: 181 DNFMTADAAKEFGLIDDILHKRPE 204


>gi|320530213|ref|ZP_08031283.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Selenomonas
           artemidis F0399]
 gi|320137646|gb|EFW29558.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Selenomonas
           artemidis F0399]
          Length = 199

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 109/196 (55%), Positives = 158/196 (80%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVE ++RGER+YDIYSRLLKERI+F+ G I+D++A ++ AQ+LFLE+E+P K+I LYIN
Sbjct: 1   MVVENSSRGERAYDIYSRLLKERIIFLGGPIDDNVANVVVAQMLFLESEDPDKDIHLYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGGVVTAG+AIYDTMQ+IKP +ST C+GQAASMGS+LL+AG KG R+ALP+ARI++HQP
Sbjct: 61  SPGGVVTAGLAIYDTMQYIKPDVSTICIGQAASMGSILLTAGAKGKRYALPHARIMIHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
            GG  GQ++DI+  A++I++++   NEI  ++ G+  +++    +RD+ MSA EA  +G+
Sbjct: 121 LGGAQGQSTDIQIQAKEILRLREVGNEILARHTGQDTDKINVDTERDNFMSAEEAKAYGL 180

Query: 201 VDKVLMSRIDIEEKSK 216
           +D+V++      ++SK
Sbjct: 181 IDEVVVRPPAASKESK 196


>gi|260432980|ref|ZP_05786951.1| Clp protease [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416808|gb|EEX10067.1| Clp protease [Silicibacter lacuscaerulensis ITI-1157]
          Length = 210

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 132/207 (63%), Positives = 165/207 (79%), Gaps = 1/207 (0%)

Query: 10  DSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           D  D ++  LVPMVVEQT+RGER+YDI+SRLLKERIVF+ G I D M+ LI AQLL LEA
Sbjct: 3   DPVDTYMNTLVPMVVEQTSRGERAYDIFSRLLKERIVFINGPIHDGMSHLIVAQLLHLEA 62

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ENP+KEIS+YINSPGGVVT+G+AIYDTMQ+IKP  ST  +GQAASMGS+LL+ GEKGMRF
Sbjct: 63  ENPKKEISIYINSPGGVVTSGLAIYDTMQYIKPKCSTLVIGQAASMGSVLLAGGEKGMRF 122

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPN+RI++HQPSGG+ GQASDI  HA +  K+K RL +IY K+ G++ + +EK LDRD+
Sbjct: 123 ALPNSRIMVHQPSGGYQGQASDIMIHAAETQKLKDRLYDIYAKHTGQSKKTIEKALDRDN 182

Query: 189 IMSASEACDWGVVDKVLMSRIDIEEKS 215
            MS  EA +WG +D+++ SR   E   
Sbjct: 183 FMSPEEAKEWGHIDEIVESRTKAEPDE 209


>gi|308271899|emb|CBX28507.1| ATP-dependent Clp protease proteolytic subunit [uncultured
           Desulfobacterium sp.]
          Length = 206

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 114/201 (56%), Positives = 160/201 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMV+EQ++RGER+YDIYSRLLK+RI+F+   + D +A L+ AQLLFLE+E+P K+I
Sbjct: 1   MPLIPMVIEQSSRGERAYDIYSRLLKDRIIFLGTAMNDEVANLLIAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGGVVT+G+A+YDTMQ+IK  I+T C+GQAASMG+LLL+AG KG R+ALPNARI
Sbjct: 61  NFYINSPGGVVTSGLAVYDTMQYIKSDIATVCIGQAASMGALLLTAGAKGKRYALPNARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           L+HQP GGF GQASDI   A++I+++K  LN+I   + GK  ++++   DRD+ MS  EA
Sbjct: 121 LIHQPMGGFQGQASDIAIQAREILRMKDTLNDILTFHTGKDLKQIQVDTDRDYFMSGKEA 180

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
            ++G++D V+ +R D++   K
Sbjct: 181 EEYGLIDHVITNRNDLDNIEK 201


>gi|312961789|ref|ZP_07776287.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens WH6]
 gi|311284048|gb|EFQ62631.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens WH6]
          Length = 211

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG +G R+ LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAEGKRYCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGHTLEEIERDTNRDNFMSAEAAR 197

Query: 197 DWGVVDKVLMSRI 209
           ++G++D V+  R 
Sbjct: 198 EYGLIDAVIEKRP 210


>gi|116243153|sp|Q1Q8J2|CLPP_PSYCK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 215

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 121/200 (60%), Positives = 160/200 (80%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           +       LVPMVVEQ+ RGERS+DI+SRLL+ER++F+TGQ+EDHMA LI AQLLFLEAE
Sbjct: 13  NQSATQAALVPMVVEQSARGERSFDIFSRLLRERVIFLTGQVEDHMANLIVAQLLFLEAE 72

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I LYINSPGG V+AG+AI+DTM FIKP +ST CMG A SMGS LL+AGEKG R+A
Sbjct: 73  NPDKDIHLYINSPGGSVSAGLAIFDTMNFIKPEVSTICMGGAYSMGSFLLAAGEKGKRYA 132

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           L NAR+++HQPSGG  GQA+DIE +A++I+K + RLNEI  +  G+  +++EK ++RD+ 
Sbjct: 133 LANARVMIHQPSGGAQGQATDIEINAREILKTRARLNEILAERTGQPVDKIEKDVERDYW 192

Query: 190 MSASEACDWGVVDKVLMSRI 209
           + A EA ++G++D+VL  R 
Sbjct: 193 LDAKEAKEYGLIDEVLERRP 212


>gi|325264756|ref|ZP_08131485.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           sp. D5]
 gi|324030048|gb|EGB91334.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           sp. D5]
          Length = 193

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 112/192 (58%), Positives = 154/192 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLKERI+F+  ++ D  A++I AQLLFLEA++P K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKERIIFLGEEVNDVSASVIVAQLLFLEADDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VT+G+AIYDTMQ+IK  +ST C+G AASMG+ LLS G+KG RFALPNA I
Sbjct: 61  QLYINSPGGSVTSGLAIYDTMQYIKCDVSTVCIGMAASMGAFLLSGGKKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I   A+ I+KI+ +LN+I  +N G++ + ++   +RD+ MSA EA
Sbjct: 121 MIHQPSGGAQGQATEIHIVAEHILKIRHKLNQILAENTGQSLDVIKVDTERDNYMSALEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+V+ S
Sbjct: 181 KEYGLIDEVIAS 192


>gi|296284617|ref|ZP_06862615.1| ATP-dependent Clp protease proteolytic subunit [Citromicrobium
           bathyomarinum JL354]
          Length = 228

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 127/194 (65%), Positives = 160/194 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVP+VVEQT+RGERS+DI+SRLL+ERIVF+TG +ED MA+L  AQLLFLE+ENP K IS
Sbjct: 16  ALVPVVVEQTSRGERSFDIFSRLLRERIVFLTGPVEDGMASLAVAQLLFLESENPSKPIS 75

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGGVVTAGMAI+DTMQ+I+P IST C+GQAASMGS LL+AGE GMR ALPNARI+
Sbjct: 76  MYINSPGGVVTAGMAIHDTMQYIQPRISTVCVGQAASMGSFLLAAGEPGMRIALPNARIM 135

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  G ASDIE  A++I++I++ +NE+Y K  G+  E++E+ +DRD  + A EA 
Sbjct: 136 IHQPSGGAQGMASDIEIQAREILRIRKNMNELYAKYTGQPLEKIEEAMDRDTFLDAQEAM 195

Query: 197 DWGVVDKVLMSRID 210
            +G+VDKV  SR  
Sbjct: 196 KFGLVDKVFESRPQ 209


>gi|188585728|ref|YP_001917273.1| ATP-dependent Clp protease proteolytic subunit ClpP [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|259585960|sp|B2A158|CLPP_NATTJ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|179350415|gb|ACB84685.1| ATP-dependent Clp protease proteolytic subunit ClpP [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 197

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 113/195 (57%), Positives = 150/195 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMV+EQTNRGERSYDIYSRLLK+RI+F+   I D +A  + AQ+LFLE+E+P K+I
Sbjct: 1   MNLIPMVIEQTNRGERSYDIYSRLLKDRIIFIGTGINDDIANSVIAQMLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V AG+AIYDTMQ+I+  +ST C+G AASMG++LL+AG +G RF LPN+RI
Sbjct: 61  HLYINSPGGHVHAGLAIYDTMQYIRSDVSTICVGMAASMGAVLLAAGNEGKRFCLPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           +LHQP GG  GQA+D+E HA++I+K K RLN+I   + G+  E++ K  DRD  MS+ EA
Sbjct: 121 MLHQPMGGAQGQAADVEIHAREIMKTKERLNQILAHHTGQPVEQISKDTDRDFFMSSEEA 180

Query: 196 CDWGVVDKVLMSRID 210
             +GV+D VL    +
Sbjct: 181 QKYGVIDDVLKRPPE 195


>gi|298292194|ref|YP_003694133.1| ATP-dependent Clp protease proteolytic subunit ClpP [Starkeya
           novella DSM 506]
 gi|296928705|gb|ADH89514.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Starkeya
           novella DSM 506]
          Length = 210

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 141/204 (69%), Positives = 174/204 (85%), Gaps = 1/204 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  D ++  LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +ED+MATL+ AQLLFL
Sbjct: 1   MRDPIDTYMNYLVPMVVEQTNRGERSYDIYSRLLKERIIFLTGPVEDNMATLMVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+KEIS+YINSPGGVVT+G+AIYDTMQFIKP +ST C+GQAASMGSLLL+AGEKGM
Sbjct: 61  EAENPKKEISMYINSPGGVVTSGLAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPNARI++HQPSGGF GQ +DI  HAQ+I+ +K+RLNEIYVK+ G+  + VE  L+R
Sbjct: 121 RFALPNARIMVHQPSGGFQGQVTDIMLHAQEILSLKKRLNEIYVKHTGQDLKAVEDALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRID 210
           D+ M++  A  +G++D V+  R D
Sbjct: 181 DNFMTSDNAKSFGLIDNVIDKRPD 204


>gi|197123826|ref|YP_002135777.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Anaeromyxobacter sp. K]
 gi|226706439|sp|B4UAX9|CLPP_ANASK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|196173675|gb|ACG74648.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Anaeromyxobacter sp. K]
          Length = 203

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 112/203 (55%), Positives = 159/203 (78%), Gaps = 2/203 (0%)

Query: 16  LGLVPM--VVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +  +PM  VVEQT+RGERSYDIYSRLLK+RI+F+   ++D +A +I AQLLFLE+E+P K
Sbjct: 1   MPYIPMPYVVEQTHRGERSYDIYSRLLKDRIIFLGTPVDDDVANVIIAQLLFLESEDPDK 60

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I+LYINSPGG VT+G+AIYDTMQ++KP +ST C+GQAASMG+ LL+ G  G RFA+PNA
Sbjct: 61  DINLYINSPGGSVTSGLAIYDTMQYVKPQVSTICLGQAASMGAFLLAGGAAGKRFAVPNA 120

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           RI++HQ SGGF GQA+DIE  A++ +++K +LNEI  ++  +  E +E+  +RD+ MSA 
Sbjct: 121 RIMIHQLSGGFQGQATDIEIQAKEALRLKAKLNEIMARHTRQPIERIERDTERDYFMSAG 180

Query: 194 EACDWGVVDKVLMSRIDIEEKSK 216
           EA ++G++D V + +   E+K +
Sbjct: 181 EAKEYGLIDDVFLHKKAAEKKPQ 203


>gi|297538721|ref|YP_003674490.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylotenera
           sp. 301]
 gi|297258068|gb|ADI29913.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylotenera
           sp. 301]
          Length = 219

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 122/204 (59%), Positives = 165/204 (80%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
           A+ D     LG +PMVVEQ+ RGERSYDIYSRLLKER++F+ G + D  A L+ AQLLFL
Sbjct: 14  AELDISPQGLGYIPMVVEQSGRGERSYDIYSRLLKERVIFLVGPVNDMSANLVVAQLLFL 73

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP K+ISLYINSPGG VTAGM+IYDTMQFIK  +ST C+GQAASMG+ LL+AG KG 
Sbjct: 74  EAENPDKDISLYINSPGGSVTAGMSIYDTMQFIKADVSTLCIGQAASMGAFLLAAGAKGK 133

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPSGGF GQ++DIE HA++I+ ++ +LN+I   + GKT  E+++  +R
Sbjct: 134 RFSLPNSRVMIHQPSGGFQGQSTDIEIHAKEILYLRAKLNDILAHHTGKTAAEIDRDTER 193

Query: 187 DHIMSASEACDWGVVDKVLMSRID 210
           D+ MSA+++ ++G++DKV+ SR +
Sbjct: 194 DNFMSATQSVEYGMIDKVIESRTE 217


>gi|225568849|ref|ZP_03777874.1| hypothetical protein CLOHYLEM_04928 [Clostridium hylemonae DSM
           15053]
 gi|225162348|gb|EEG74967.1| hypothetical protein CLOHYLEM_04928 [Clostridium hylemonae DSM
           15053]
          Length = 193

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 111/193 (57%), Positives = 151/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A++I AQLLFLEAE+P+K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVTDVSASVIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG+AIYDTMQ+IK  I T C+G AASMGS LL+ G KG R ALPNA I
Sbjct: 61  HLYINSPGGSVSAGLAIYDTMQYIKSDIETICIGMAASMGSFLLAGGTKGKRLALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A+ I+K ++RLN+I  +N G+  + +    +RD+ MSA EA
Sbjct: 121 MIHQPSGGAQGQATEIQIAAEHILKTRQRLNQILAENTGQPLDVIRIDTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D+V+ +R
Sbjct: 181 KAYGLIDEVIKNR 193


>gi|93278470|pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp.
 gi|93278471|pdb|1YG8|B Chain B, The Structure Of A V6a Variant Of Clpp.
 gi|93278472|pdb|1YG8|C Chain C, The Structure Of A V6a Variant Of Clpp.
 gi|93278473|pdb|1YG8|D Chain D, The Structure Of A V6a Variant Of Clpp.
 gi|93278474|pdb|1YG8|E Chain E, The Structure Of A V6a Variant Of Clpp.
 gi|93278475|pdb|1YG8|F Chain F, The Structure Of A V6a Variant Of Clpp.
 gi|93278476|pdb|1YG8|G Chain G, The Structure Of A V6a Variant Of Clpp.
 gi|93278477|pdb|1YG8|H Chain H, The Structure Of A V6a Variant Of Clpp.
 gi|93278478|pdb|1YG8|I Chain I, The Structure Of A V6a Variant Of Clpp.
 gi|93278479|pdb|1YG8|J Chain J, The Structure Of A V6a Variant Of Clpp.
 gi|93278480|pdb|1YG8|K Chain K, The Structure Of A V6a Variant Of Clpp.
 gi|93278481|pdb|1YG8|L Chain L, The Structure Of A V6a Variant Of Clpp.
 gi|93278482|pdb|1YG8|M Chain M, The Structure Of A V6a Variant Of Clpp.
 gi|93278483|pdb|1YG8|N Chain N, The Structure Of A V6a Variant Of Clpp.
 gi|93278484|pdb|1YG8|O Chain O, The Structure Of A V6a Variant Of Clpp.
 gi|93278485|pdb|1YG8|P Chain P, The Structure Of A V6a Variant Of Clpp.
 gi|93278486|pdb|1YG8|Q Chain Q, The Structure Of A V6a Variant Of Clpp.
 gi|93278487|pdb|1YG8|R Chain R, The Structure Of A V6a Variant Of Clpp.
 gi|93278488|pdb|1YG8|S Chain S, The Structure Of A V6a Variant Of Clpp.
 gi|93278489|pdb|1YG8|T Chain T, The Structure Of A V6a Variant Of Clpp.
 gi|93278490|pdb|1YG8|U Chain U, The Structure Of A V6a Variant Of Clpp.
 gi|93278491|pdb|1YG8|V Chain V, The Structure Of A V6a Variant Of Clpp.
 gi|93278492|pdb|1YG8|W Chain W, The Structure Of A V6a Variant Of Clpp.
 gi|93278493|pdb|1YG8|X Chain X, The Structure Of A V6a Variant Of Clpp.
 gi|93278494|pdb|1YG8|Y Chain Y, The Structure Of A V6a Variant Of Clpp.
 gi|93278495|pdb|1YG8|Z Chain Z, The Structure Of A V6a Variant Of Clpp.
 gi|93278496|pdb|1YG8|AA Chain a, The Structure Of A V6a Variant Of Clpp.
 gi|93278497|pdb|1YG8|BB Chain b, The Structure Of A V6a Variant Of Clpp
          Length = 193

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 163/193 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            L PMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 1   ALAPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 60

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R++
Sbjct: 61  LYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVM 120

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE HA++I+K+K R+NE+   + G++ E++E+  +RD  +SA EA 
Sbjct: 121 IHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAV 180

Query: 197 DWGVVDKVLMSRI 209
           ++G+VD +L  R 
Sbjct: 181 EYGLVDSILTHRN 193


>gi|56416580|ref|YP_153654.1| ATP-dependent Clp protease proteolytic subunit [Anaplasma marginale
           str. St. Maries]
 gi|222474947|ref|YP_002563362.1| ATP-dependent clp protease proteolytic subunit (clpP) [Anaplasma
           marginale str. Florida]
 gi|67460191|sp|Q5PBD0|CLPP_ANAMM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763783|sp|B9KHZ4|CLPP_ANAMF RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56387812|gb|AAV86399.1| ATP-dependent clp protease proteolytic subunit [Anaplasma marginale
           str. St. Maries]
 gi|222419083|gb|ACM49106.1| ATP-dependent clp protease proteolytic subunit (clpP) [Anaplasma
           marginale str. Florida]
          Length = 215

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 138/197 (70%), Positives = 176/197 (89%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   + LVPMVVEQT+RGER+YDIYSRLLKERI+F+TG +ED+MA+LI AQL+FLEAENP
Sbjct: 14  EREIMNLVPMVVEQTSRGERAYDIYSRLLKERIIFITGTVEDNMASLIVAQLVFLEAENP 73

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+ISLYINSPGGVVTAG++IYDTMQ+IKP +ST C+GQAASMG+LLL+ GE GMR+ALP
Sbjct: 74  EKDISLYINSPGGVVTAGLSIYDTMQYIKPKVSTLCLGQAASMGALLLAGGEPGMRYALP 133

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+RI++HQPSGGF GQA+DIE HA++I++IKRRLNEIYVK+ GK+ EE+E +++RD+ M 
Sbjct: 134 NSRIMVHQPSGGFRGQATDIEIHAREILEIKRRLNEIYVKHTGKSLEEIESSMERDNFMV 193

Query: 192 ASEACDWGVVDKVLMSR 208
           A +A D+G+VDKV+  R
Sbjct: 194 AEKAKDFGIVDKVIDKR 210


>gi|254670503|emb|CBA06249.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis alpha153]
          Length = 209

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 122/208 (58%), Positives = 158/208 (75%), Gaps = 2/208 (0%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            K D       LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFL
Sbjct: 1   MKGDEMSFDNYLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I  YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG 
Sbjct: 61  ESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGK 120

Query: 127 RFALPNARILLHQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL 184
           RFALPN+RI++HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  
Sbjct: 121 RFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDT 180

Query: 185 DRDHIMSASEACDWGVVDKVLMSRIDIE 212
           DRD+ MSA EA ++G++D+VL +R  ++
Sbjct: 181 DRDNFMSAEEAKEYGLIDQVLENRASLQ 208


>gi|329894939|ref|ZP_08270738.1| ATP-dependent Clp protease proteolytic subunit [gamma
           proteobacterium IMCC3088]
 gi|328922668|gb|EGG30003.1| ATP-dependent Clp protease proteolytic subunit [gamma
           proteobacterium IMCC3088]
          Length = 200

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 123/194 (63%), Positives = 160/194 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGL+PMVVEQT+RGERSYDIYSRLLKER++FV GQ+EDHMA LI AQLLFLE+ENP K+I
Sbjct: 7   LGLIPMVVEQTSRGERSYDIYSRLLKERVIFVVGQVEDHMANLIVAQLLFLESENPDKDI 66

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG+AIYDTM+FIKP ++T CMGQAASMG+ LLSAG KG R+ LPNAR 
Sbjct: 67  HLYINSPGGSVTAGLAIYDTMKFIKPDVTTTCMGQAASMGAFLLSAGAKGKRYCLPNART 126

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI+  A++I+ I+ RLN +  ++ G+  + +E+  +RD  M+A ++
Sbjct: 127 MIHQPSGGAQGQATDIDIQAKEILIIRERLNRLMAEHTGQPIDVIERDTERDRFMNAEQS 186

Query: 196 CDWGVVDKVLMSRI 209
            ++G+VD+V+ SR 
Sbjct: 187 KEYGLVDEVVSSRT 200


>gi|256556952|gb|ACU83574.1| ATP-dependent Clp protease subunit [uncultured bacterium
           HF130_AEPn_2]
          Length = 211

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 125/193 (64%), Positives = 158/193 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG +G RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAEGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGHTLEEIERDTNRDNFMSAEAAR 197

Query: 197 DWGVVDKVLMSRI 209
           ++G++D V+  R 
Sbjct: 198 EYGLIDAVIDKRP 210


>gi|42784300|ref|NP_981547.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           ATCC 10987]
 gi|67460499|sp|Q72XW9|CLPP2_BACC1 RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|42740231|gb|AAS44155.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus ATCC 10987]
          Length = 193

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 106/193 (54%), Positives = 152/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLE+++P K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG R+ALPN+ +
Sbjct: 61  HLYINSPGGSITAGMAIYDTMQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN+I     G+  E +++  DRD+ M+A +A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQPLEVLQRDTDRDNFMTAEKA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DK+  +R
Sbjct: 181 LEYGLIDKIFTNR 193


>gi|301598440|pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598441|pdb|3HLN|B Chain B, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598442|pdb|3HLN|C Chain C, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598443|pdb|3HLN|D Chain D, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598444|pdb|3HLN|E Chain E, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598445|pdb|3HLN|F Chain F, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598446|pdb|3HLN|G Chain G, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598447|pdb|3HLN|H Chain H, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598448|pdb|3HLN|I Chain I, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598449|pdb|3HLN|J Chain J, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598450|pdb|3HLN|K Chain K, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598451|pdb|3HLN|L Chain L, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598452|pdb|3HLN|M Chain M, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598453|pdb|3HLN|N Chain N, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598454|pdb|3HLN|O Chain O, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598455|pdb|3HLN|P Chain P, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598456|pdb|3HLN|Q Chain Q, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598457|pdb|3HLN|R Chain R, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598458|pdb|3HLN|S Chain S, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598459|pdb|3HLN|T Chain T, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598460|pdb|3HLN|U Chain U, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598461|pdb|3HLN|V Chain V, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598462|pdb|3HLN|W Chain W, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598463|pdb|3HLN|X Chain X, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598464|pdb|3HLN|Y Chain Y, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598465|pdb|3HLN|Z Chain Z, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598466|pdb|3HLN|1 Chain 1, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 gi|301598467|pdb|3HLN|2 Chain 2, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
          Length = 193

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 163/193 (84%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            LVPMV+EQT+RGERS+DIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLEAENP+K+I 
Sbjct: 1   ALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIY 60

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQAASMG+ LL+AG KG RF LPN+R++
Sbjct: 61  LYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVM 120

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQA+DIE H ++I+K+K R+NE+   + G++ E++E+  +RD  +SA EA 
Sbjct: 121 IHQPLGGYQGQATDIEIHCREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAV 180

Query: 197 DWGVVDKVLMSRI 209
           ++G+VD +L  R 
Sbjct: 181 EYGLVDSILTHRN 193


>gi|242279532|ref|YP_002991661.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           salexigens DSM 2638]
 gi|242122426|gb|ACS80122.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           salexigens DSM 2638]
          Length = 202

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 123/201 (61%), Positives = 167/201 (83%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
             G +P+VVE T R ER+YDIYSRLLK+RI+ ++G++ DH+A++ICAQLLFLE+E+P+KE
Sbjct: 1   MSGTIPIVVETTGRTERAYDIYSRLLKDRIILLSGEVNDHVASVICAQLLFLESEDPEKE 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I +YINSPGGVVTAGMAIYDTMQ+I  P++T CMGQAASMG+ LLSAGEKG R++LP++R
Sbjct: 61  IYMYINSPGGVVTAGMAIYDTMQYISAPVATLCMGQAASMGAFLLSAGEKGQRYSLPHSR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           IL+HQP GG  GQA+DI+  A++I+++++ LN I  +N G+T EE+EK  DRD+ MSA E
Sbjct: 121 ILIHQPLGGAQGQATDIDIQAREILRLRKSLNSIMAENTGRTVEEIEKDTDRDNFMSAQE 180

Query: 195 ACDWGVVDKVLMSRIDIEEKS 215
           A ++G++DKVL +R +IE K 
Sbjct: 181 AVEYGLIDKVLENRGNIESKE 201


>gi|315122830|ref|YP_004063319.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496232|gb|ADR52831.1| ATP-dependent Clp protease proteolytic subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 216

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 179/216 (82%), Positives = 196/216 (90%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M FE  A++   D  LGLVPMVVEQTNRGERSYDIYSRLLKERIVF+TGQIEDHMA LIC
Sbjct: 1   MIFEEYAREGFNDTSLGLVPMVVEQTNRGERSYDIYSRLLKERIVFITGQIEDHMAALIC 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPP+ST C+GQAASMGSLLL+
Sbjct: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPVSTLCIGQAASMGSLLLA 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG+KGMRFALPNARI+LHQPSGGFSGQASDIERHA+DI+KIK RLN IYVK+CG+ YEEV
Sbjct: 121 AGKKGMRFALPNARIMLHQPSGGFSGQASDIERHARDIIKIKHRLNNIYVKHCGRVYEEV 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           E+TLDRD  MSA +A  WG++DKVLMSR+DIEE  K
Sbjct: 181 EQTLDRDCFMSAEDAHAWGLIDKVLMSRVDIEEGGK 216


>gi|117620419|ref|YP_856542.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117561826|gb|ABK38774.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 200

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 127/197 (64%), Positives = 156/197 (79%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E     L+PMVVEQT +GERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP
Sbjct: 3   ESPRNALIPMVVEQTAKGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENP 62

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            ++IS+YINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG RF LP
Sbjct: 63  DQDISIYINSPGGAVTAGMSIYDTMQFIKPDVSTVCMGQACSMGAFLLAGGAKGKRFCLP 122

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           NAR+++HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+    +E+  DRD+ MS
Sbjct: 123 NARVMIHQPLGGFQGQASDIQIHAQEILKIKNTLNERLAFHTGQDMATIERDTDRDNFMS 182

Query: 192 ASEACDWGVVDKVLMSR 208
           A +A  +G+VD VL  R
Sbjct: 183 AEQAVAYGLVDGVLSRR 199


>gi|21230439|ref|NP_636356.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66769567|ref|YP_244329.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|25008306|sp|Q8PBY6|CLPP_XANCP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|81304478|sp|Q4URL4|CLPP_XANC8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|21112001|gb|AAM40280.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66574899|gb|AAY50309.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. campestris str. 8004]
          Length = 208

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 123/198 (62%), Positives = 163/198 (82%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
              L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+DHMA +I AQLLFLEA+NP+
Sbjct: 5   TKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPE 64

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+IS+YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN
Sbjct: 65  KDISIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPN 124

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQA+DI+ HA++I+ ++ RLNEI  K+ G++ E + +  +RD+  SA
Sbjct: 125 SRVMIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSA 184

Query: 193 SEACDWGVVDKVLMSRID 210
            +A  +G+VD VL  R +
Sbjct: 185 VDAQAYGLVDHVLERRPE 202


>gi|315127189|ref|YP_004069192.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           sp. SM9913]
 gi|315015703|gb|ADT69041.1| ATP-dependent Clp protease proteolytic subunit [Pseudoalteromonas
           sp. SM9913]
          Length = 205

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 126/196 (64%), Positives = 158/196 (80%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           D    LVPMVVEQT +GERS+DIYSRLLKERI+F+TGQ+ED+MA LI AQ+LFLE+ENP+
Sbjct: 7   DPLNALVPMVVEQTAKGERSFDIYSRLLKERIIFLTGQVEDNMANLILAQMLFLESENPE 66

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+I LYINSPGG VTAGMAIYDTM FIKP +ST C+GQAASMG+ LLS G KG RF LPN
Sbjct: 67  KDIFLYINSPGGSVTAGMAIYDTMNFIKPDVSTICVGQAASMGAFLLSGGAKGKRFCLPN 126

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQASD E HA++I+ IK +LN +  ++ G+  + V +  DRD+ MSA
Sbjct: 127 SRVMIHQPLGGFQGQASDFEIHAKEILSIKDKLNRLMAEHTGQPLDVVSRDTDRDNFMSA 186

Query: 193 SEACDWGVVDKVLMSR 208
           S+A D+G+VD V  +R
Sbjct: 187 SQAVDYGIVDSVFTNR 202


>gi|17231175|ref|NP_487723.1| ATP-dependent Clp protease proteolytic subunit [Nostoc sp. PCC
           7120]
 gi|75909809|ref|YP_324105.1| ATP-dependent Clp protease proteolytic subunit ClpP [Anabaena
           variabilis ATCC 29413]
 gi|21759070|sp|Q8YQX8|CLPP2_ANASP RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|17132816|dbj|BAB75382.1| ATP-dependent Clp protease proteolytic subunit [Nostoc sp. PCC
           7120]
 gi|75703534|gb|ABA23210.1| ATP-dependent Clp protease proteolytic subunit ClpP [Anabaena
           variabilis ATCC 29413]
          Length = 232

 Score =  239 bits (610), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 105/191 (54%), Positives = 143/191 (74%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            +VPMVVEQ+  GER++DIYSRLL+ERI+F+   I+D +A  I AQLLFL+AE+ +K+I 
Sbjct: 28  NIVPMVVEQSGMGERAFDIYSRLLRERIIFLGTPIDDAVANTIVAQLLFLDAEDSEKDIQ 87

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V AGMAIYDT+Q I+P + T C G AASMG+ LL+AG KG R +LP++RI+
Sbjct: 88  LYINSPGGSVYAGMAIYDTIQQIRPDVVTICFGLAASMGAFLLTAGTKGKRMSLPDSRIM 147

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA DIE  A++I+ IK +LN++   + G+  E +E   DRD  MSA EA 
Sbjct: 148 IHQPLGGAQGQAIDIEIQAREILYIKAQLNQLLANHTGQPLERIEADTDRDFFMSAEEAK 207

Query: 197 DWGVVDKVLMS 207
           ++G++D+V+  
Sbjct: 208 NYGLIDQVISR 218


>gi|329121861|ref|ZP_08250476.1| ATP-dependent Clp protease, protease subunit [Dialister
           micraerophilus DSM 19965]
 gi|327467799|gb|EGF13291.1| ATP-dependent Clp protease, protease subunit [Dialister
           micraerophilus DSM 19965]
          Length = 205

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 115/205 (56%), Positives = 160/205 (78%), Gaps = 1/205 (0%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
            E + +  VP+VVEQT+ GERSYDIYSRLLK+RI+F+ GQIEDHMA +I AQLLFLEAE+
Sbjct: 2   KEGIIMAYVPIVVEQTSHGERSYDIYSRLLKDRIIFLDGQIEDHMANVIIAQLLFLEAED 61

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I LYINSPGGVVTAGMAIYDTMQ+I+P +ST C+G  ASM ++LL++G KG RFAL
Sbjct: 62  PDKDIHLYINSPGGVVTAGMAIYDTMQYIRPDVSTICIGSCASMAAVLLTSGAKGKRFAL 121

Query: 131 PNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM 190
           P++ +++HQP GG  GQA++IE HA++I++++  LN I  K+ G+  + ++K  +RD+ M
Sbjct: 122 PHSNVMIHQPLGGVQGQATEIEIHAREILRLRDELNGILAKHTGQPLDVIKKDTERDNFM 181

Query: 191 SASEACDWGVVDKVLMSRIDIEEKS 215
           +A  A  +G++DK+L  R ++  K 
Sbjct: 182 TAENALKYGLIDKILT-RNELTAKD 205


>gi|310766842|gb|ADP11792.1| ATP-dependent Clp protease proteolytic subunit clpP [Erwinia sp.
           Ejp617]
          Length = 215

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 171/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 9   MSYSG--ERELTAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 66

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 67  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 126

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+K K+ +NE+  K+ G+T E +
Sbjct: 127 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIDIHAREIIKTKQMMNELMAKHTGQTIETI 186

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASE+ ++G+VD VL  R 
Sbjct: 187 ERDTNRDRFLSASESVEYGLVDSVLSQRS 215


>gi|229164087|ref|ZP_04292023.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           R309803]
 gi|228619323|gb|EEK76213.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           R309803]
          Length = 193

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 106/193 (54%), Positives = 153/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLE+++P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG RFALPN+ +
Sbjct: 61  HIYINSPGGSITAGMAIYDTMQFIKPQVSTICIGMAASMGAFLLAAGEKGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN+I     G+  E +++  DRD+ M+A +A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQPLEVLQRDTDRDNFMTAEKA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DK+  +R
Sbjct: 181 LEYGLIDKIFTNR 193


>gi|68249290|ref|YP_248402.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 86-028NP]
 gi|161350016|ref|NP_438872.3| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae Rd KW20]
 gi|260581528|ref|ZP_05849336.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Haemophilus
           influenzae RdAW]
 gi|1168977|sp|P43867|CLPP_HAEIN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|81336285|sp|Q4QMK5|CLPP_HAEI8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|1573716|gb|AAC22371.1| ATP-dependent Clp protease, proteolytic subunit (clpP) [Haemophilus
           influenzae Rd KW20]
 gi|68057489|gb|AAX87742.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae 86-028NP]
 gi|260091826|gb|EEW75781.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Haemophilus
           influenzae RdAW]
          Length = 193

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 157/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LN+    + G+  E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQGIERIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 QAYGLVDEVLVKR 193


>gi|293606140|ref|ZP_06688505.1| ATP-dependent Clp protease proteolytic subunit [Achromobacter
           piechaudii ATCC 43553]
 gi|292815595|gb|EFF74711.1| ATP-dependent Clp protease proteolytic subunit [Achromobacter
           piechaudii ATCC 43553]
          Length = 217

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 117/195 (60%), Positives = 153/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LG +PMV+EQ+ RGER+YDIYSRLL+ER++F+ G + D  A L+ AQLLFLE+ENP K+I
Sbjct: 22  LGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDATANLVVAQLLFLESENPDKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V AGMAI+DTMQFIKP +ST C G AASMG+ LL+AG+KG RF LPN+RI
Sbjct: 82  SLYINSPGGSVYAGMAIFDTMQFIKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRI 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQASDI+  A++I+ ++ RLN I   N G++ E +    +RD+ MSA +A
Sbjct: 142 MIHQPSGGAQGQASDIQIQAREILDLRERLNRILADNTGQSMERIGLDTERDNFMSAEDA 201

Query: 196 CDWGVVDKVLMSRID 210
             +G+VDKV+ SR +
Sbjct: 202 VSYGLVDKVMSSRSE 216


>gi|323465060|gb|ADX77213.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus pseudintermedius ED99]
          Length = 195

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 105/194 (54%), Positives = 148/194 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+E TNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFL+A++ +K+I
Sbjct: 1   MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLQAQDAEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG AIYDT+Q IKP + T C+G AASMGS LL+AG KG RFALPNA +
Sbjct: 61  YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I++ + RLN+I  +  G+  E++EK  DRD+ ++A EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKHILRTRERLNKILSERTGQPIEKIEKDTDRDNFLTAQEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V+    
Sbjct: 181 KEYGLIDEVMEPEK 194


>gi|59801023|ref|YP_207735.1| putative endopeptidase [Neisseria gonorrhoeae FA 1090]
 gi|239999171|ref|ZP_04719095.1| putative endopeptidase [Neisseria gonorrhoeae 35/02]
 gi|240013921|ref|ZP_04720834.1| putative endopeptidase [Neisseria gonorrhoeae DGI18]
 gi|240016363|ref|ZP_04722903.1| putative endopeptidase [Neisseria gonorrhoeae FA6140]
 gi|240080482|ref|ZP_04725025.1| putative endopeptidase [Neisseria gonorrhoeae FA19]
 gi|240113150|ref|ZP_04727640.1| putative endopeptidase [Neisseria gonorrhoeae MS11]
 gi|240115906|ref|ZP_04729968.1| putative endopeptidase [Neisseria gonorrhoeae PID18]
 gi|240118204|ref|ZP_04732266.1| putative endopeptidase [Neisseria gonorrhoeae PID1]
 gi|240121490|ref|ZP_04734452.1| putative endopeptidase [Neisseria gonorrhoeae PID24-1]
 gi|240123752|ref|ZP_04736708.1| putative endopeptidase [Neisseria gonorrhoeae PID332]
 gi|240125943|ref|ZP_04738829.1| putative endopeptidase [Neisseria gonorrhoeae SK-92-679]
 gi|240128455|ref|ZP_04741116.1| putative endopeptidase [Neisseria gonorrhoeae SK-93-1035]
 gi|254493943|ref|ZP_05107114.1| endopeptidase [Neisseria gonorrhoeae 1291]
 gi|260440279|ref|ZP_05794095.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae DGI2]
 gi|268595002|ref|ZP_06129169.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae 35/02]
 gi|268596618|ref|ZP_06130785.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae FA19]
 gi|268599230|ref|ZP_06133397.1| endopeptidase [Neisseria gonorrhoeae MS11]
 gi|268601577|ref|ZP_06135744.1| endopeptidase [Neisseria gonorrhoeae PID18]
 gi|268603916|ref|ZP_06138083.1| endopeptidase [Neisseria gonorrhoeae PID1]
 gi|268682379|ref|ZP_06149241.1| endopeptidase [Neisseria gonorrhoeae PID332]
 gi|268684537|ref|ZP_06151399.1| endopeptidase [Neisseria gonorrhoeae SK-92-679]
 gi|268686847|ref|ZP_06153709.1| endopeptidase [Neisseria gonorrhoeae SK-93-1035]
 gi|291043574|ref|ZP_06569290.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae DGI2]
 gi|293398887|ref|ZP_06643052.1| Clp protease [Neisseria gonorrhoeae F62]
 gi|67460148|sp|Q5F914|CLPP_NEIG1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|59717918|gb|AAW89323.1| putative endopeptidase [Neisseria gonorrhoeae FA 1090]
 gi|226512983|gb|EEH62328.1| endopeptidase [Neisseria gonorrhoeae 1291]
 gi|268548391|gb|EEZ43809.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae 35/02]
 gi|268550406|gb|EEZ45425.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae FA19]
 gi|268583361|gb|EEZ48037.1| endopeptidase [Neisseria gonorrhoeae MS11]
 gi|268585708|gb|EEZ50384.1| endopeptidase [Neisseria gonorrhoeae PID18]
 gi|268588047|gb|EEZ52723.1| endopeptidase [Neisseria gonorrhoeae PID1]
 gi|268622663|gb|EEZ55063.1| endopeptidase [Neisseria gonorrhoeae PID332]
 gi|268624821|gb|EEZ57221.1| endopeptidase [Neisseria gonorrhoeae SK-92-679]
 gi|268627131|gb|EEZ59531.1| endopeptidase [Neisseria gonorrhoeae SK-93-1035]
 gi|291012037|gb|EFE04026.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           gonorrhoeae DGI2]
 gi|291610301|gb|EFF39411.1| Clp protease [Neisseria gonorrhoeae F62]
          Length = 204

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 120/197 (60%), Positives = 155/197 (78%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  + 
Sbjct: 187 KEYGLIDQVLENRASLR 203


>gi|114330232|ref|YP_746454.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrosomonas
           eutropha C91]
 gi|122314709|sp|Q0AJI2|CLPP_NITEC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|114307246|gb|ABI58489.1| ATP-dependent Clp protease proteolytic subunit ClpP [Nitrosomonas
           eutropha C91]
          Length = 214

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 120/202 (59%), Positives = 157/202 (77%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           K +     LGL+PMV+E + RGER+YDIYSRLL+ERI+F+ G + +  A L+ AQLLFLE
Sbjct: 9   KNELNTTGLGLIPMVIESSGRGERAYDIYSRLLRERIIFLVGPVTETSANLVIAQLLFLE 68

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +EN +K+ISLYINSPGG+VTAG+A+YDTMQFIKP +ST C+GQAASMG+LLL+AG KG R
Sbjct: 69  SENSEKDISLYINSPGGLVTAGLAVYDTMQFIKPDVSTLCIGQAASMGALLLTAGAKGKR 128

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           + LPN+R+++HQP GGF GQASDIE HA++I+ +K RLNEI  K+  +T   +EK  DRD
Sbjct: 129 YCLPNSRVMIHQPLGGFQGQASDIEIHAKEILALKGRLNEILAKHTSQTIRTIEKDTDRD 188

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + + A  A  + +VD VL SR 
Sbjct: 189 NFLGAEAAVKYSLVDAVLTSRK 210


>gi|317050717|ref|YP_004111833.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfurispirillum indicum S5]
 gi|316945801|gb|ADU65277.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfurispirillum indicum S5]
          Length = 196

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 120/194 (61%), Positives = 161/194 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQT RGERSYDIYSRLLK+RIVF+  QI+D ++ +I AQLLFLEAE+P+K+I
Sbjct: 1   MPLVPIVVEQTARGERSYDIYSRLLKDRIVFLGTQIDDQISNVIIAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAGMAIYDTMQ+I+P +ST C+GQAASMG++LL+AGEKG RFALP++RI
Sbjct: 61  FLYINSPGGVVTAGMAIYDTMQYIRPKVSTICVGQAASMGAVLLAAGEKGKRFALPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE  A++I++IK  LN+I V++ G   E++++  DRD  M+  +A
Sbjct: 121 MIHQPLGGAQGQATDIEIQAREILRIKEMLNDILVRHTGADLEKIQRDTDRDFFMTGEQA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G++D+V+ SR 
Sbjct: 181 RAYGIIDEVIQSRS 194


>gi|153955960|ref|YP_001396725.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           kluyveri DSM 555]
 gi|219856302|ref|YP_002473424.1| hypothetical protein CKR_2959 [Clostridium kluyveri NBRC 12016]
 gi|189082452|sp|A5N2K8|CLPP_CLOK5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763788|sp|B9E685|CLPP_CLOK1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|146348818|gb|EDK35354.1| ClpP [Clostridium kluyveri DSM 555]
 gi|219570026|dbj|BAH08010.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 194

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 119/194 (61%), Positives = 155/194 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RIV ++ ++ D  A+LI AQLLFLEAENP K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRIVMLSEEVNDVTASLIVAQLLFLEAENPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG +TAGMAIYDTMQ+IK  +ST C+G AASMG+ LL+AGEKG RFALPN+ I
Sbjct: 61  YFYINSPGGSITAGMAIYDTMQYIKSDVSTICIGMAASMGAFLLAAGEKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA  I++IK++LN I  +  G++ E+VEK  +RD+ M+A EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHADRILRIKKKLNAIISERTGQSIEKVEKDTERDNFMTAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V   + 
Sbjct: 181 KEYGLIDEVFTKKK 194


>gi|218768333|ref|YP_002342845.1| endopeptidase [Neisseria meningitidis Z2491]
 gi|18203136|sp|Q9JU33|CLPP_NEIMA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|121052341|emb|CAM08672.1| endopeptidase [Neisseria meningitidis Z2491]
 gi|308389431|gb|ADO31751.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis alpha710]
 gi|319410578|emb|CBY90947.1| ATP-dependent Clp protease proteolytic subunit (endopeptidase Clp)
           [Neisseria meningitidis WUE 2594]
          Length = 204

 Score =  239 bits (609), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 120/197 (60%), Positives = 156/197 (79%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 187 KEYGLIDQVLENRASLQ 203


>gi|161486690|ref|YP_719644.2| ATP-dependent Clp protease proteolytic subunit [Haemophilus somnus
           129PT]
          Length = 193

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 123/193 (63%), Positives = 160/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F+TG++ED MA LI AQLLFLEAE+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLTGEVEDRMANLIVAQLLFLEAEDPAKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALP+AR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDVRTLCIGQACSMGAFLLAGGTAGKRAALPHARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G++ E++E+  DRD+ MSA +A
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIEQIEQDTDRDNFMSAEQA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 KLYGLVDEVLIKR 193


>gi|223938520|ref|ZP_03630412.1| Endopeptidase Clp [bacterium Ellin514]
 gi|223892782|gb|EEF59251.1| Endopeptidase Clp [bacterium Ellin514]
          Length = 215

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 114/194 (58%), Positives = 151/194 (77%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMVVEQT RGER YDIYSRLL +RIVF+   ++D +A LI AQLLFL+  +P+K+I L
Sbjct: 10  LVPMVVEQTGRGERGYDIYSRLLVDRIVFLGTPVDDMVANLIIAQLLFLQMSDPKKDIHL 69

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG+AIYDTMQF+   ++T+C+GQAASMG++LL  G KG R+ALPNA I++
Sbjct: 70  YINSPGGSVTAGLAIYDTMQFLTCDVNTYCIGQAASMGAVLLCGGTKGKRYALPNANIMI 129

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQ  GG  GQASD+E   + ++++K+RLN I  K+ GK  E+VEK  DRD+ M++ EA  
Sbjct: 130 HQVLGGAEGQASDVEIRVKYMLRLKQRLNGIISKHTGKPIEQVEKDCDRDNFMTSDEAKA 189

Query: 198 WGVVDKVLMSRIDI 211
           +G+VD+V+ SR +I
Sbjct: 190 YGLVDEVVQSRKEI 203


>gi|145635952|ref|ZP_01791637.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittAA]
 gi|319897851|ref|YP_004136048.1| ATP-dependent clp protease proteolytic subunit [Haemophilus
           influenzae F3031]
 gi|145266785|gb|EDK06804.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae PittAA]
 gi|301169432|emb|CBW29032.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           proteases [Haemophilus influenzae 10810]
 gi|317433357|emb|CBY81736.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus
           influenzae F3031]
          Length = 193

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LN+    + G++ E +EK  DRD+ MSA EA
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQSIERIEKDTDRDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 181 QVYGLVDEVLVKR 193


>gi|208779709|ref|ZP_03247053.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Francisella
           novicida FTG]
 gi|208744164|gb|EDZ90464.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Francisella
           novicida FTG]
          Length = 201

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 116/200 (58%), Positives = 155/200 (77%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +   LVP V+E+T  GER++DIYSRLLKERIVF+ G++ DH A L+ AQLLFLE+E+P K
Sbjct: 2   ITNNLVPTVIEKTAGGERAFDIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESEDPNK 61

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I  YINSPGG+VTAGM +YDTMQFIKP +ST C+G AASMGSLLL+ G KG R++LP++
Sbjct: 62  DIYFYINSPGGMVTAGMGVYDTMQFIKPDVSTICIGLAASMGSLLLAGGAKGKRYSLPSS 121

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           +I++HQP GGF GQASDIE HA++I++IK RLN++   + G+  E + K  DRD+ M A 
Sbjct: 122 QIMIHQPLGGFRGQASDIEIHAKNILRIKDRLNKVLAHHTGQDLETIVKDTDRDNFMMAD 181

Query: 194 EACDWGVVDKVLMSRIDIEE 213
           EA  +G++D V+ SR  I +
Sbjct: 182 EAKAYGLIDHVIESREAIIK 201


>gi|21241838|ref|NP_641420.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|58580656|ref|YP_199672.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|78046637|ref|YP_362812.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|84622589|ref|YP_449961.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|166710928|ref|ZP_02242135.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzicola BLS256]
 gi|188578371|ref|YP_001915300.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188992776|ref|YP_001904786.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. campestris str. B100]
 gi|289664185|ref|ZP_06485766.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. vasculorum NCPPB702]
 gi|289668776|ref|ZP_06489851.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           campestris pv. musacearum NCPPB4381]
 gi|294666562|ref|ZP_06731803.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|325914926|ref|ZP_08177258.1| ATP-dependent Clp protease proteolytic subunit ClpP [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325927441|ref|ZP_08188688.1| ATP-dependent Clp protease proteolytic subunit ClpP [Xanthomonas
           perforans 91-118]
 gi|25008307|sp|Q8PNI5|CLPP_XANAC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|67460159|sp|Q5H434|CLPP_XANOR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90183187|sp|Q3BWQ1|CLPP_XANC5 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|110816521|sp|Q2P6Z0|CLPP_XANOM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706557|sp|B0RTF7|CLPP_XANCB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706558|sp|B2SMI3|CLPP_XANOP RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|21107218|gb|AAM35956.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|58425250|gb|AAW74287.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|78035067|emb|CAJ22712.1| ATP-dependent Clp protease [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|84366529|dbj|BAE67687.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|167734536|emb|CAP52746.1| ATP-dependent Clp protease [Xanthomonas campestris pv. campestris]
 gi|188522823|gb|ACD60768.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|292603706|gb|EFF47116.1| ATP-dependent Clp protease proteolytic subunit [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|325538819|gb|EGD10483.1| ATP-dependent Clp protease proteolytic subunit ClpP [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325542191|gb|EGD13686.1| ATP-dependent Clp protease proteolytic subunit ClpP [Xanthomonas
           perforans 91-118]
          Length = 208

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 123/198 (62%), Positives = 164/198 (82%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
              L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+DHMA +I AQLLFLEA+NP+
Sbjct: 5   TKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEADNPE 64

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K+IS+YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+ALPN
Sbjct: 65  KDISIYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAASMGALLLASGAAGKRYALPN 124

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           +R+++HQP GGF GQA+DI+ HA++I+ ++ RLNEI  K+ G++ E + +  +RD+  SA
Sbjct: 125 SRVMIHQPLGGFQGQATDIDIHAREILTLRSRLNEILAKHTGQSLETIARDTERDNFKSA 184

Query: 193 SEACDWGVVDKVLMSRID 210
            +A  +G+VD+VL  R +
Sbjct: 185 VDAQAYGLVDQVLERRPE 202


>gi|329908483|ref|ZP_08274873.1| ATP-dependent Clp protease proteolytic subunit [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327546710|gb|EGF31661.1| ATP-dependent Clp protease proteolytic subunit [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 206

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 122/198 (61%), Positives = 157/198 (79%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   LG++PMV+EQ+ RGERSYDIYSRLLKER++F+ G + D +A LI AQLLFLE+ENP
Sbjct: 9   EPQMLGMIPMVIEQSGRGERSYDIYSRLLKERVIFLVGPVNDGVANLIVAQLLFLESENP 68

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+ISLYINSPGG V+AGMAI+DTMQFIKP +ST C G AASMG+ LL+AG KG RF+LP
Sbjct: 69  DKDISLYINSPGGSVSAGMAIFDTMQFIKPNVSTLCTGLAASMGAFLLAAGAKGKRFSLP 128

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+RI++HQPSGG  GQA+DIE  A++I+ ++ RLN I     G+T EE+ +  +RD+ MS
Sbjct: 129 NSRIMIHQPSGGAQGQATDIEIQAKEILYLRERLNGILADKTGRTIEEIRRDTERDNFMS 188

Query: 192 ASEACDWGVVDKVLMSRI 209
           A EA  +G++DKVL +R 
Sbjct: 189 ADEAEKYGMIDKVLTTRE 206


>gi|297250503|ref|ZP_06864443.2| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           polysaccharea ATCC 43768]
 gi|296838809|gb|EFH22747.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           polysaccharea ATCC 43768]
          Length = 209

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 122/208 (58%), Positives = 159/208 (76%), Gaps = 2/208 (0%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            K D       LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFL
Sbjct: 1   MKGDEMSFDNYLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I  YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG 
Sbjct: 61  ESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGK 120

Query: 127 RFALPNARILLHQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL 184
           RFALPN+RI++HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  
Sbjct: 121 RFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDT 180

Query: 185 DRDHIMSASEACDWGVVDKVLMSRIDIE 212
           DRD+ MSA EA ++G++D+VL +R+ ++
Sbjct: 181 DRDNFMSAEEAKEYGLIDQVLENRVSLQ 208


>gi|15616126|ref|NP_244431.1| ATP-dependent Clp protease proteolytic subunit [Bacillus halodurans
           C-125]
 gi|11386690|sp|Q9K709|CLPP1_BACHD RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|10176188|dbj|BAB07283.1| ATP-dependent Clp protease proteolytic subunit [Bacillus halodurans
           C-125]
          Length = 194

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 111/192 (57%), Positives = 152/192 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I AQLLFL+AE+P K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGTAIDDNVANSIVAQLLFLQAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ +
Sbjct: 61  SLYINSPGGSITAGMAIYDTMQYIKPNVSTICIGMAASMGAFLLAAGAKGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE H + I++++  LN I  +  G+  E++ K  DRD+ M+A +A
Sbjct: 121 MIHQPLGGTRGQASDIEIHTRRILEMRETLNRILAERTGQPLEQIAKDTDRDNFMTAEKA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++DKV+ +
Sbjct: 181 REYGLIDKVIET 192


>gi|116747551|ref|YP_844238.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Syntrophobacter fumaroxidans MPOB]
 gi|166214718|sp|A0LEF1|CLPP_SYNFM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|116696615|gb|ABK15803.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Syntrophobacter fumaroxidans MPOB]
          Length = 202

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 112/196 (57%), Positives = 158/196 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P+VVEQ++RGER++DIYSRLL++RI+F+   I D +A +I AQLLFLE+E+P K+I
Sbjct: 1   MSLIPIVVEQSSRGERAFDIYSRLLRDRIIFLGTAITDEVANVIIAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG+VTAG+AIYDTMQFIKP +ST CMGQAASM ++LL+AG KG R+ALP+ RI
Sbjct: 61  HFYINSPGGLVTAGLAIYDTMQFIKPNVSTLCMGQAASMAAILLAAGVKGKRYALPHVRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           +LHQP GGF GQA+D+E  A++I+K++  LN+I V++ G+  E++++  DRD  MS  +A
Sbjct: 121 MLHQPMGGFQGQATDVEIQAKEILKLREELNDILVRHTGRPVEQIQRDTDRDFYMSGEQA 180

Query: 196 CDWGVVDKVLMSRIDI 211
            ++G+VD +  SR+ I
Sbjct: 181 REYGMVDHIFTSRLSI 196


>gi|261377747|ref|ZP_05982320.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           cinerea ATCC 14685]
 gi|269146032|gb|EEZ72450.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           cinerea ATCC 14685]
          Length = 206

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 119/197 (60%), Positives = 156/197 (79%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPNVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 128

Query: 138 HQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLGGQASDIEIHARELLKIKEKLNHLMAKHCGRDLADLERDTDRDNFMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D++L +R  ++
Sbjct: 189 KEYGLIDQILENRASLQ 205


>gi|254673129|emb|CBA07904.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis alpha275]
          Length = 209

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 121/208 (58%), Positives = 158/208 (75%), Gaps = 2/208 (0%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            K D       LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFL
Sbjct: 1   MKGDEMSFDNYLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I  YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG 
Sbjct: 61  ESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGK 120

Query: 127 RFALPNARILLHQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL 184
           RFALPN+RI++HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  
Sbjct: 121 RFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDT 180

Query: 185 DRDHIMSASEACDWGVVDKVLMSRIDIE 212
           DRD+ MSA EA ++G++D++L +R  ++
Sbjct: 181 DRDNFMSAEEAKEYGLIDQILENRASLQ 208


>gi|55980584|ref|YP_143881.1| ATP-dependent Clp protease proteolytic subunit [Thermus
           thermophilus HB8]
 gi|60389682|sp|Q72L15|CLPP_THET2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|67460210|sp|Q5SKM8|CLPP_THET8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|55771997|dbj|BAD70438.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermus
           thermophilus HB8]
          Length = 194

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 107/192 (55%), Positives = 149/192 (77%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           ++P V+EQT RGER YDIYSRLLK+RI+F+   I+  +A ++ AQLLFL+A+NP +EI L
Sbjct: 2   VIPYVIEQTARGERVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V AG+AIYDTMQF++ P+ST  +G AASM +++L+AGEKG R+ALP+A++++
Sbjct: 62  YINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  G ASDI   AQ+I+K K+ LNEI  K+ G+  E+VEK  DRD+ +SA EA +
Sbjct: 122 HQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALE 181

Query: 198 WGVVDKVLMSRI 209
           +G++D+V+    
Sbjct: 182 YGLIDQVVTREE 193


>gi|256823172|ref|YP_003147135.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Kangiella
           koreensis DSM 16069]
 gi|256796711|gb|ACV27367.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Kangiella
           koreensis DSM 16069]
          Length = 205

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 128/204 (62%), Positives = 162/204 (79%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
             K  E    GL+PMVVEQT+RGERSYDIYSRLLKER++F  GQ+ED+MA  I AQ+LFL
Sbjct: 1   MSKIIETQASGLIPMVVEQTSRGERSYDIYSRLLKERVIFCVGQVEDYMANSIVAQMLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E++NP K+I LYINSPGGVVTAG++IYDTMQFI+P +ST C+GQAASMG+LLL+ G KG 
Sbjct: 61  ESDNPDKDIYLYINSPGGVVTAGLSIYDTMQFIRPDVSTVCVGQAASMGALLLTGGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R  LPN+R+++HQP GGF GQASDI  HAQ+I ++K RLN I   +CGKT EEVE+  DR
Sbjct: 121 RHTLPNSRMMIHQPLGGFQGQASDIAIHAQEITELKHRLNSIMAHHCGKTVEEVERDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRID 210
           D+ ++A EA ++G+VD ++ SR  
Sbjct: 181 DNFLTADEAVEYGLVDSIISSRKQ 204


>gi|78043074|ref|YP_359188.1| ATP-dependent Clp protease proteolytic subunit [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|90101405|sp|Q3AF96|CLPP_CARHZ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|77995189|gb|ABB14088.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 195

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 116/195 (59%), Positives = 161/195 (82%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVP+V+EQT+RGERSYDI+SRLLK+R +F+ G I+DH+A L+ AQ+LFLEAE+P+K+
Sbjct: 1   MSYLVPIVIEQTSRGERSYDIWSRLLKDRTIFIGGPIDDHVANLVIAQMLFLEAEDPEKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGGV+TAGMAIYDTMQ+IKP +ST C+GQAASMG+ LL+AG KG RF+LP AR
Sbjct: 61  IHLYINSPGGVITAGMAIYDTMQYIKPDVSTICIGQAASMGAFLLAAGAKGKRFSLPYAR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQA+DI+ HA++I++++  LNE+  K+ G+  E++E+  +RD  MSA+E
Sbjct: 121 IMIHQPLGGVQGQATDIDIHAREILRMRDMLNELLTKHTGQPKEKIERDTERDFFMSAAE 180

Query: 195 ACDWGVVDKVLMSRI 209
           A ++G++D+V+  R 
Sbjct: 181 AKEYGIIDEVITVRK 195


>gi|331005198|ref|ZP_08328592.1| ATP-dependent Clp protease proteolytic subunit [gamma
           proteobacterium IMCC1989]
 gi|330420980|gb|EGG95252.1| ATP-dependent Clp protease proteolytic subunit [gamma
           proteobacterium IMCC1989]
          Length = 208

 Score =  239 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 128/199 (64%), Positives = 159/199 (79%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
             E    GLVPMVVEQT RGERSYDIYSRLLKER++F+ GQ+EDHMA L+ AQLLFLEAE
Sbjct: 7   SQEVTNSGLVPMVVEQTARGERSYDIYSRLLKERVIFMVGQVEDHMANLVVAQLLFLEAE 66

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG  G RF 
Sbjct: 67  NPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQACSMGAFLLNAGAPGKRFC 126

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNAR ++HQPSGG  GQA+DI   A++I+KI++RLNEI  K+ G+ ++E+ +  +RD  
Sbjct: 127 LPNARTMIHQPSGGAQGQATDISIQAEEILKIRQRLNEIMAKHSGRDFDEIARDTERDRF 186

Query: 190 MSASEACDWGVVDKVLMSR 208
           MSA E+ ++G++D VL SR
Sbjct: 187 MSADESKEYGLIDDVLTSR 205


>gi|167562414|ref|ZP_02355330.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           oklahomensis EO147]
 gi|167569597|ref|ZP_02362471.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           oklahomensis C6786]
          Length = 207

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 121/209 (57%), Positives = 159/209 (76%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           M+ +    +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ 
Sbjct: 1   MASQAP--RDFEAQALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVV 58

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+ISLYINSPGG V+AGMAIYDTMQF+KP +ST CMG AASMG+ LL+
Sbjct: 59  AQLLFLESENPDKDISLYINSPGGSVSAGMAIYDTMQFVKPDVSTLCMGLAASMGAFLLA 118

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           +G KG R+ALPNAR+++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E +
Sbjct: 119 SGAKGKRYALPNARVMIHQPLGGARGQASDIEIQAREILYLKDRLNHLLAQHTGQDVERI 178

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
            +  DRD+ MS+ +A  +G++D V + R 
Sbjct: 179 ARDTDRDNFMSSEDAKAYGLIDHVSIKRP 207


>gi|325662430|ref|ZP_08151036.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 4_1_37FAA]
 gi|331086220|ref|ZP_08335302.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 9_1_43BFAA]
 gi|325471264|gb|EGC74488.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 4_1_37FAA]
 gi|330406379|gb|EGG85893.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 9_1_43BFAA]
          Length = 193

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 113/190 (59%), Positives = 149/190 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A++I AQLLFLEAE+P+K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVNDVSASVIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGMAIYDTMQFIK  +ST C+G AASMG+ LL+ G KG R+ALPNA I
Sbjct: 61  HLYINSPGGSVTAGMAIYDTMQFIKCDVSTTCIGMAASMGAFLLAGGAKGKRYALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI+  A  I+K + +LN+I  +N G+    +E   +RD+ MSA EA
Sbjct: 121 MIHQPSGGAQGQATDIKIVADHILKTRTKLNKILAENTGQDLSVIEVDTERDNYMSAEEA 180

Query: 196 CDWGVVDKVL 205
             +G++D+V+
Sbjct: 181 KAYGLIDEVI 190


>gi|304387382|ref|ZP_07369574.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           meningitidis ATCC 13091]
 gi|304338633|gb|EFM04751.1| ATP-dependent Clp protease proteolytic subunit [Neisseria
           meningitidis ATCC 13091]
          Length = 209

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 121/208 (58%), Positives = 158/208 (75%), Gaps = 2/208 (0%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            K D       LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFL
Sbjct: 1   MKGDEMSFDNYLVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I  YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG 
Sbjct: 61  ESENPDKDIFFYINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGK 120

Query: 127 RFALPNARILLHQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL 184
           RFALPN+RI++HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  
Sbjct: 121 RFALPNSRIMIHQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDT 180

Query: 185 DRDHIMSASEACDWGVVDKVLMSRIDIE 212
           DRD+ MSA EA ++G++D++L +R  ++
Sbjct: 181 DRDNFMSAEEAKEYGLIDQILENRASLQ 208


>gi|240146206|ref|ZP_04744807.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Roseburia
           intestinalis L1-82]
 gi|257201662|gb|EEU99946.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Roseburia
           intestinalis L1-82]
 gi|291536689|emb|CBL09801.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Roseburia
           intestinalis M50/1]
 gi|291537973|emb|CBL11084.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Roseburia
           intestinalis XB6B4]
          Length = 193

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 113/193 (58%), Positives = 151/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGER+YDIYSRLLK+RI+F+  ++ +  A+L  AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERNYDIYSRLLKDRIIFLGEEVNETTASLTVAQLLFLESEDPGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG+VTAG+AIYDTMQ+IK  +ST C+G AASMG+ LLS G KG R ALPNA I
Sbjct: 61  QLYINSPGGMVTAGLAIYDTMQYIKCDVSTICIGLAASMGAFLLSGGTKGKRLALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A++I+K K+RLNEI   N GK Y+ +    +RD+ MSA EA
Sbjct: 121 MIHQPSGGAKGQATEIQIAAENILKTKKRLNEILAANTGKPYDVIAADTERDYYMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D V+ +R
Sbjct: 181 KAYGLIDDVITNR 193


>gi|113867496|ref|YP_725985.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia eutropha
           H16]
 gi|194289504|ref|YP_002005411.1| ATP-dependent clp protease proteolytic subunit [Cupriavidus
           taiwanensis LMG 19424]
 gi|123033071|sp|Q0KBK4|CLPP_RALEH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706449|sp|B3R4W1|CLPP_CUPTR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|113526272|emb|CAJ92617.1| Endopeptidase Clp (type 1) [Ralstonia eutropha H16]
 gi|193223339|emb|CAQ69344.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease
           [Cupriavidus taiwanensis LMG 19424]
          Length = 216

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 121/193 (62%), Positives = 154/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP K++
Sbjct: 23  LGLVPMVVEQSGRGERAYDIYSRLLKERVVFMVGEVNDQTANLVVAQLLFLESENPDKDV 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V+AG+AIYDTMQFIKP +ST CMG AASMG+ LL+AG KG R ALPN+RI
Sbjct: 83  SLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCMGMAASMGAFLLAAGAKGKRSALPNSRI 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN I  +  G+  E++ +  DRD+ MS  +A
Sbjct: 143 MIHQPLGGARGQASDIEIQAREILYLRERLNTILSEVTGQPVEKIARDTDRDNFMSGDQA 202

Query: 196 CDWGVVDKVLMSR 208
            D+G++DKVL  R
Sbjct: 203 VDYGLIDKVLARR 215


>gi|209517482|ref|ZP_03266323.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. H160]
 gi|209502136|gb|EEA02151.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. H160]
          Length = 218

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 114/204 (55%), Positives = 152/204 (74%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
                     LGLVP V+EQ+ RGER+YDIYSRLL+ERIVF+ G + +  A+LI AQLLF
Sbjct: 1   MPSSYPSVSALGLVPTVIEQSGRGERAYDIYSRLLRERIVFLVGPVNEQSASLIVAQLLF 60

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP K+I  YINSPGG V  G+AIYDTMQFIKP +ST C G AASMG+ LL+AG++G
Sbjct: 61  LESENPDKDICFYINSPGGSVYDGLAIYDTMQFIKPEVSTLCTGFAASMGTFLLTAGQRG 120

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            R+ALPNARI++HQPSGG  G A+D+E  A++++ ++ RLN +  +  G++ EE+ +  D
Sbjct: 121 KRYALPNARIMIHQPSGGGQGTAADVEIQAKEVLYVRARLNAMMAERTGRSIEEISRDTD 180

Query: 186 RDHIMSASEACDWGVVDKVLMSRI 209
           RD+ MSA EA D+G++D VL +R 
Sbjct: 181 RDNFMSALEARDYGLIDDVLEARA 204


>gi|86159772|ref|YP_466557.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|220918591|ref|YP_002493895.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|115311353|sp|Q2IEW1|CLPP_ANADE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|254763782|sp|B8J5G7|CLPP_ANAD2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|85776283|gb|ABC83120.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|219956445|gb|ACL66829.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 203

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 111/203 (54%), Positives = 159/203 (78%), Gaps = 2/203 (0%)

Query: 16  LGLVPM--VVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +  +PM  VVEQT+RGERSYDIYSRLLK+RI+F+   ++D +A +I AQLLFLE+E+P K
Sbjct: 1   MPYIPMPYVVEQTHRGERSYDIYSRLLKDRIIFLGTPVDDDVANVIIAQLLFLESEDPDK 60

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I+LYINSPGG VT+G+AIYDTMQ++KP +ST C+GQAASMG+ LL+ G  G RFA+PNA
Sbjct: 61  DINLYINSPGGSVTSGLAIYDTMQYVKPQVSTICLGQAASMGAFLLAGGAAGKRFAVPNA 120

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           RI++HQ SGGF GQA+DIE  A++ +++K +LNEI  ++  +  E +E+  +RD+ MSA 
Sbjct: 121 RIMIHQLSGGFQGQATDIEIQAKEALRLKAKLNEIMARHTRQPIERIERDTERDYFMSAG 180

Query: 194 EACDWGVVDKVLMSRIDIEEKSK 216
           EA ++G++D V + +   ++K +
Sbjct: 181 EAKEYGLIDDVFLHKKAADKKPQ 203


>gi|16332068|ref|NP_442796.1| ATP-dependent Clp protease proteolytic subunit [Synechocystis sp.
           PCC 6803]
 gi|2493737|sp|Q59993|CLPP2_SYNY3 RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|1001377|dbj|BAA10867.1| ATP-dependent Clp protease proteolytic subunit [Synechocystis sp.
           PCC 6803]
          Length = 226

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 107/211 (50%), Positives = 153/211 (72%), Gaps = 1/211 (0%)

Query: 3   FEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQ 62
           +         +    +VPMVVEQ+  GER++DIYSRLL+ERI+F+   ++D +A  I AQ
Sbjct: 8   YRSPLSTLGGNNIQSVVPMVVEQSGMGERAFDIYSRLLRERIIFLGTPVDDQVADSIVAQ 67

Query: 63  LLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAG 122
           LLFL+AE+P+K+I LYINSPGG V AG+AIYDTMQ I+P + T C G AASMG+ LLS G
Sbjct: 68  LLFLDAEDPEKDIQLYINSPGGSVYAGLAIYDTMQQIRPDVVTICFGLAASMGAFLLSGG 127

Query: 123 EKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK 182
            KG R ALP++RI++HQP GG  GQA +IE  A++I+ IK RLN + V++ G+  E++++
Sbjct: 128 CKGKRMALPSSRIMIHQPLGGAQGQAVEIEIQAREILYIKDRLNTMLVEHTGQPMEKLQE 187

Query: 183 TLDRDHIMSASEACDWGVVDKVLMSRIDIEE 213
             +RD  MSA EA ++G++D+V+ SR ++ +
Sbjct: 188 DTERDFFMSAEEAKEYGLIDQVI-SRPNLPD 217


>gi|311695076|gb|ADP97949.1| ATP-dependent Clp protease, proteolytic subunit ClpP [marine
           bacterium HP15]
          Length = 201

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 115/197 (58%), Positives = 151/197 (76%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
                GLVP+V+EQT RGERS+DIYSRLLKER++F+ G +EDHMA LI AQLLFLE+ENP
Sbjct: 1   MVTNSGLVPIVIEQTARGERSFDIYSRLLKERVIFMVGPVEDHMANLIVAQLLFLESENP 60

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+I LYINSPGG VTAGM+IYDTMQFIKP ++T C+GQAASMG+ LL+ G  G R  LP
Sbjct: 61  DKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVATLCVGQAASMGAFLLAGGAAGKRACLP 120

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GG+ GQA+DIE H ++I+KI+  LN I   + G+  E + K  DRD+ M 
Sbjct: 121 NSRVMIHQPLGGYQGQATDIEIHTREILKIRHTLNSILAHHTGQDLETIAKDTDRDNFMD 180

Query: 192 ASEACDWGVVDKVLMSR 208
            ++A ++G++D +L  R
Sbjct: 181 PAQAKEYGLIDSILDKR 197


>gi|158321199|ref|YP_001513706.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Alkaliphilus
           oremlandii OhILAs]
 gi|167008645|sp|A8MIS8|CLPP_ALKOO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|158141398|gb|ABW19710.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Alkaliphilus
           oremlandii OhILAs]
          Length = 195

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 116/195 (59%), Positives = 151/195 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLKERI+F++ ++ D  A+L+ AQLLFLE+E+P K+I
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKERIIFLSDEVNDATASLVVAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTM +IKP +ST C+G AASMG+ LL+AG+KG RFALPNA I
Sbjct: 61  QLYINSPGGSITAGMAIYDTMNYIKPDVSTICIGMAASMGAFLLTAGQKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA DI  H + I+K++  LN+I  +  G+  E+V+K  DRD  M A EA
Sbjct: 121 MIHQPLGGTRGQAEDIRIHTERILKMRETLNKIIAERTGQPLEKVQKDTDRDFFMEAEEA 180

Query: 196 CDWGVVDKVLMSRID 210
             +G++D+V+ +   
Sbjct: 181 RAYGIIDEVITTAKK 195


>gi|94958239|gb|ABF47251.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           xylosus]
          Length = 194

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 108/190 (56%), Positives = 149/190 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+E TNRGER+YDIYSRLLK+RI+ +  QI+D++A  I +QLLFL+A++ +K+I
Sbjct: 1   MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDAEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG AIYDT+Q IKP + T C+G AASMGS LL+AG KG RFALPNA +
Sbjct: 61  YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A  I+K + +LN+I  +  G++ E++EK  DRD+ +SA EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAANHILKTRAKLNQILAERTGQSIEKIEKDTDRDNFLSAEEA 180

Query: 196 CDWGVVDKVL 205
            ++G+VD+V+
Sbjct: 181 KEYGLVDQVM 190


>gi|30023185|ref|NP_834816.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           ATCC 14579]
 gi|47567358|ref|ZP_00238071.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus G9241]
 gi|49481130|ref|YP_039138.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|52140414|ref|YP_086415.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           E33L]
 gi|75759660|ref|ZP_00739744.1| ATP-dependent endopeptidase clp proteolytic subunit clpP [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|118480187|ref|YP_897338.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis str. Al Hakam]
 gi|190015186|ref|YP_001966706.1| ATP-dependent Clp protease, proteolytic subunit [Bacillus cereus]
 gi|190015451|ref|YP_001967031.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus]
 gi|190015619|ref|YP_001967344.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus]
 gi|196032944|ref|ZP_03100357.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus W]
 gi|196039610|ref|ZP_03106915.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus NVH0597-99]
 gi|196045601|ref|ZP_03112831.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus 03BB108]
 gi|206970378|ref|ZP_03231331.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus AH1134]
 gi|208702014|ref|YP_002267309.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus H3081.97]
 gi|217956873|ref|YP_002335967.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           AH187]
 gi|217962631|ref|YP_002341203.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           AH187]
 gi|218231097|ref|YP_002369926.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           B4264]
 gi|218848317|ref|YP_002455085.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus AH820]
 gi|218900271|ref|YP_002448682.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus G9842]
 gi|218906323|ref|YP_002454157.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus AH820]
 gi|222098603|ref|YP_002532661.1| ATP-dependent clp protease proteolytic subunit [Bacillus cereus Q1]
 gi|225867113|ref|YP_002752491.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus 03BB102]
 gi|228903623|ref|ZP_04067744.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis IBL 4222]
 gi|228910978|ref|ZP_04074786.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis IBL 200]
 gi|228917753|ref|ZP_04081294.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228923875|ref|ZP_04087152.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228930150|ref|ZP_04093159.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228936434|ref|ZP_04099232.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228942286|ref|ZP_04104825.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228948867|ref|ZP_04111142.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228955388|ref|ZP_04117393.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228961377|ref|ZP_04122991.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228968242|ref|ZP_04129240.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228975215|ref|ZP_04135773.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228981853|ref|ZP_04142148.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis Bt407]
 gi|228988373|ref|ZP_04148465.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229072597|ref|ZP_04205799.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           F65185]
 gi|229082356|ref|ZP_04214819.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock4-2]
 gi|229087619|ref|ZP_04219749.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock3-44]
 gi|229094242|ref|ZP_04225321.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock3-42]
 gi|229112558|ref|ZP_04242095.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock1-15]
 gi|229124654|ref|ZP_04253836.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           95/8201]
 gi|229130395|ref|ZP_04259353.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           BDRD-Cer4]
 gi|229147676|ref|ZP_04276019.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           BDRD-ST24]
 gi|229153305|ref|ZP_04281483.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           m1550]
 gi|229158714|ref|ZP_04286772.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           ATCC 4342]
 gi|229164770|ref|ZP_04292604.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           R309803]
 gi|229181405|ref|ZP_04308733.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           172560W]
 gi|229187359|ref|ZP_04314502.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           BGSC 6E1]
 gi|229193390|ref|ZP_04320339.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           ATCC 10876]
 gi|254724422|ref|ZP_05186206.1| ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis
           str. A1055]
 gi|296505568|ref|YP_003667268.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis BMB171]
 gi|301056609|ref|YP_003794820.1| ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis
           CI]
 gi|67460463|sp|Q631K2|CLPP2_BACCZ RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|67460476|sp|Q6HBD8|CLPP2_BACHK RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|67460524|sp|Q815J6|CLPP2_BACCR RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|17981472|gb|AAL51030.1|AF454757_1 ClpP1 [Bacillus thuringiensis]
 gi|29898745|gb|AAP12017.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           ATCC 14579]
 gi|47555979|gb|EAL14317.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus G9241]
 gi|49332686|gb|AAT63332.1| ATP-dependent Clp protease, proteolytic subunit (endopeptidase Clp)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|51973883|gb|AAU15433.1| ATP-dependent Clp protease, proteolytic subunit (endopeptidase Clp)
           [Bacillus cereus E33L]
 gi|74492856|gb|EAO55988.1| ATP-dependent endopeptidase clp proteolytic subunit clpP [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|116584526|gb|ABK00643.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus]
 gi|116584862|gb|ABK00977.1| ATP-dependent Clp protease, proteolytic subunit [Bacillus cereus]
 gi|116585132|gb|ABK01241.1| ATP-dependent Clp protease, proteolytic subunit [Bacillus cereus]
 gi|118419412|gb|ABK87831.1| ATP-dependent Clp protease proteolytic subunit ClpP [Bacillus
           thuringiensis str. Al Hakam]
 gi|195994373|gb|EDX58328.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus W]
 gi|196023432|gb|EDX62109.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus 03BB108]
 gi|196029770|gb|EDX68372.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus NVH0597-99]
 gi|206734955|gb|EDZ52124.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus AH1134]
 gi|208657869|gb|ACI30239.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus H3081.97]
 gi|217064081|gb|ACJ78331.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus AH187]
 gi|217068436|gb|ACJ82684.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus AH187]
 gi|218159054|gb|ACK59046.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus B4264]
 gi|218536274|gb|ACK88672.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus AH820]
 gi|218540368|gb|ACK92764.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus AH820]
 gi|218541218|gb|ACK93612.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus G9842]
 gi|221242662|gb|ACM15372.1| ATP-dependent Clp protease, proteolytic subunit (endopeptidase Clp)
           [Bacillus cereus Q1]
 gi|225789761|gb|ACO29978.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           cereus 03BB102]
 gi|228590104|gb|EEK47974.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           ATCC 10876]
 gi|228596063|gb|EEK53740.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           BGSC 6E1]
 gi|228601980|gb|EEK59473.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           172560W]
 gi|228618700|gb|EEK75692.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           R309803]
 gi|228624698|gb|EEK81467.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           ATCC 4342]
 gi|228629909|gb|EEK86560.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           m1550]
 gi|228635689|gb|EEK92176.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           BDRD-ST24]
 gi|228653094|gb|EEL08974.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           BDRD-Cer4]
 gi|228658805|gb|EEL14463.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           95/8201]
 gi|228670938|gb|EEL26245.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock1-15]
 gi|228689234|gb|EEL43056.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock3-42]
 gi|228695735|gb|EEL48590.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock3-44]
 gi|228700788|gb|EEL53311.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock4-2]
 gi|228710573|gb|EEL62546.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           F65185]
 gi|228771354|gb|EEM19828.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228777965|gb|EEM26237.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis Bt407]
 gi|228784494|gb|EEM32515.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228791415|gb|EEM39019.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228798262|gb|EEM45261.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228804180|gb|EEM50794.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228810829|gb|EEM57175.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228817330|gb|EEM63416.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228823266|gb|EEM69100.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228829435|gb|EEM75063.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228835674|gb|EEM81038.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228841990|gb|EEM87096.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228848633|gb|EEM93479.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis IBL 200]
 gi|228856052|gb|EEN00591.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis IBL 4222]
 gi|296326620|gb|ADH09548.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis BMB171]
 gi|300378778|gb|ADK07682.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           biovar anthracis str. CI]
 gi|324329059|gb|ADY24319.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar finitimus YBT-020]
 gi|326942942|gb|AEA18838.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 193

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 105/193 (54%), Positives = 153/193 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLE+++P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG R+ALPN+ +
Sbjct: 61  HIYINSPGGSITAGMAIYDTMQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN+I     G+  E +++  DRD+ M+A +A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQPLEVLQRDTDRDNFMTAEKA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DK+  +R
Sbjct: 181 LEYGLIDKIFTNR 193


>gi|138896648|ref|YP_001127101.1| ATP-dependent Clp protease proteolytic subunit [Geobacillus
           thermodenitrificans NG80-2]
 gi|196249350|ref|ZP_03148048.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacillus
           sp. G11MC16]
 gi|166201825|sp|A4ISQ2|CLPP_GEOTN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|134268161|gb|ABO68356.1| ATP-dependent Clp protease [Geobacillus thermodenitrificans NG80-2]
 gi|196211107|gb|EDY05868.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacillus
           sp. G11MC16]
          Length = 196

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 111/195 (56%), Positives = 153/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+F+   I+D +A  I +QLLFL AE+P+K+I
Sbjct: 1   MYLIPTVIEQTNRGERAYDIYSRLLKDRIIFLGSPIDDQVANSIVSQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAG+AIYDTMQFIKP +ST C+G AASMG+ LL+AG KG RFALPN+ +
Sbjct: 61  SLYINSPGGSITAGLAIYDTMQFIKPDVSTICIGMAASMGAFLLAAGAKGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN I  +N G+  E +E+  DRD+ M+A +A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLRDKLNRILAENTGQPIEVIERDTDRDNFMTAQKA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D+VL    D
Sbjct: 181 QEYGIIDRVLTRLED 195


>gi|254805112|ref|YP_003083333.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis alpha14]
 gi|254668654|emb|CBA06317.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis alpha14]
          Length = 204

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 119/197 (60%), Positives = 156/197 (79%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D++L +R  ++
Sbjct: 187 KEYGLIDQILENRASLQ 203


>gi|167627759|ref|YP_001678259.1| ATP-dependent Clp protease proteolytic subunit [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|241668323|ref|ZP_04755901.1| endopeptidase Clp [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254876856|ref|ZP_05249566.1| ATP-dependent Clp protease subunit P [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|189082458|sp|B0TZA5|CLPP_FRAP2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|167597760|gb|ABZ87758.1| Endopeptidase Clp [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
 gi|254842877|gb|EET21291.1| ATP-dependent Clp protease subunit P [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 201

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 114/200 (57%), Positives = 156/200 (78%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +   LVP V+E+T  GER++DIYSRLLKERIVF+ G++ DH A L+ AQLLFLE+E+P K
Sbjct: 2   ITNNLVPTVIEKTAGGERAFDIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESEDPDK 61

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I  YINSPGG+VTAGM +YDTMQFIKP ++T C+G AASMGSLLL+ G KG R++LP++
Sbjct: 62  DIYFYINSPGGMVTAGMGVYDTMQFIKPDVNTICIGLAASMGSLLLAGGAKGKRYSLPSS 121

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           +I++HQP GGF GQASDIE HA++I++IK RLN++   + G+  E + +  DRD+ M A 
Sbjct: 122 QIMIHQPLGGFRGQASDIEIHAKNILRIKDRLNKVLAHHTGQDLETIVRDTDRDNFMMAD 181

Query: 194 EACDWGVVDKVLMSRIDIEE 213
           EA ++G++D V+ SR  I +
Sbjct: 182 EAKEYGLIDHVIESREAIIK 201


>gi|218295537|ref|ZP_03496350.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermus
           aquaticus Y51MC23]
 gi|218244169|gb|EED10695.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermus
           aquaticus Y51MC23]
          Length = 194

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 106/192 (55%), Positives = 148/192 (77%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           ++P V+EQT RGER YDIYSRLLK+RI+F+   I+  +A  I AQLLFL+A+NP +EI L
Sbjct: 2   VIPYVIEQTARGERVYDIYSRLLKDRIIFLGTPIDAQVANTIVAQLLFLDAQNPNQEIRL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V AG+AIYDTMQF++ P+ST  +G AASM +++L+AGEKG R+ALP++++++
Sbjct: 62  YINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHSKVMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  G ASDI   AQ+I+K K+ LNEI  K+ G+  E+VE+  DRD+ +SA EA +
Sbjct: 122 HQPWGGARGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVERDTDRDYYLSAQEALE 181

Query: 198 WGVVDKVLMSRI 209
           +G++D+V+    
Sbjct: 182 YGLIDQVVTREE 193


>gi|121635023|ref|YP_975268.1| endopeptidase [Neisseria meningitidis FAM18]
 gi|161870184|ref|YP_001599354.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis 053442]
 gi|166201829|sp|A1KUD9|CLPP_NEIMF RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082461|sp|A9LZN9|CLPP_NEIM0 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|120866729|emb|CAM10482.1| endopeptidase [Neisseria meningitidis FAM18]
 gi|161595737|gb|ABX73397.1| ATP-dependent Clp protease, proteolytic subunit [Neisseria
           meningitidis 053442]
 gi|261392408|emb|CAX49950.1| ATP-dependent Clp protease proteolytic subunit (endopeptidase Clp)
           [Neisseria meningitidis 8013]
 gi|325128392|gb|EGC51275.1| endopeptidase Clp [Neisseria meningitidis N1568]
 gi|325130325|gb|EGC53091.1| endopeptidase Clp [Neisseria meningitidis OX99.30304]
 gi|325132488|gb|EGC55181.1| endopeptidase Clp [Neisseria meningitidis M6190]
 gi|325134447|gb|EGC57092.1| endopeptidase Clp [Neisseria meningitidis M13399]
 gi|325136185|gb|EGC58793.1| endopeptidase Clp [Neisseria meningitidis M0579]
 gi|325138262|gb|EGC60831.1| endopeptidase Clp [Neisseria meningitidis ES14902]
 gi|325142516|gb|EGC64917.1| endopeptidase Clp [Neisseria meningitidis 961-5945]
 gi|325198463|gb|ADY93919.1| endopeptidase Clp [Neisseria meningitidis G2136]
 gi|325201978|gb|ADY97432.1| endopeptidase Clp [Neisseria meningitidis M01-240149]
 gi|325204312|gb|ADY99765.1| endopeptidase Clp [Neisseria meningitidis M01-240355]
 gi|325208271|gb|ADZ03723.1| endopeptidase Clp [Neisseria meningitidis NZ-05/33]
          Length = 204

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 119/197 (60%), Positives = 156/197 (79%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D++L +R  ++
Sbjct: 187 KEYGLIDQILENRASLQ 203


>gi|292670226|ref|ZP_06603652.1| ATP-dependent Clp protease proteolytic subunit [Selenomonas noxia
           ATCC 43541]
 gi|292648178|gb|EFF66150.1| ATP-dependent Clp protease proteolytic subunit [Selenomonas noxia
           ATCC 43541]
          Length = 197

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 109/196 (55%), Positives = 155/196 (79%), Gaps = 1/196 (0%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVE ++RGER+YDIYSRLLKERI+F+ G I+D +A ++ AQ+LFLE+E+P K+I LYIN
Sbjct: 1   MVVENSSRGERAYDIYSRLLKERIIFLGGPIDDSVANVVVAQMLFLESEDPDKDIHLYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGGVVTAG+AIYDTMQ+IKP +ST C+GQAASMGS+LL+AG KG R+ALP+ARI++HQP
Sbjct: 61  SPGGVVTAGLAIYDTMQYIKPDVSTICIGQAASMGSILLTAGAKGKRYALPHARIMIHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
            GG  GQ++DI+  A++I++++   N I  ++ G+  +++    +RD+ MSA EA  +G+
Sbjct: 121 LGGAQGQSTDIQIQAKEILRLREVGNHILARHTGQDEKKINVDTERDNFMSAEEAKAYGL 180

Query: 201 VDKVLMSRIDIEEKSK 216
           +D+V+  R   E  +K
Sbjct: 181 IDEVVT-RPKTEPAAK 195


>gi|283479306|emb|CAY75222.1| ATP-dependent Clp protease proteolytic subunit clpP [Erwinia
           pyrifoliae DSM 12163]
          Length = 218

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 132/209 (63%), Positives = 171/209 (81%), Gaps = 2/209 (0%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS+ G  +++     + LVPMVVEQT+RGERSYDIYSRLLKERI+F+TGQ+EDHMA LI 
Sbjct: 12  MSYSG--ERELTAPHMALVPMVVEQTSRGERSYDIYSRLLKERIIFLTGQVEDHMANLIV 69

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQ+LFLEAENP+K+I LYINSPGGV+TAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+
Sbjct: 70  AQMLFLEAENPEKDIHLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQACSMGAFLLT 129

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
           AG KG R+ LPN+R+++HQP GGF GQASDI+ HA++I+K K+ +NE+  K+ G+T E +
Sbjct: 130 AGAKGKRYCLPNSRVMIHQPLGGFQGQASDIDIHAREIIKTKQMMNELMAKHTGQTIETI 189

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRI 209
           E+  +RD  +SASE+ ++G+VD VL  R 
Sbjct: 190 ERDTNRDRFLSASESVEYGLVDSVLSQRS 218


>gi|91785004|ref|YP_560210.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           xenovorans LB400]
 gi|116243097|sp|Q13UT1|CLPP1_BURXL RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|91688958|gb|ABE32158.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           xenovorans LB400]
          Length = 215

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 113/206 (54%), Positives = 153/206 (74%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
                     LGLVP V+EQ+ RGER+YDIYSRLL+ERIVF+ G + +  A++I AQLLF
Sbjct: 1   MHSSYPTITGLGLVPTVIEQSGRGERAYDIYSRLLRERIVFLVGPVNEQSASVIVAQLLF 60

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP K+IS YINSPGG V  G+AIYDTMQFIKP +ST C G AASMG+ LL+AG++G
Sbjct: 61  LESENPDKDISFYINSPGGSVYDGLAIYDTMQFIKPEVSTLCTGFAASMGTFLLTAGQRG 120

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            R+ALPNARI++HQPSGG  G A+D+E  A++++ ++ RLN +  +  G++ EE+ +  D
Sbjct: 121 KRYALPNARIMIHQPSGGSQGTAADVEIQAKEVLYLRERLNAMMAERTGRSIEEIARDTD 180

Query: 186 RDHIMSASEACDWGVVDKVLMSRIDI 211
           RD+ MSA  A  +G+VD+VL +R  +
Sbjct: 181 RDNFMSAHAAKTYGLVDEVLETRAAL 206


>gi|167761297|ref|ZP_02433424.1| hypothetical protein CLOSCI_03702 [Clostridium scindens ATCC 35704]
 gi|167660963|gb|EDS05093.1| hypothetical protein CLOSCI_03702 [Clostridium scindens ATCC 35704]
          Length = 193

 Score =  238 bits (608), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 112/193 (58%), Positives = 151/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGERSYDIYSRLLK+RI+F+  ++ D  A++I AQLLFLEAE+P+K+I
Sbjct: 1   MSLVPYVIEQTSRGERSYDIYSRLLKDRIIFLGEEVTDVSASVIVAQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG+AIYDTMQ+IK  I T C+G AASMGS LL+ G KG R ALPNA I
Sbjct: 61  HLYINSPGGSVTAGLAIYDTMQYIKCDIETICIGMAASMGSFLLAGGTKGKRLALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A+ I+K +++LN+I  +N G+  + +    +RD+ MSA EA
Sbjct: 121 MIHQPSGGAQGQATEIQIAAEHILKTRQKLNQILAENTGQPLDVIRIGTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D+V+ SR
Sbjct: 181 KAYGLIDEVIKSR 193


>gi|269959005|ref|YP_003328794.1| ATP-dependent Clp protease proteolytic subunit [Anaplasma centrale
           str. Israel]
 gi|269848836|gb|ACZ49480.1| ATP-dependent Clp protease proteolytic subunit [Anaplasma centrale
           str. Israel]
          Length = 215

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 138/197 (70%), Positives = 176/197 (89%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   + LVPMVVEQT+RGER+YDIYSRLLKERI+F+TG +ED+MA+LI AQL+FLEAENP
Sbjct: 14  EREIMNLVPMVVEQTSRGERAYDIYSRLLKERIIFITGTVEDNMASLIVAQLVFLEAENP 73

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +K+ISLYINSPGGVVTAG++IYDTMQ+IKP +ST C+GQAASMG+LLL+ GE GMR+ALP
Sbjct: 74  EKDISLYINSPGGVVTAGLSIYDTMQYIKPKVSTLCLGQAASMGALLLAGGEPGMRYALP 133

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+RI++HQPSGGF GQA+DIE HA++I++IKRRLNEIYVK+ GK+ EE+E +++RD+ M 
Sbjct: 134 NSRIMVHQPSGGFRGQATDIEIHAREILEIKRRLNEIYVKHTGKSLEEIESSMERDNFMV 193

Query: 192 ASEACDWGVVDKVLMSR 208
           A +A D+G+VDKV+  R
Sbjct: 194 AEKAKDFGIVDKVIDKR 210


>gi|229591362|ref|YP_002873481.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas
           fluorescens SBW25]
 gi|259585962|sp|C3JYK0|CLPP_PSEFS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|229363228|emb|CAY50311.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pseudomonas
           fluorescens SBW25]
          Length = 211

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 126/193 (65%), Positives = 158/193 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +ED+MA LICAQLLFLEAENP K+I 
Sbjct: 18  GLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLICAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG +G RF LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLLTAGAEGKRFCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQASDIE HA++I+ I+ RLN +  K+ G T EE+E+  +RD+ MSA  A 
Sbjct: 138 IHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGHTLEEIERDTNRDNFMSAEAAR 197

Query: 197 DWGVVDKVLMSRI 209
           D+G++D V+  R 
Sbjct: 198 DYGLIDAVIDKRP 210


>gi|163736126|ref|ZP_02143545.1| Endopeptidase Clp [Phaeobacter gallaeciensis BS107]
 gi|161389996|gb|EDQ14346.1| ATP-dependent Clp protease proteolytic subunit [Phaeobacter
           gallaeciensis BS107]
          Length = 202

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 124/201 (61%), Positives = 170/201 (84%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQT+RGER+YDI+SRLLKERI+F+ G + D M++LI AQLL LEAENP KE
Sbjct: 1   MNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHLEAENPSKE 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           IS+YINSPGGVVT+G++IYDTMQ+IKP +ST  +GQAASMGSLLL+AGE GMRF+LPN+R
Sbjct: 61  ISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGMRFSLPNSR 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           +++HQPSGGF GQA+DI  HA++ +K+K+RLNEIYVK+ G+ Y+++   L+RD+ MS  +
Sbjct: 121 VMVHQPSGGFQGQATDIMIHAEETLKLKKRLNEIYVKHTGQEYDKIVDALERDNFMSPED 180

Query: 195 ACDWGVVDKVLMSRIDIEEKS 215
           A D+G++D+++ +R  ++++ 
Sbjct: 181 AKDFGLIDEIVENRSKLDDQD 201


>gi|226311381|ref|YP_002771275.1| ATP-dependent Clp protease proteolytic subunit [Brevibacillus
           brevis NBRC 100599]
 gi|226094329|dbj|BAH42771.1| ATP-dependent Clp protease proteolytic subunit [Brevibacillus
           brevis NBRC 100599]
          Length = 193

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 120/192 (62%), Positives = 153/192 (79%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           L+PMV+EQT+RGERSYDIYSRLLK+RI+ +  +I+D +A LI AQLLFL+AE+P K+ISL
Sbjct: 2   LIPMVIEQTSRGERSYDIYSRLLKDRIILLGTEIDDEIANLIVAQLLFLQAEDPDKDISL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPNA +++
Sbjct: 62  YINSPGGSVTAGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRFALPNAEVMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA DI  HA+ I+K KR+LNEI  +  G+ YE VE+  DRD+ MSA EA  
Sbjct: 122 HQPLGGVRGQAEDIRIHAEWIMKTKRQLNEILSERTGQPYERVEQDTDRDNFMSAEEAKA 181

Query: 198 WGVVDKVLMSRI 209
           +G++D ++  + 
Sbjct: 182 YGLIDSIIERKN 193


>gi|307730796|ref|YP_003908020.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1003]
 gi|307585331|gb|ADN58729.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1003]
          Length = 219

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 114/202 (56%), Positives = 150/202 (74%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
                 LGLVP V+EQ+ RGER+YDIYSRLL+ERIVF+ G + +  A+LI AQLLFLE+E
Sbjct: 5   YPPVTGLGLVPTVIEQSGRGERAYDIYSRLLRERIVFLVGPVNEQSASLIVAQLLFLESE 64

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+IS YINSPGG V  G+AIYDTMQFIKP +ST C G AASMG+ LL AG+ G R+A
Sbjct: 65  NPDKDISFYINSPGGSVYDGLAIYDTMQFIKPEVSTLCTGFAASMGTFLLCAGQPGKRYA 124

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPNARI++HQPSGG  G A+DI+  A++++ ++ RLN +  +  G+  EE+ +  DRD+ 
Sbjct: 125 LPNARIMIHQPSGGGQGTAADIDIQAKEVLYLRERLNTMMAERTGRGVEEIARDTDRDNF 184

Query: 190 MSASEACDWGVVDKVLMSRIDI 211
           MSA  A  +G+VD+VL +R  +
Sbjct: 185 MSAFAAKAYGLVDEVLETRAAL 206


>gi|222100864|ref|YP_002535432.1| ATP-dependent Clp protease proteolytic subunit [Thermotoga
           neapolitana DSM 4359]
 gi|221573254|gb|ACM24066.1| ATP-dependent Clp protease proteolytic subunit [Thermotoga
           neapolitana DSM 4359]
          Length = 200

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 115/196 (58%), Positives = 152/196 (77%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQ 72
           ++    VP+VVE T R ER+YDI+SRLLK+RIVF+   I+DH+A L+ AQLLFLEAE+P 
Sbjct: 5   EIIDQYVPIVVESTGRYERAYDIFSRLLKDRIVFLGSPIDDHVANLVIAQLLFLEAEDPD 64

Query: 73  KEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPN 132
           K++ LYINSPGG VTAG+AIYDTMQ+IK  +ST C+GQAASM ++LL+AG KG R+ALPN
Sbjct: 65  KDVYLYINSPGGSVTAGLAIYDTMQYIKCDVSTICVGQAASMAAVLLAAGTKGKRYALPN 124

Query: 133 ARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSA 192
           ARI++HQP GG  G A D+E   +++++IK  LN I  K+ G+  E++EK  DRD  MSA
Sbjct: 125 ARIMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSA 184

Query: 193 SEACDWGVVDKVLMSR 208
            EA ++G+VDKV+ SR
Sbjct: 185 EEAKEYGIVDKVVSSR 200


>gi|325144548|gb|EGC66847.1| endopeptidase Clp [Neisseria meningitidis M01-240013]
          Length = 204

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 119/197 (60%), Positives = 155/197 (78%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 7   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 66

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 67  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 126

Query: 138 HQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 127 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 186

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D++L +R  + 
Sbjct: 187 KEYGLIDQILENRASLR 203


>gi|261364459|ref|ZP_05977342.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           mucosa ATCC 25996]
 gi|288567379|gb|EFC88939.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Neisseria
           mucosa ATCC 25996]
          Length = 206

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 120/197 (60%), Positives = 156/197 (79%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLIGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAGEKG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPNVSTLCLGQAASMGAFLLSAGEKGKRFALPNSRIMI 128

Query: 138 HQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP       GQASDIE HA++++KIK +LN +  K+CG+   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDTDRDNFMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 189 KEYGLIDQVLENRASLQ 205


>gi|169824905|ref|YP_001692516.1| ATP-dependent protease Clp proteolytic subunit [Finegoldia magna
           ATCC 29328]
 gi|297587291|ref|ZP_06945936.1| ATP-dependent Clp protease proteolytic subunit [Finegoldia magna
           ATCC 53516]
 gi|302379561|ref|ZP_07268046.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Finegoldia
           magna ACS-171-V-Col3]
 gi|303234189|ref|ZP_07320835.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Finegoldia
           magna BVS033A4]
 gi|167831710|dbj|BAG08626.1| ATP-dependent protease Clp proteolytic subunit [Finegoldia magna
           ATCC 29328]
 gi|297575272|gb|EFH93991.1| ATP-dependent Clp protease proteolytic subunit [Finegoldia magna
           ATCC 53516]
 gi|302312468|gb|EFK94464.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Finegoldia
           magna ACS-171-V-Col3]
 gi|302494730|gb|EFL54490.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Finegoldia
           magna BVS033A4]
          Length = 195

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 117/195 (60%), Positives = 158/195 (81%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQ+NRGERSYDI+SRLLKERI+FVTG++ D MA L+ AQLLFLE+E+P+K+
Sbjct: 1   MPSLVPMVVEQSNRGERSYDIFSRLLKERIIFVTGEVNDQMADLVIAQLLFLESEDPKKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGG V+AG+AIYDTMQ++KP +ST C+G AASMG++LL++G KG R+ALPNA 
Sbjct: 61  IQLYINSPGGSVSAGLAIYDTMQYVKPDVSTICVGMAASMGAILLTSGAKGKRYALPNAD 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
            L+HQP GG  GQASDIE HA++I+K +  LN+I  +  G+  E++E+  DRD I++A E
Sbjct: 121 TLIHQPLGGAQGQASDIEIHAKNILKKRELLNKILSERTGQPLEKIERDTDRDFILTAEE 180

Query: 195 ACDWGVVDKVLMSRI 209
           A ++G++D+V+ +  
Sbjct: 181 AKEYGLIDEVIYTSK 195


>gi|255528525|ref|ZP_05395307.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           carboxidivorans P7]
 gi|296184877|ref|ZP_06853288.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           carboxidivorans P7]
 gi|255507783|gb|EET84241.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           carboxidivorans P7]
 gi|296050659|gb|EFG90082.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           carboxidivorans P7]
          Length = 194

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 118/194 (60%), Positives = 157/194 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+R+V +T ++ D  A+L+ AQLLFLEAE+P K+I
Sbjct: 1   MSLVPVVVEQTNRGERSYDIYSRLLKDRVVMLTEEVNDVTASLVVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LL+AG KG R ALPNA I
Sbjct: 61  YLYINSPGGSITAGMAIYDTMQYIKPDVSTICIGMAASMGAFLLNAGAKGKRVALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI  HA+ I+KIK++LN I+ +  G+  E +EK  +RD+ MSA EA
Sbjct: 121 MIHQPLGGFQGQATDIGIHAERILKIKKKLNTIFSERTGQPLETIEKDTERDNFMSAEEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D++++ + 
Sbjct: 181 KEYGLIDEIMVKKK 194


>gi|296157194|ref|ZP_06840030.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. Ch1-1]
 gi|295892530|gb|EFG72312.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. Ch1-1]
          Length = 215

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 113/206 (54%), Positives = 153/206 (74%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
                     LGLVP V+EQ+ RGER+YDIYSRLL+ERIVF+ G + +  A++I AQLLF
Sbjct: 1   MHSSYPTITGLGLVPTVIEQSGRGERAYDIYSRLLRERIVFLVGPVNEQSASVIVAQLLF 60

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP K+IS YINSPGG V  G+AIYDTMQFIKP +ST C G AASMG+ LL+AG++G
Sbjct: 61  LESENPDKDISFYINSPGGSVYDGLAIYDTMQFIKPEVSTLCTGFAASMGTFLLTAGQRG 120

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            R+ALPNARI++HQPSGG  G A+D+E  A++++ ++ RLN +  +  G++ EE+ +  D
Sbjct: 121 KRYALPNARIMIHQPSGGSQGTAADVEIQAKEVLYLRERLNAMMAERTGRSIEEIARDTD 180

Query: 186 RDHIMSASEACDWGVVDKVLMSRIDI 211
           RD+ MSA  A  +G+VD+VL +R  +
Sbjct: 181 RDNFMSAHAAKTYGLVDEVLETRAAL 206


>gi|56707749|ref|YP_169645.1| ATP-dependent Clp protease proteolytic subunit [Francisella
           tularensis subsp. tularensis SCHU S4]
 gi|89256249|ref|YP_513611.1| ATP-dependent Clp protease proteolytic subunit [Francisella
           tularensis subsp. holarctica LVS]
 gi|110670220|ref|YP_666777.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115314706|ref|YP_763429.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           holarctica OSU18]
 gi|118497648|ref|YP_898698.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           novicida U112]
 gi|134302069|ref|YP_001122038.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156502310|ref|YP_001428375.1| ATP-dependent Clp protease proteolytic subunit [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|167010854|ref|ZP_02275785.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Francisella
           tularensis subsp. holarctica FSC200]
 gi|187931471|ref|YP_001891455.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|194323619|ref|ZP_03057395.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Francisella
           tularensis subsp. novicida FTE]
 gi|224456819|ref|ZP_03665292.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|254367562|ref|ZP_04983588.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           holarctica 257]
 gi|254369239|ref|ZP_04985251.1| hypothetical protein FTAG_00191 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254370252|ref|ZP_04986258.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254373013|ref|ZP_04988502.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254374463|ref|ZP_04989944.1| hypothetical protein FTDG_00632 [Francisella novicida GA99-3548]
 gi|254874562|ref|ZP_05247272.1| ATP-dependent clp protease proteolytic subunit [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|290953590|ref|ZP_06558211.1| ATP-dependent Clp protease proteolytic subunit [Francisella
           tularensis subsp. holarctica URFT1]
 gi|295313091|ref|ZP_06803781.1| ATP-dependent Clp protease proteolytic subunit [Francisella
           tularensis subsp. holarctica URFT1]
 gi|67460184|sp|Q5NH47|CLPP_FRATT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|116243138|sp|Q2A3U1|CLPP_FRATH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|122325271|sp|Q0BM92|CLPP_FRATO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|122971012|sp|Q14IJ9|CLPP_FRAT1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201822|sp|A7NBR6|CLPP_FRATF RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201823|sp|A0Q6S9|CLPP_FRATN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201824|sp|A4IYB6|CLPP_FRATW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706451|sp|B2SG18|CLPP_FRATM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56604241|emb|CAG45257.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89144080|emb|CAJ79331.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           holarctica LVS]
 gi|110320553|emb|CAL08640.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115129605|gb|ABI82792.1| endopeptidase Clp [Francisella tularensis subsp. holarctica OSU18]
 gi|118423554|gb|ABK89944.1| ATP-dependent Clp protease subunit P [Francisella novicida U112]
 gi|134049846|gb|ABO46917.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Francisella
           tularensis subsp. tularensis WY96-3418]
 gi|134253378|gb|EBA52472.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           holarctica 257]
 gi|151568496|gb|EDN34150.1| ATP-dependent Clp protease subunit P [Francisella tularensis subsp.
           tularensis FSC033]
 gi|151570740|gb|EDN36394.1| ATP-dependent Clp protease subunit P [Francisella novicida
           GA99-3549]
 gi|151572182|gb|EDN37836.1| hypothetical protein FTDG_00632 [Francisella novicida GA99-3548]
 gi|156252913|gb|ABU61419.1| ATP-dependent Clp protease, proteolytic subunit [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|157122189|gb|EDO66329.1| hypothetical protein FTAG_00191 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|187712380|gb|ACD30677.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|194321983|gb|EDX19465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Francisella
           tularensis subsp. novicida FTE]
 gi|254840561|gb|EET18997.1| ATP-dependent clp protease proteolytic subunit [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|282158920|gb|ADA78311.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Francisella
           tularensis subsp. tularensis NE061598]
          Length = 201

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 116/200 (58%), Positives = 155/200 (77%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +   LVP V+E+T  GER++DIYSRLLKERIVF+ G++ DH A L+ AQLLFLE+E+P K
Sbjct: 2   ITNNLVPTVIEKTAGGERAFDIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESEDPDK 61

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I  YINSPGG+VTAGM +YDTMQFIKP +ST C+G AASMGSLLL+ G KG R++LP++
Sbjct: 62  DIYFYINSPGGMVTAGMGVYDTMQFIKPDVSTICIGLAASMGSLLLAGGAKGKRYSLPSS 121

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           +I++HQP GGF GQASDIE HA++I++IK RLN++   + G+  E + K  DRD+ M A 
Sbjct: 122 QIMIHQPLGGFRGQASDIEIHAKNILRIKDRLNKVLAHHTGQDLETIVKDTDRDNFMMAD 181

Query: 194 EACDWGVVDKVLMSRIDIEE 213
           EA  +G++D V+ SR  I +
Sbjct: 182 EAKAYGLIDHVIESREAIIK 201


>gi|295112117|emb|CBL28867.1| ATP-dependent Clp protease proteolytic subunit ClpP [Synergistetes
           bacterium SGP1]
          Length = 195

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 114/191 (59%), Positives = 151/191 (79%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
            +P V+EQT RGERSYDIYSRLLK+RIVF+  Q+ D +A  I AQLLFLE+E+P K+I L
Sbjct: 5   YIPYVIEQTGRGERSYDIYSRLLKDRIVFLGTQVMDDVANSIVAQLLFLESEDPDKDIHL 64

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGMAIYDTMQ+IK P+ST C+G AASM ++LLS G +G R ALPNA +++
Sbjct: 65  YINSPGGSVTAGMAIYDTMQYIKSPVSTICVGMAASMAAILLSGGARGKRLALPNAEVMI 124

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG SGQASDIE HA++I+  ++R+N I  ++ G+  E+V +  DRD+ M+A EA D
Sbjct: 125 HQPLGGTSGQASDIEIHARNILNTRKRMNAILARHTGQDVEKVAQDTDRDNFMTAQEALD 184

Query: 198 WGVVDKVLMSR 208
           +G++D+++ SR
Sbjct: 185 YGLIDRIIESR 195


>gi|22298052|ref|NP_681299.1| ATP-dependent Clp protease proteolytic subunit 1
           [Thermosynechococcus elongatus BP-1]
 gi|34222557|sp|Q8DLI2|CLPP1_THEEB RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;
           AltName: Full=Endopeptidase Clp 1
 gi|22294230|dbj|BAC08061.1| ATP-dependent Clp protease proteolytic subunit 1
           [Thermosynechococcus elongatus BP-1]
          Length = 229

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 111/201 (55%), Positives = 145/201 (72%), Gaps = 6/201 (2%)

Query: 13  DVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQ------IEDHMATLICAQLLFL 66
                +VPMVVEQ+ RGER++DIYSRLL+ERI+F+ G       I+D +A  I AQLLFL
Sbjct: 23  PTHANIVPMVVEQSGRGERAFDIYSRLLRERIIFLGGGAGDRRGIDDAVADSIVAQLLFL 82

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           +AE+P+K+I LYINSPGG VTAGMAIYDTM+ I+P + T C G AASMG+ LLS G  G 
Sbjct: 83  DAEDPEKDIYLYINSPGGSVTAGMAIYDTMKHIRPDVCTLCFGLAASMGAFLLSGGTPGK 142

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R ALPNARI++HQP GG  GQA DIE  A++I+  KR+LNE+  ++ G+  E +E   +R
Sbjct: 143 RMALPNARIMIHQPLGGAQGQAVDIEIQAREILYHKRKLNELLSQHTGQPIERIEADTER 202

Query: 187 DHIMSASEACDWGVVDKVLMS 207
           D  MSA EA  +G++D+V+  
Sbjct: 203 DFFMSAEEAKAYGLIDQVVTR 223


>gi|156362486|ref|XP_001625808.1| predicted protein [Nematostella vectensis]
 gi|156212658|gb|EDO33708.1| predicted protein [Nematostella vectensis]
          Length = 228

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 117/199 (58%), Positives = 155/199 (77%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVPMV+E T RGER+YDI+SRLLKERIV V G + D  ++L+ AQLLFL++E+ +  I +
Sbjct: 27  LVPMVIESTGRGERAYDIFSRLLKERIVCVMGPVTDETSSLVIAQLLFLQSESSKLPIHM 86

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VT+G+ IYDTMQ+I+PPIST+C+GQA SMGSLLL+AG  G+R ALP++RI++
Sbjct: 87  YINSPGGTVTSGLGIYDTMQYIQPPISTWCVGQACSMGSLLLAAGSPGLRHALPHSRIMV 146

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG SGQA+DI   A++I+K+KR LN IYVK+ GK  E +E+ L+RD  MS  EA +
Sbjct: 147 HQPHGGASGQATDIAIQAEEILKLKRVLNGIYVKHTGKDMETIEQALERDKFMSPEEAKE 206

Query: 198 WGVVDKVLMSRIDIEEKSK 216
           +G++D+VL      EE  K
Sbjct: 207 FGLIDRVLAHPPTNEELKK 225


>gi|221215056|ref|ZP_03588023.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD1]
 gi|221164992|gb|EED97471.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD1]
          Length = 208

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 120/198 (60%), Positives = 156/198 (78%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP
Sbjct: 11  EAQALGLVPIVVETSGRGERSYDIYSRLLKERLVFMVGEVNDQTANLVVAQLLFLESENP 70

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+ISLYINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G KG RFALP
Sbjct: 71  DKDISLYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLASGAKGKRFALP 130

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E + +  DRD+ MS
Sbjct: 131 NSRVMIHQPLGGARGQASDIEIQAREILYLKERLNHLLAQHTGQDVERIARDTDRDNFMS 190

Query: 192 ASEACDWGVVDKVLMSRI 209
           + +A  +G++D+VL+ R 
Sbjct: 191 SEDAKAYGLIDQVLLKRP 208


>gi|293375439|ref|ZP_06621720.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Turicibacter
           sanguinis PC909]
 gi|325844477|ref|ZP_08168204.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Turicibacter sp. HGF1]
 gi|292645992|gb|EFF64021.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Turicibacter
           sanguinis PC909]
 gi|325489151|gb|EGC91535.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Turicibacter sp. HGF1]
          Length = 199

 Score =  238 bits (607), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 105/199 (52%), Positives = 149/199 (74%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVP V+EQT  GER+YDIYSRLLK+RI+ ++G+I DH A ++ AQLLFL AE+P K+
Sbjct: 1   MSYLVPTVIEQTAHGERAYDIYSRLLKDRIIMLSGEINDHTANIVVAQLLFLAAEDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I++YINSPGG VTAG+AI+DTM +IK  +ST C+G AASMG+ LL+AG KG R+ LPN+ 
Sbjct: 61  INIYINSPGGSVTAGLAIFDTMNYIKCDVSTICVGMAASMGAFLLTAGTKGKRYVLPNSE 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           +++HQP GG  GQA++I   A+ I+K + RLN+I  +  G+  E++E+  +RD+ MSA E
Sbjct: 121 VMIHQPLGGAQGQATEIAIAAKHILKTRDRLNKILAEQTGQPLEKIEQDTERDNFMSADE 180

Query: 195 ACDWGVVDKVLMSRIDIEE 213
           A  +G+VD+V+    D+ +
Sbjct: 181 AVAYGLVDQVVTRPTDVTK 199


>gi|195952528|ref|YP_002120818.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Hydrogenobaculum sp. Y04AAS1]
 gi|195932140|gb|ACG56840.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Hydrogenobaculum sp. Y04AAS1]
          Length = 205

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 122/201 (60%), Positives = 159/201 (79%)

Query: 9   KDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEA 68
           KD + +   LVP+VVEQT RGER+YDIYSRLL++RIV +   I+DH+A LI AQLLFLEA
Sbjct: 5   KDYQKIIDQLVPIVVEQTPRGERAYDIYSRLLQDRIVILGFPIDDHVANLIVAQLLFLEA 64

Query: 69  ENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRF 128
           ++P+K+I +YINSPGG VTAG+AIYDTMQ+IKP ++T C+GQAASMG++LL+AG KG RF
Sbjct: 65  QDPEKDIQMYINSPGGSVTAGLAIYDTMQYIKPDVTTICIGQAASMGAVLLAAGTKGKRF 124

Query: 129 ALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDH 188
           ALPNARI++HQP GG  GQA+DI  HA++I +IK  LN I     GK   ++EK +DRD+
Sbjct: 125 ALPNARIMIHQPLGGVQGQATDILIHAEEIKRIKHILNTILANATGKNLRQIEKDVDRDY 184

Query: 189 IMSASEACDWGVVDKVLMSRI 209
            MSA EA ++G++DKV+  R 
Sbjct: 185 FMSAEEAKNYGLIDKVITKRA 205


>gi|312898487|ref|ZP_07757877.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Megasphaera
           micronuciformis F0359]
 gi|310620406|gb|EFQ03976.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Megasphaera
           micronuciformis F0359]
          Length = 202

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 115/201 (57%), Positives = 160/201 (79%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           + +  VP+VVEQ+++GERSYDIYSRLLK+RI+F+TG I+D +A  + AQLLFLEA+NP K
Sbjct: 1   MKMQYVPIVVEQSSQGERSYDIYSRLLKDRIIFLTGAIDDTVANSVIAQLLFLEADNPDK 60

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I LYINSPGGVVTAGMAIYDTM++IKP +ST C+G AASM S+LL+AG KG RFALP++
Sbjct: 61  DIHLYINSPGGVVTAGMAIYDTMRYIKPDVSTICVGSAASMASVLLTAGTKGKRFALPHS 120

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           ++++HQP GG  GQASDIE HA++I+++++ LN I   + G+  + +EK  +RD+ M+A 
Sbjct: 121 QVMIHQPLGGVQGQASDIEIHAREILRMRKELNGILATHTGQPVDVIEKDTERDNFMTAE 180

Query: 194 EACDWGVVDKVLMSRIDIEEK 214
           EA  +G+VD++L+   D   K
Sbjct: 181 EAKAYGLVDEILIRPGDAAVK 201


>gi|224081363|ref|XP_002306383.1| predicted protein [Populus trichocarpa]
 gi|118481948|gb|ABK92906.1| unknown [Populus trichocarpa]
 gi|222855832|gb|EEE93379.1| predicted protein [Populus trichocarpa]
          Length = 244

 Score =  238 bits (607), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 108/193 (55%), Positives = 151/193 (78%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            L+PMV+E ++RGER+YDI+SRLLKERIV + G I D  + ++ AQLLFLE+ENP K I 
Sbjct: 34  SLIPMVIEHSSRGERAYDIFSRLLKERIVCINGPINDDTSNVVVAQLLFLESENPSKPIH 93

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +Y+NSPGG VTAG+AIYDTMQ+I+ P++T C+GQAASM SLLL++G KG R ALPNA I+
Sbjct: 94  MYLNSPGGHVTAGLAIYDTMQYIRSPVNTICLGQAASMASLLLASGAKGERKALPNATIM 153

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG+SGQA D+  H + IV++   LN++Y K+ GK  + ++K +DRD+ M+  EA 
Sbjct: 154 IHQPSGGYSGQAKDLTIHTKQIVRVWDALNQLYCKHTGKPIDVIQKNMDRDYFMTPEEAK 213

Query: 197 DWGVVDKVLMSRI 209
           ++G++D+V+  R 
Sbjct: 214 EFGIIDEVIDQRP 226


>gi|229014309|ref|ZP_04171428.1| ATP-dependent Clp protease proteolytic subunit [Bacillus mycoides
           DSM 2048]
 gi|229099577|ref|ZP_04230505.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock3-29]
 gi|229105752|ref|ZP_04236381.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock3-28]
 gi|229118641|ref|ZP_04247993.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock1-3]
 gi|228664833|gb|EEL20323.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock1-3]
 gi|228677641|gb|EEL31889.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock3-28]
 gi|228683873|gb|EEL37823.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           Rock3-29]
 gi|228746909|gb|EEL96793.1| ATP-dependent Clp protease proteolytic subunit [Bacillus mycoides
           DSM 2048]
          Length = 193

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 106/193 (54%), Positives = 152/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLE+++P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG RFALPN+ +
Sbjct: 61  HIYINSPGGSITAGMAIYDTMQFIKPQVSTICIGMAASMGAFLLAAGEKGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN+I     G+  E +++  DRD+ M+A  A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQPLEVLQRDTDRDNFMTAERA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DK+  +R
Sbjct: 181 LEYGLIDKIFTNR 193


>gi|325291111|ref|YP_004267292.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Syntrophobotulus glycolicus DSM 8271]
 gi|324966512|gb|ADY57291.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Syntrophobotulus glycolicus DSM 8271]
          Length = 202

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 114/202 (56%), Positives = 156/202 (77%), Gaps = 1/202 (0%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVPMVVEQTNRGERSYDIYSRLLK+RI+F+ GQ++D+MA LI AQLLFL+AE+P+K+
Sbjct: 1   MSYLVPMVVEQTNRGERSYDIYSRLLKDRIIFLGGQVDDYMANLIVAQLLFLDAEDPEKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGG ++AGMAIYDTMQ ++  + T C+G AASMG+ LL++G KG R ALPN+ 
Sbjct: 61  IFLYINSPGGSISAGMAIYDTMQHVRADVHTICVGLAASMGAFLLASGAKGKRTALPNSE 120

Query: 135 ILLHQP-SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           IL+HQP  GG SGQA++IE HA+ I+++K R+N +  +  G+  E +E+  DRD  ++A 
Sbjct: 121 ILIHQPLLGGLSGQATEIEIHAKHILRVKERMNRLLAEMTGQPVERIEQDTDRDRYLTAQ 180

Query: 194 EACDWGVVDKVLMSRIDIEEKS 215
           EA ++G+VD++L     + +K 
Sbjct: 181 EAKEYGLVDQILEKSEQVAKKK 202


>gi|212640342|ref|YP_002316862.1| ATP-dependent Clp protease proteolytic subunit [Anoxybacillus
           flavithermus WK1]
 gi|226706440|sp|B7GL34|CLPP_ANOFW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|212561822|gb|ACJ34877.1| ATP-dependent Clp protease proteolytic subunit (class III
           heat-shock protein) [Anoxybacillus flavithermus WK1]
          Length = 196

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 111/195 (56%), Positives = 153/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQT+RGER+YDIYSRLLK+RI+ +   I+DH+A  I +QLLFL AE+P+K+I
Sbjct: 1   MNLIPTVIEQTSRGERAYDIYSRLLKDRIIILGSPIDDHVANSIVSQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  SLYINSPGGSITAGMAIYDTMQFIKPDVSTICIGMAASMGAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN I  +N G+  E +E+  DRD+ M+A +A
Sbjct: 121 MIHQPLGGVQGQATEIEIAAKRILFLRDKLNRILSENTGQPIEVIERDTDRDNFMTAEKA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D+VL    +
Sbjct: 181 KEYGLIDRVLTRVDE 195


>gi|323140768|ref|ZP_08075687.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Phascolarctobacterium sp. YIT 12067]
 gi|322414786|gb|EFY05586.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Phascolarctobacterium sp. YIT 12067]
          Length = 197

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 113/197 (57%), Positives = 158/197 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+VVEQ++RGERSYDIYSRLLK+RIVFVTG I+D+MA ++ AQLLFLE+E+P K+I
Sbjct: 1   MNYVPIVVEQSSRGERSYDIYSRLLKDRIVFVTGPIDDNMANVVIAQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AGMAIYDTMQ+IKP +ST CMG AASM S+LL+AG  G RFALP +R+
Sbjct: 61  HLYINSPGGSVSAGMAIYDTMQYIKPDVSTICMGMAASMASVLLAAGAPGKRFALPYSRV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE HA++I++I+  +N++  K+ G+T E++    +RDH +++ EA
Sbjct: 121 MIHQPLGGAQGQATEIEIHAREILRIREEMNQVLAKHTGQTVEKIAADTERDHYLTSKEA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+V+      E
Sbjct: 181 KEYGLIDEVVSRSKSAE 197


>gi|313891581|ref|ZP_07825191.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Dialister microaerophilus UPII 345-E]
 gi|313120040|gb|EFR43222.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Dialister microaerophilus UPII 345-E]
          Length = 199

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 114/200 (57%), Positives = 159/200 (79%), Gaps = 1/200 (0%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+VVEQT+ GERSYDIYSRLLK+RI+F+ GQIEDHMA +I AQLLFLEAE+P K+I
Sbjct: 1   MAYVPIVVEQTSHGERSYDIYSRLLKDRIIFLDGQIEDHMANVIIAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAGMAIYDTMQ+I+P +ST C+G  ASM ++LL++G KG RFALP++ +
Sbjct: 61  HLYINSPGGVVTAGMAIYDTMQYIRPDVSTICIGSCASMAAVLLTSGAKGKRFALPHSNV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE HA++I++++  LN I  K+ G++ + ++K  +RD+ M+A  A
Sbjct: 121 MIHQPLGGVQGQATEIEIHAREILRLRDELNGILAKHTGQSLDVIKKDTERDNFMTAENA 180

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
             +G++DK+L  R ++  K 
Sbjct: 181 LKYGLIDKILT-RNELTAKD 199


>gi|225713510|gb|ACO12601.1| ATP-dependent Clp protease proteolytic subunit, mitochondrial
           precursor [Lepeophtheirus salmonis]
          Length = 222

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 121/206 (58%), Positives = 162/206 (78%)

Query: 5   GCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLL 64
               +       GLVP+VVEQT RGERSYDIYSRLLK+RI+ + GQ++D ++ L+ AQLL
Sbjct: 12  NGPMRAEARSMSGLVPIVVEQTGRGERSYDIYSRLLKDRIICLMGQVDDVISGLMVAQLL 71

Query: 65  FLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEK 124
           FL+AE+ +K I +YINSPGG VTAG+AIYDTMQ+I+PPI+T+C+GQA SMGSLLL+AG K
Sbjct: 72  FLQAESGKKPIHMYINSPGGSVTAGLAIYDTMQYIQPPIATWCVGQACSMGSLLLTAGTK 131

Query: 125 GMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL 184
           GMR +LPN+RI++HQPSG   GQASDI+  AQ+I+ ++ RLN IYVK+ G+  + VEK++
Sbjct: 132 GMRHSLPNSRIMVHQPSGQSHGQASDIQIQAQEILNLRARLNNIYVKHTGQPLDIVEKSM 191

Query: 185 DRDHIMSASEACDWGVVDKVLMSRID 210
           DRD+ MSA +A  +G++DKVL +   
Sbjct: 192 DRDNFMSADDALKFGLIDKVLETPPK 217


>gi|149376712|ref|ZP_01894470.1| ATP-dependent Clp protease proteolytic subunit [Marinobacter
           algicola DG893]
 gi|149358951|gb|EDM47417.1| ATP-dependent Clp protease proteolytic subunit [Marinobacter
           algicola DG893]
          Length = 227

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 114/198 (57%), Positives = 152/198 (76%)

Query: 11  SEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAEN 70
           +     GLVP+V+EQT RGERS+DI+SRLLKER++F+ G +EDHMA LI AQLLFLE+EN
Sbjct: 26  AMVTNSGLVPIVIEQTARGERSFDIFSRLLKERVIFLVGPVEDHMANLIVAQLLFLESEN 85

Query: 71  PQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFAL 130
           P K+I LYINSPGG VTAGM+IYDTMQFIKP ++T C+GQAASMG+ LL+ G +G R  L
Sbjct: 86  PDKDIHLYINSPGGSVTAGMSIYDTMQFIKPDVATLCVGQAASMGAFLLAGGAEGKRACL 145

Query: 131 PNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIM 190
           PN+R+++HQP GG+ GQA+DIE H ++I+KI+  LN I   + G+  + + K  DRD+ M
Sbjct: 146 PNSRVMIHQPLGGYQGQATDIEIHTREILKIRHTLNSILAHHTGQKLDTIAKDTDRDNFM 205

Query: 191 SASEACDWGVVDKVLMSR 208
              +A D+G++D +L  R
Sbjct: 206 DPQQAKDYGLIDSILDKR 223


>gi|296330330|ref|ZP_06872811.1| ATP-dependent Clp protease proteolytic subunit [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305676065|ref|YP_003867737.1| ATP-dependent Clp protease proteolytic subunit [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296152598|gb|EFG93466.1| ATP-dependent Clp protease proteolytic subunit [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305414309|gb|ADM39428.1| ATP-dependent Clp protease proteolytic subunit [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 198

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 109/198 (55%), Positives = 156/198 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLEAE+P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG R+ALPN+ +
Sbjct: 61  SIYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN++  +  G+  E +E+  DRD+  SA EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEA 180

Query: 196 CDWGVVDKVLMSRIDIEE 213
            ++G++DK+L    + ++
Sbjct: 181 LEYGLIDKILTRNTEEQK 198


>gi|238926240|ref|ZP_04658000.1| endopeptidase Clp [Selenomonas flueggei ATCC 43531]
 gi|238885920|gb|EEQ49558.1| endopeptidase Clp [Selenomonas flueggei ATCC 43531]
          Length = 197

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 111/196 (56%), Positives = 155/196 (79%)

Query: 21  MVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLYIN 80
           MVVE + RGER+YDIYSRLLKERI+F+ G I+D +A +I AQ+LFLE+E+P K+I LYIN
Sbjct: 1   MVVENSGRGERAYDIYSRLLKERIIFLGGPIDDSVANVIVAQMLFLESEDPDKDIHLYIN 60

Query: 81  SPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLHQP 140
           SPGGVVTAG+AIYDTMQ+IKP +ST C+GQAASMGS+LL+AG KG R+ALP+ARI++HQP
Sbjct: 61  SPGGVVTAGLAIYDTMQYIKPDVSTICVGQAASMGSILLTAGAKGKRYALPHARIMIHQP 120

Query: 141 SGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDWGV 200
            GG  GQ++DI+  A++I++++   NEI  ++ G+   ++    +RD+ MSA EA ++G+
Sbjct: 121 LGGAQGQSTDIQIQAKEILRLREVGNEILARHTGQDTAKINIDTERDNFMSAEEAKEYGL 180

Query: 201 VDKVLMSRIDIEEKSK 216
           +D+V++   D    SK
Sbjct: 181 IDEVVLRPKDTSADSK 196


>gi|115311350|sp|Q3M726|CLPP3_ANAVT RecName: Full=ATP-dependent Clp protease proteolytic subunit 3;
           AltName: Full=Endopeptidase Clp 3
          Length = 214

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 105/191 (54%), Positives = 143/191 (74%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            +VPMVVEQ+  GER++DIYSRLL+ERI+F+   I+D +A  I AQLLFL+AE+ +K+I 
Sbjct: 10  NIVPMVVEQSGMGERAFDIYSRLLRERIIFLGTPIDDAVANTIVAQLLFLDAEDSEKDIQ 69

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG V AGMAIYDT+Q I+P + T C G AASMG+ LL+AG KG R +LP++RI+
Sbjct: 70  LYINSPGGSVYAGMAIYDTIQQIRPDVVTICFGLAASMGAFLLTAGTKGKRMSLPDSRIM 129

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA DIE  A++I+ IK +LN++   + G+  E +E   DRD  MSA EA 
Sbjct: 130 IHQPLGGAQGQAIDIEIQAREILYIKAQLNQLLANHTGQPLERIEADTDRDFFMSAEEAK 189

Query: 197 DWGVVDKVLMS 207
           ++G++D+V+  
Sbjct: 190 NYGLIDQVISR 200


>gi|114771109|ref|ZP_01448549.1| Protease subunit of ATP-dependent Clp protease [alpha
           proteobacterium HTCC2255]
 gi|114548391|gb|EAU51277.1| Protease subunit of ATP-dependent Clp protease [alpha
           proteobacterium HTCC2255]
          Length = 204

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 140/204 (68%), Positives = 176/204 (86%), Gaps = 1/204 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  +V+   LVPMVVEQT+RGERS+DI+SRLLKERI+FV+G + D M+TLI AQLLFL
Sbjct: 1   MRDPLEVYNNTLVPMVVEQTSRGERSFDIFSRLLKERIIFVSGPVHDGMSTLIVAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+K+IS+YINSPGGVVTAGMAIYDTMQ+I+P +ST C+GQAASMGSLLL+AGEKGM
Sbjct: 61  EAENPKKDISMYINSPGGVVTAGMAIYDTMQYIRPKVSTLCVGQAASMGSLLLAAGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPNAR+++HQPSGGFSGQASDI  HA++I+++K RLN+IYVK+C +    VE  LDR
Sbjct: 121 RFALPNARVMVHQPSGGFSGQASDIALHAKEILELKDRLNKIYVKHCSQKLSTVEDALDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRID 210
           D+ M+A EA DWG++D+++  R D
Sbjct: 181 DNFMTAEEAKDWGLIDEIVQKRED 204


>gi|294678131|ref|YP_003578746.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodobacter
           capsulatus SB 1003]
 gi|294476951|gb|ADE86339.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Rhodobacter
           capsulatus SB 1003]
          Length = 209

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 131/206 (63%), Positives = 171/206 (83%), Gaps = 1/206 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  D+++  LVPMVVEQT+RGER+YDIYSRLLKERI+F+ G   D M++LICAQLLFL
Sbjct: 1   MKDPVDLYMNTLVPMVVEQTSRGERAYDIYSRLLKERIIFLAGPFHDGMSSLICAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEIS+YINSPGGVVT+G+AIYDTMQ+I+P +ST  +GQAASMGS++  AGEKGM
Sbjct: 61  EAENPSKEISMYINSPGGVVTSGLAIYDTMQYIRPKVSTLVIGQAASMGSVIACAGEKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+RI++HQPSGGF GQA+DI  HA++  KI++RL EIYV++ G++ EEV + L+R
Sbjct: 121 RFSLPNSRIMVHQPSGGFQGQATDIMIHARETEKIRQRLYEIYVRHTGRSLEEVAEALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIE 212
           D  MS  EA +WG +D++L +R  ++
Sbjct: 181 DRFMSPEEALEWGHLDEILSARPSLD 206


>gi|302671762|ref|YP_003831722.1| ATP-dependent Clp protease proteolytic subunit ClpP [Butyrivibrio
           proteoclasticus B316]
 gi|302396235|gb|ADL35140.1| ATP-dependent Clp protease proteolytic subunit ClpP [Butyrivibrio
           proteoclasticus B316]
          Length = 201

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 109/201 (54%), Positives = 150/201 (74%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQT+RGERSYDIYSRLLKERIVF+  ++    A+ I AQLLFLEAE+P K+I
Sbjct: 1   MSLIPYVIEQTSRGERSYDIYSRLLKERIVFLGEEVNAASASTIVAQLLFLEAEDPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG +++GMAIYDTM +IK  +ST C+G AASMG+ LL+ G KG R ALPNA +
Sbjct: 61  HMYINSPGGEISSGMAIYDTMNYIKCDVSTICIGMAASMGAFLLAGGAKGKRMALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+K K ++N +   N GK+YE+V    +RD+ +SA EA
Sbjct: 121 MIHQPLGGTQGQATEIEIAAKHILKTKEKMNRMLAANTGKSYEQVAADTERDNWLSAQEA 180

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
            D+G++D ++ +R   +E  K
Sbjct: 181 LDYGLIDSIIENRPSEKEDKK 201


>gi|239828281|ref|YP_002950905.1| ATP-dependent Clp protease proteolytic subunit [Geobacillus sp.
           WCH70]
 gi|259585956|sp|C5D7M9|CLPP_GEOSW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|239808574|gb|ACS25639.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacillus
           sp. WCH70]
          Length = 196

 Score =  237 bits (606), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 109/195 (55%), Positives = 152/195 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQT+RGER+YDIYSRLLK+RI+ +   I+D +A  I +QLLFL AE+P+K+I
Sbjct: 1   MNLIPTVIEQTSRGERAYDIYSRLLKDRIIILGSPIDDQVANSIVSQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAG+AIYDTMQFIKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  SLYINSPGGSITAGLAIYDTMQFIKPDVSTICIGMAASMGAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN I  +N G+  E +E+  DRD+ M+A +A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLRDKLNRILAENTGQPVEVIERDTDRDNFMTAQKA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D+VL    +
Sbjct: 181 QEYGIIDRVLTRIDE 195


>gi|323705911|ref|ZP_08117482.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534709|gb|EGB24489.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 194

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 110/194 (56%), Positives = 150/194 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP+VVEQTNRGERSYDIYSRLLK+RIVF+  +I D  A+L+ AQLLFLE E+P K+I
Sbjct: 1   MSLVPIVVEQTNRGERSYDIYSRLLKDRIVFLGEEINDVSASLVVAQLLFLEGEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +T+  AIYDTMQ+IKP + T C+G AAS G+ LL+AG KG RF+LPN+ I
Sbjct: 61  WLYINSPGGSITSAFAIYDTMQYIKPDVVTMCVGMAASAGAFLLAAGAKGKRFSLPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA+ I+K+K++LN+I  +  G+  E++E+  +RD  M   EA
Sbjct: 121 MIHQPLGGTQGQATDIKIHAERIIKMKQKLNKILSERTGQPLEKIERDTERDFFMDPEEA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G++D++L+ R 
Sbjct: 181 KAYGLIDEILVKRK 194


>gi|187928950|ref|YP_001899437.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia pickettii
           12J]
 gi|241663134|ref|YP_002981494.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia pickettii
           12D]
 gi|309781948|ref|ZP_07676679.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ralstonia sp.
           5_7_47FAA]
 gi|187725840|gb|ACD27005.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ralstonia
           pickettii 12J]
 gi|240865161|gb|ACS62822.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ralstonia
           pickettii 12D]
 gi|308919292|gb|EFP64958.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Ralstonia sp.
           5_7_47FAA]
          Length = 215

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 114/193 (59%), Positives = 155/193 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           LGLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G++ D  A L+ AQLLFLE+ENP K+I
Sbjct: 23  LGLVPMVVEQSGRGERAYDIYSRLLKERVIFMVGEVNDQTANLVVAQLLFLESENPDKDI 82

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG V++G+A+YDTMQFIKP +ST CMG AASMG+ LL+AG KG R ALPN+RI
Sbjct: 83  SLYINSPGGSVSSGLAMYDTMQFIKPDVSTLCMGMAASMGAFLLAAGAKGKRLALPNSRI 142

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQASDIE  A++I+ ++ RLN +  +  G+  +++ +  DRD+ MS+ +A
Sbjct: 143 MIHQPLGGARGQASDIEIQAREILYLRERLNTVLSEVTGQPVDKIARDTDRDNFMSSEQA 202

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+V+  R
Sbjct: 203 KEYGLIDQVIAKR 215


>gi|160933529|ref|ZP_02080917.1| hypothetical protein CLOLEP_02375 [Clostridium leptum DSM 753]
 gi|156867406|gb|EDO60778.1| hypothetical protein CLOLEP_02375 [Clostridium leptum DSM 753]
          Length = 201

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 116/193 (60%), Positives = 150/193 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP VVEQT+RGERSYDI+SRLL +RIV +T ++ D  A+L+ AQLL+LE ++P K+I
Sbjct: 9   MSLVPYVVEQTSRGERSYDIFSRLLNDRIVMLTEEVNDTSASLVVAQLLYLEGQDPTKDI 68

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG VTAGM+IYDTMQ+IK  +ST CMG AASMG+ LL+AG KG R ALPN+ I
Sbjct: 69  SLYINSPGGSVTAGMSIYDTMQYIKCDVSTICMGMAASMGAFLLAAGAKGKRMALPNSDI 128

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA+DI  HA  I + K++LNEI  +  G+  E +E+  +RD+ MSA EA
Sbjct: 129 MIHQPSGGAQGQATDILIHANHIARTKKKLNEILAERTGQPLEVIERDTERDNFMSAQEA 188

Query: 196 CDWGVVDKVLMSR 208
            D+G+VDKV+  R
Sbjct: 189 ADYGLVDKVIYKR 201


>gi|314933077|ref|ZP_07840443.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus caprae C87]
 gi|313654396|gb|EFS18152.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus caprae C87]
          Length = 195

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 104/191 (54%), Positives = 148/191 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+E TNRGER+YDIYSRLLK+RI+ +  QI+D++A  I +QLLFL+A++ +K+I
Sbjct: 1   MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG AIYDT+Q IKP + T C+G AASMGS LL+AG KG RFALPNA +
Sbjct: 61  YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A  I+K + +LN I  +  G++ E++++  DRD+ ++A EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAANHILKTREKLNRILAERTGQSIEKIQQDTDRDNFLTAEEA 180

Query: 196 CDWGVVDKVLM 206
            ++G++D+V+ 
Sbjct: 181 KEYGLIDEVME 191


>gi|295677486|ref|YP_003606010.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1002]
 gi|295437329|gb|ADG16499.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1002]
          Length = 215

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 114/204 (55%), Positives = 153/204 (75%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
                     LGLVP V+EQ+ RGER+YDIYSRLL+ERIVF+ G + +  A+LI AQLLF
Sbjct: 1   MPSSYPSVSALGLVPTVIEQSGRGERAYDIYSRLLRERIVFLVGPVNEQSASLIVAQLLF 60

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP K+IS YINSPGG V  G+AIYDTMQFIKP +ST C G AASMG+ LL+AG++G
Sbjct: 61  LESENPDKDISFYINSPGGSVYDGLAIYDTMQFIKPEVSTLCTGFAASMGTFLLTAGQRG 120

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            R+ALPNARI++HQPSGG  G A+DIE  A++++ ++ RLN +  +  G+T +++ +  D
Sbjct: 121 KRYALPNARIMIHQPSGGGQGTAADIEIQAKEVLYVRARLNAMMAERTGRTIDDIARDTD 180

Query: 186 RDHIMSASEACDWGVVDKVLMSRI 209
           RD+ MSA EA ++G++D VL +R 
Sbjct: 181 RDNFMSALEAREYGLIDDVLEARA 204


>gi|253577702|ref|ZP_04855005.1| clp protease [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251842907|gb|EES70953.1| clp protease [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 196

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 105/195 (53%), Positives = 139/195 (71%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              ++P V+EQT RGERSYDIYSRLLK+RIVF+   I+D +A  I AQ+LFL AE+P+K+
Sbjct: 1   MSSVIPYVIEQTGRGERSYDIYSRLLKDRIVFLGSAIDDQVANSIMAQMLFLAAEDPEKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I  YINSPGG  +AG AIYDTMQ++KP + T C G AAS  ++LL AG KG RFALPN+ 
Sbjct: 61  IYFYINSPGGSTSAGFAIYDTMQYVKPDVQTICSGMAASFAAILLMAGAKGKRFALPNSE 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQP GG  GQASDI   A  I++ +  LN I  +  G+  E +EK +DRD+ MSA E
Sbjct: 121 IMIHQPHGGAQGQASDIAISANRILRTRAVLNTIAAECTGQPLERIEKDMDRDYFMSADE 180

Query: 195 ACDWGVVDKVLMSRI 209
           A ++G++D+V+    
Sbjct: 181 AREYGIIDQVITPNK 195


>gi|323484460|ref|ZP_08089826.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           symbiosum WAL-14163]
 gi|323692476|ref|ZP_08106710.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           symbiosum WAL-14673]
 gi|323402238|gb|EGA94570.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           symbiosum WAL-14163]
 gi|323503473|gb|EGB19301.1| ATP-dependent Clp protease proteolytic subunit [Clostridium
           symbiosum WAL-14673]
          Length = 193

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 110/192 (57%), Positives = 150/192 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+E T+RGERSYDI+SRLLKERI+F+  ++ D  A LI +QLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIESTSRGERSYDIFSRLLKERIIFLGEEVTDTSAGLIVSQLLFLESEDPNKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V+AG+AIYDTM +IK  +ST C G AASMG+ LL+ G KG RFALPNA +
Sbjct: 61  HLYINSPGGSVSAGLAIYDTMNYIKCDVSTICFGMAASMGAFLLAGGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  A+ I++ K++LNEI   N G+ YE +E+  DRD+ M+A EA
Sbjct: 121 MIHQPSGGAQGQATEIQIVAEKILQTKKKLNEILAANTGQPYEVIERDTDRDNYMTAQEA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D+V+ S
Sbjct: 181 MEYGLIDRVIAS 192


>gi|254441469|ref|ZP_05054962.1| Clp protease [Octadecabacter antarcticus 307]
 gi|198251547|gb|EDY75862.1| Clp protease [Octadecabacter antarcticus 307]
          Length = 209

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 119/209 (56%), Positives = 159/209 (76%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +D  D ++ LVPMVVEQT RGER+YDI+SRLLKERI+FV G I D M+ L+ AQLL LE
Sbjct: 1   MQDPIDTYMNLVPMVVEQTARGERAYDIFSRLLKERIIFVNGPIHDGMSQLVVAQLLHLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+KEIS+YINSPGG V +GM+IYDTMQ+I+P +ST   G AASMGS++   GEKGMR
Sbjct: 61  AENPKKEISMYINSPGGAVHSGMSIYDTMQYIRPKVSTLICGMAASMGSVIAVGGEKGMR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F+LPN+ I++HQPSGG  G+ASD+   A+ I + + R  ++Y+K+ G+T++ VEK LDRD
Sbjct: 121 FSLPNSEIMVHQPSGGSQGKASDMLITARHIEQTRERFYKLYMKHTGQTHKSVEKALDRD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
             M+  EA +WG +D+++ SR   E + K
Sbjct: 181 TWMTPEEAKEWGHLDEIVESRGKAEGEDK 209


>gi|331001370|ref|ZP_08324994.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Parasutterella excrementihominis YIT 11859]
 gi|329568629|gb|EGG50431.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Parasutterella excrementihominis YIT 11859]
          Length = 209

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 112/209 (53%), Positives = 159/209 (76%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D  +    L+PMV+EQ+ RGERS+DIYSRLL++R+VF+ G + D  A L+ AQLLFLE
Sbjct: 1   MPDFSNFNSALIPMVIEQSGRGERSFDIYSRLLRDRVVFLVGPVTDQSANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+ISLYI+SPGG V AG++IYDTMQFIKP +ST C+G AASMG+ LL+AG KG R
Sbjct: 61  SENPDKDISLYIDSPGGSVYAGLSIYDTMQFIKPDVSTICLGMAASMGAFLLAAGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPN+RI++HQPSGG +G A+DIE  A++I++++ RLN I  ++ G++ E++    +RD
Sbjct: 121 FALPNSRIMIHQPSGGTNGTAADIEIQAKEILELRSRLNTILSEHTGQSIEKIAVDTERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           + MS+++A ++G++D V   R +   K K
Sbjct: 181 NFMSSAQAVEYGIIDGVFRKRSEQIIKKK 209


>gi|170718338|ref|YP_001783566.1| ATP-dependent Clp protease proteolytic subunit [Haemophilus somnus
           2336]
 gi|189082460|sp|B0UW20|CLPP_HAES2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|168826467|gb|ACA31838.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Haemophilus
           somnus 2336]
          Length = 193

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 123/193 (63%), Positives = 159/193 (82%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F+TG++ED MA LI AQLLFLEAE+P K+I
Sbjct: 1   MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLTGEVEDRMANLIVAQLLFLEAEDPAKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP + T C+GQA SMG+ LL+ G  G R ALP+AR+
Sbjct: 61  NIYINSPGGSVTAGMAIYDTMQFIKPNVRTLCIGQACSMGAFLLAGGTAGKRAALPHARV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK+ LNE    + G++ E++E+  DRD+ MSA +A
Sbjct: 121 MIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIEQIEQDTDRDNFMSAEQA 180

Query: 196 CDWGVVDKVLMSR 208
             +G+VD VL+ R
Sbjct: 181 KLYGLVDDVLIKR 193


>gi|328543681|ref|YP_004303790.1| ATP-dependent Clp protease proteolytic subunit [Polymorphum gilvum
           SL003B-26A1]
 gi|326413425|gb|ADZ70488.1| ATP-dependent Clp protease proteolytic subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 211

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 138/210 (65%), Positives = 179/210 (85%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            KD  ++F   LVPMVVEQTNRGER++DIYSRLLKERI+F+TG IED +ATL+CAQLL+L
Sbjct: 1   MKDPVELFTNTLVPMVVEQTNRGERAFDIYSRLLKERIIFLTGPIEDQLATLVCAQLLYL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP KEI+LYINSPGG+VT+G+AIYDTMQFI+P +ST C+GQAASMGSLLL+AG+KGM
Sbjct: 61  EAENPNKEIALYINSPGGLVTSGLAIYDTMQFIRPEVSTLCIGQAASMGSLLLAAGQKGM 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPNAR+++HQPSGGF GQA+DI  HAQ+I+K+KRRLN+IYVK+ G++ + VE+ L+R
Sbjct: 121 RFSLPNARVMVHQPSGGFRGQAADIMLHAQEILKLKRRLNDIYVKHTGQSLDSVEEALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           D+ M+A  A  +G+VD V+  R  +  + +
Sbjct: 181 DNFMTADMAKGFGIVDSVISDRASLGTEGQ 210


>gi|254455562|ref|ZP_05068991.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082564|gb|EDZ59990.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 203

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 125/203 (61%), Positives = 165/203 (81%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
                 +    LVPMVVEQ+N+GER+YDIYSRLLKERI+F+TGQI D++A+L+ AQLLFL
Sbjct: 1   MTTKLSEHMNTLVPMVVEQSNKGERAYDIYSRLLKERIIFLTGQINDNVASLVTAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAE+P+KEI LYINSPGG+VTAG+ IYDTMQ++KP IST C+GQAASMGS LL+AG KG 
Sbjct: 61  EAEDPKKEIYLYINSPGGLVTAGLGIYDTMQYVKPDISTLCIGQAASMGSFLLAAGTKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RF+LPN+R+++HQPS GF GQ +DIE HA ++  +K+RLNEIY K+ GK+ +EV+  L+R
Sbjct: 121 RFSLPNSRVMVHQPSAGFQGQVTDIEIHANEVSSLKKRLNEIYSKHTGKSVDEVKAALER 180

Query: 187 DHIMSASEACDWGVVDKVLMSRI 209
           D+ M+A  A D+G++D+V+  R 
Sbjct: 181 DNFMTADVAKDFGLIDEVVEKRS 203


>gi|83592885|ref|YP_426637.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodospirillum
           rubrum ATCC 11170]
 gi|124013826|sp|Q2RU45|CLPP_RHORT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|83575799|gb|ABC22350.1| ATP-dependent Clp protease proteolytic subunit ClpP [Rhodospirillum
           rubrum ATCC 11170]
          Length = 216

 Score =  237 bits (606), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 134/205 (65%), Positives = 167/205 (81%), Gaps = 1/205 (0%)

Query: 6   CAKKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLL 64
              +D  DVF   LVPMVVEQTNRGERSYDIYSRLLKERI+F+TGQ+ D +A+LICAQLL
Sbjct: 1   MIDRDPIDVFNNTLVPMVVEQTNRGERSYDIYSRLLKERIIFLTGQVHDGVASLICAQLL 60

Query: 65  FLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEK 124
           FLE+ENP K+IS YINSPGGVVT+GMAIYDTMQ+I+ P+ST C+GQAASMGSLLL AGE 
Sbjct: 61  FLESENPSKDISFYINSPGGVVTSGMAIYDTMQYIRSPVSTVCIGQAASMGSLLLCAGEA 120

Query: 125 GMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTL 184
           G R+A PNARI++HQPSGGF GQA+DIE  A++I+ ++ RLN IYVK+ G+  E +E+ +
Sbjct: 121 GKRYATPNARIMIHQPSGGFQGQAADIEIQAREILALRERLNRIYVKHTGQPLETIERAM 180

Query: 185 DRDHIMSASEACDWGVVDKVLMSRI 209
           DRD+ M+A E+  +G+ D V+  R 
Sbjct: 181 DRDNYMTAEESRAFGLTDSVIERRA 205


>gi|238026973|ref|YP_002911204.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia glumae
           BGR1]
 gi|237876167|gb|ACR28500.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia glumae
           BGR1]
          Length = 217

 Score =  237 bits (605), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 123/208 (59%), Positives = 158/208 (75%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ A
Sbjct: 10  TLASHAPQDFETKALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVA 69

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLLFLE+ENP K+ISLYINSPGG V+AG+AIYDTMQFIKP +ST CMG AASMG+ LLS+
Sbjct: 70  QLLFLESENPDKDISLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCMGLAASMGAFLLSS 129

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN+I  +N G+  E + 
Sbjct: 130 GAKGKRYALPNARVMIHQPLGGARGQASDIEIQAREILYLRERLNKILAENTGQDVERIA 189

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  DRD+ MS+ +A  +G++D V   R 
Sbjct: 190 RDTDRDNFMSSDDAKAYGLIDHVSAKRP 217


>gi|187935559|ref|YP_001887076.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum B str. Eklund 17B]
 gi|226706444|sp|B2TPB9|CLPP_CLOBB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|187723712|gb|ACD24933.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Clostridium
           botulinum B str. Eklund 17B]
          Length = 199

 Score =  237 bits (605), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 117/199 (58%), Positives = 156/199 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLKERI+ ++G++ D  + LI +QLLFLE+E+P K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIFSRLLKERIIMLSGEVNDDSSNLIVSQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMG+ LLS+G  G R+ALPNA I
Sbjct: 61  SIYINSPGGSITAGMAIYDTMQYIKPDVSTICVGMAASMGAFLLSSGANGKRYALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+DI+ HA  I+KIK  LN+I  +N  +  E +E  ++RD+ M+A EA
Sbjct: 121 MIHQPLGGFQGQATDIQIHANRILKIKESLNKILSENTNQPLEVIEADVERDNFMTADEA 180

Query: 196 CDWGVVDKVLMSRIDIEEK 214
             +G+VDKV+      ++K
Sbjct: 181 KTYGLVDKVITKNETGKDK 199


>gi|26989024|ref|NP_744449.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas putida
           KT2440]
 gi|148548677|ref|YP_001268779.1| ATP-dependent Clp protease proteolytic subunit [Pseudomonas putida
           F1]
 gi|38257487|sp|Q88KJ0|CLPP_PSEPK RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214701|sp|A5W635|CLPP_PSEP1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|24983847|gb|AAN67913.1|AE016423_8 ATP-dependent Clp protease, proteolytic subunit ClpP [Pseudomonas
           putida KT2440]
 gi|148512735|gb|ABQ79595.1| ATP-dependent Clp protease proteolytic subunit ClpP [Pseudomonas
           putida F1]
 gi|171362771|dbj|BAG15849.1| probable ATP-dependent clp protease [Pseudomonas putida]
          Length = 213

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 121/193 (62%), Positives = 155/193 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+EQ+ RGER+YDIYSRLLKER++F+ G +ED+MA L+ AQLLFLEAENP K+I 
Sbjct: 18  GLVPMVIEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLVVAQLLFLEAENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQA SMG+ LL+AG KG R  LPN+R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPDVSTICIGQACSMGAFLLAAGAKGKRHCLPNSRVM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GGF GQA+DIE HAQ+I+ IK RLNE+   + G+  E +++  +RD+ MSAS A 
Sbjct: 138 IHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAA 197

Query: 197 DWGVVDKVLMSRI 209
           ++G++D V   R 
Sbjct: 198 EYGLIDSVYDKRQ 210


>gi|310829091|ref|YP_003961448.1| hypothetical protein ELI_3526 [Eubacterium limosum KIST612]
 gi|308740825|gb|ADO38485.1| hypothetical protein ELI_3526 [Eubacterium limosum KIST612]
          Length = 195

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 108/195 (55%), Positives = 151/195 (77%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           + + LVPMV+EQT RGERS+DIYSRLLKERI+F+ G+I D  ++LI AQL+FLEA+NP K
Sbjct: 1   MNMNLVPMVIEQTGRGERSFDIYSRLLKERIIFLDGEINDTTSSLIVAQLIFLEADNPDK 60

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I +YINSPGG +T+G AIYDTM FIK  +ST C+G AASMG+ LL+AG KG R ALPN+
Sbjct: 61  DIEMYINSPGGSITSGFAIYDTMNFIKCDVSTMCVGMAASMGAFLLAAGAKGKRKALPNS 120

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
            I++HQP GG  GQ+ D+E +A+ ++K + +LNEI  +  G+  + + +  DRD+ MSA 
Sbjct: 121 EIMIHQPLGGAQGQSVDVEIYAKRLIKTREKLNEILSEKTGQPIDVIARDTDRDNFMSAE 180

Query: 194 EACDWGVVDKVLMSR 208
           EA ++G++D+++ SR
Sbjct: 181 EALEYGLIDQIVSSR 195


>gi|223043057|ref|ZP_03613105.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus capitis SK14]
 gi|222443911|gb|EEE50008.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus capitis SK14]
          Length = 195

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 104/195 (53%), Positives = 148/195 (75%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+E TNRGER+YDIYSRLLK+RI+ +  QI+D++A  I +QLLFL+A++ +K+I
Sbjct: 1   MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG AIYDT+Q IKP + T C+G AASMGS LL+AG KG RFALPNA +
Sbjct: 61  YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A  I+K + +LN I  +  G++ E++++  DRD+ ++A EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAANHILKTREKLNRILAERTGQSIEKIQQDTDRDNFLTAEEA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D+V+     
Sbjct: 181 KEYGLIDEVMEPESK 195


>gi|260589157|ref|ZP_05855070.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Blautia
           hansenii DSM 20583]
 gi|331082573|ref|ZP_08331698.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 6_1_63FAA]
 gi|260540577|gb|EEX21146.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Blautia
           hansenii DSM 20583]
 gi|330400551|gb|EGG80181.1| ATP-dependent Clp protease proteolytic subunit [Lachnospiraceae
           bacterium 6_1_63FAA]
          Length = 193

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 112/193 (58%), Positives = 147/193 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+RGER+YDIYSRLLK+RI+F+  ++ D  A LI AQLLFLE+E+P K+I
Sbjct: 1   MSLVPYVIEQTSRGERNYDIYSRLLKDRIIFLGEEVTDVSANLIAAQLLFLESEDPGKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGM IYDTMQ+IK  +ST CMG AASMG+ LL+ G KG R ALPNA I
Sbjct: 61  HLYINSPGGSVTAGMVIYDTMQYIKCDVSTICMGLAASMGAFLLAGGAKGKRMALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++I+  AQ I+K + +LN I  +N G+T E + +  +RD+ M+A EA
Sbjct: 121 MIHQPSGGAQGQATEIDIVAQQILKTRHKLNSILAQNTGQTLETIARDTERDNYMTAQEA 180

Query: 196 CDWGVVDKVLMSR 208
             +G++D V+  R
Sbjct: 181 MAYGLIDSVIEHR 193


>gi|310639654|ref|YP_003944412.1| ATP-dependent clp protease proteolytic subunit [Paenibacillus
           polymyxa SC2]
 gi|309244604|gb|ADO54171.1| ATP-dependent Clp protease proteolytic subunit [Paenibacillus
           polymyxa SC2]
          Length = 198

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 113/192 (58%), Positives = 149/192 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VPMVVEQ+NRGER+YDIYSRLLK+RI+ +   + D +A  I AQ+LFL AE+P+K+I
Sbjct: 1   MSYVPMVVEQSNRGERAYDIYSRLLKDRIILLGSDVNDVVANSIIAQMLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAI+DTMQ+IKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  HLYINSPGGSITAGMAIFDTMQYIKPDVSTICVGMAASMGAFLLNAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE  A+ I+K++ +LN I     G+  E +EK  DRD+ MSA +A
Sbjct: 121 MIHQPLGGAQGQATDIEIRARRILKMRDKLNRILADRTGQPLERIEKDTDRDYFMSADDA 180

Query: 196 CDWGVVDKVLMS 207
            ++G++DKVL S
Sbjct: 181 KEYGIIDKVLTS 192


>gi|297531315|ref|YP_003672590.1| ATP-dependent Clp protease proteolytic subunit ClpP [Geobacillus
           sp. C56-T3]
 gi|297254567|gb|ADI28013.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacillus
           sp. C56-T3]
          Length = 196

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 112/195 (57%), Positives = 153/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RIVF+   I+D +A  I +QLLFL AE+P+K+I
Sbjct: 1   MYLIPTVIEQTNRGERAYDIYSRLLKDRIVFLGSPIDDQVANSIVSQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAG+AIYDTMQFIKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  SLYINSPGGSITAGLAIYDTMQFIKPDVSTICIGMAASMGAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN I  +N G+  E +E+  DRD+ M+A +A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLRDKLNRILSENTGQPIEVIERDTDRDNFMTAQKA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D+VL    +
Sbjct: 181 MEYGIIDRVLTRADE 195


>gi|163942836|ref|YP_001647720.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           weihenstephanensis KBAB4]
 gi|228993855|ref|ZP_04153759.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           pseudomycoides DSM 12442]
 gi|228999881|ref|ZP_04159453.1| ATP-dependent Clp protease proteolytic subunit [Bacillus mycoides
           Rock3-17]
 gi|229007435|ref|ZP_04165032.1| ATP-dependent Clp protease proteolytic subunit [Bacillus mycoides
           Rock1-4]
 gi|229062796|ref|ZP_04200101.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           AH603]
 gi|229135952|ref|ZP_04264713.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           BDRD-ST196]
 gi|229169852|ref|ZP_04297548.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           AH621]
 gi|163865033|gb|ABY46092.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           weihenstephanensis KBAB4]
 gi|228613566|gb|EEK70695.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           AH621]
 gi|228647494|gb|EEL03568.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           BDRD-ST196]
 gi|228716556|gb|EEL68259.1| ATP-dependent Clp protease proteolytic subunit [Bacillus cereus
           AH603]
 gi|228753823|gb|EEM03264.1| ATP-dependent Clp protease proteolytic subunit [Bacillus mycoides
           Rock1-4]
 gi|228759823|gb|EEM08797.1| ATP-dependent Clp protease proteolytic subunit [Bacillus mycoides
           Rock3-17]
 gi|228765911|gb|EEM14561.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           pseudomycoides DSM 12442]
          Length = 193

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 105/193 (54%), Positives = 152/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLE+++P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG R+ALPN+ +
Sbjct: 61  HIYINSPGGSITAGMAIYDTMQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN+I     G+  E +++  DRD+ M+A  A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQPLEVLQRDTDRDNFMTAERA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DK+  +R
Sbjct: 181 LEYGLIDKIFTNR 193


>gi|109899441|ref|YP_662696.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Pseudoalteromonas atlantica T6c]
 gi|123064308|sp|Q15R46|CLPP_PSEA6 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|109701722|gb|ABG41642.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Pseudoalteromonas atlantica T6c]
          Length = 212

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 126/209 (60%), Positives = 159/209 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
                 D    LVPMVVEQT +GERSYDIYSRLLKE ++F+ GQ+EDHMA LI AQ+LFL
Sbjct: 1   MMNTPFDPTNALVPMVVEQTAKGERSYDIYSRLLKENVIFMVGQVEDHMANLIVAQMLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP+K+I LYINSPGG VTAGMAIYDTM FIKP +ST C+GQAASMG+ LLS G KG 
Sbjct: 61  EAENPEKDIFLYINSPGGSVTAGMAIYDTMNFIKPDVSTVCIGQAASMGAFLLSGGAKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R+ LPNAR+++HQP GGF GQASD E HA++I+ IK ++N +   + G+ Y++V +  DR
Sbjct: 121 RYCLPNARVMIHQPLGGFQGQASDFEIHAKEILSIKEKMNRLMAAHTGQDYDKVARDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           D+ +SA E+ D+G+VD+VL +R D     
Sbjct: 181 DNFLSAQESVDYGLVDQVLANRPDASNSD 209


>gi|116074350|ref|ZP_01471612.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Synechococcus
           sp. RS9916]
 gi|116069655|gb|EAU75407.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Synechococcus
           sp. RS9916]
          Length = 229

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 108/194 (55%), Positives = 146/194 (75%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           G++P VVEQ+ RGER++DIYSRLL+ERI+F+   I+D +A  + AQLLFLEAE+P+K+I 
Sbjct: 29  GVLPTVVEQSGRGERAFDIYSRLLRERIIFLGTGIDDQVADALVAQLLFLEAEDPEKDIQ 88

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           +YINSPGG VTAG+AIYDTMQ + P + T C G AASMG+ LLS G KG R ALPNARI+
Sbjct: 89  IYINSPGGSVTAGLAIYDTMQQVAPDVVTICYGLAASMGAFLLSGGTKGKRLALPNARIM 148

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA DIE  AQ+I+ +K  LN +  ++ G+  E + +  DRDH +S +EA 
Sbjct: 149 IHQPMGGAQGQAVDIEIQAQEILYLKETLNGLMAEHTGQPLETIAEDTDRDHFLSPAEAV 208

Query: 197 DWGVVDKVLMSRID 210
           ++G++D+V+ S  D
Sbjct: 209 EYGLIDRVVDSPAD 222


>gi|313680148|ref|YP_004057887.1| ATP-dependent clp protease proteolytic subunit clpp [Oceanithermus
           profundus DSM 14977]
 gi|313152863|gb|ADR36714.1| ATP-dependent Clp protease proteolytic subunit ClpP [Oceanithermus
           profundus DSM 14977]
          Length = 194

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 111/194 (57%), Positives = 147/194 (75%), Gaps = 1/194 (0%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           +VP V+EQT RGER YDIYSRLLK+RI+F+   I+  +A  I AQ+LFLEA+NP +EI L
Sbjct: 2   IVPYVIEQTARGERVYDIYSRLLKDRIIFLGTPIDSQVANTIVAQMLFLEAQNPNQEIKL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V AG+AIYDTMQ++K P++T  +G AASMG+ LL+AGE G R+ALP+AR+++
Sbjct: 62  YINSPGGDVYAGLAIYDTMQYVKSPVATIVVGMAASMGAFLLAAGEAGQRYALPHARVMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA+DI   A+ I+K K+ LNE+  K+ G+  E+VE   DRD  M+A EA D
Sbjct: 122 HQPWGGAQGQATDIAIQAEQILKSKKLLNELLAKHTGQPVEKVEADSDRDFWMTADEARD 181

Query: 198 WGVVDKVLMSRIDI 211
           +G+VD+V+  R D 
Sbjct: 182 YGLVDRVIA-REDT 194


>gi|210621780|ref|ZP_03292809.1| hypothetical protein CLOHIR_00754 [Clostridium hiranonis DSM 13275]
 gi|210154544|gb|EEA85550.1| hypothetical protein CLOHIR_00754 [Clostridium hiranonis DSM 13275]
          Length = 195

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 110/194 (56%), Positives = 150/194 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP VVEQT RGERSYDI+SRLLK+RI+F+  ++ D  A LI AQLLFLEAE+P K+I
Sbjct: 1   MALVPYVVEQTGRGERSYDIFSRLLKDRIIFLCDEVNDDTAGLIVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTM +IKP +ST C+G AASMG+ LLS+G KG R+ALPN+ I
Sbjct: 61  HLYINSPGGSITAGMAIYDTMNYIKPDVSTICIGMAASMGAFLLSSGAKGKRYALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+++K +LN+I  +N G+  E++    +RD+ M A EA
Sbjct: 121 MIHQPLGGAQGQATEIEIRAKRIIRMKEKLNQILSENTGQPLEKIMADTERDNFMEADEA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G++D+V+ ++ 
Sbjct: 181 LAYGLIDEVITNKP 194


>gi|172035557|ref|YP_001802058.1| ATP-dependent Clp protease proteolytic subunit [Cyanothece sp. ATCC
           51142]
 gi|171697011|gb|ACB49992.1| ATP-dependent Clp protease, proteolytic subunit [Cyanothece sp.
           ATCC 51142]
          Length = 202

 Score =  237 bits (605), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 100/192 (52%), Positives = 142/192 (73%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           ++P V+E + RGER++DIYSRLL+ERIVF+  ++ D  + LI AQLLFLEAE+P K+I L
Sbjct: 1   MIPTVIETSGRGERAFDIYSRLLRERIVFLGQEVRDENSNLIVAQLLFLEAEDPDKDIYL 60

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG V+AG+ I+DTM  I+P + T C+G AASMG+ LLSAG KG R +LPN+RI++
Sbjct: 61  YINSPGGSVSAGLGIFDTMNQIRPDVCTICIGLAASMGAFLLSAGAKGKRMSLPNSRIMI 120

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA+DIE  A++I+ +K  LN     + G+  +++ +  +RD  MSA EA +
Sbjct: 121 HQPLGGAQGQATDIEIQAKEILYLKGLLNNHLANHTGQPLDKIAEDTERDFFMSAEEAQE 180

Query: 198 WGVVDKVLMSRI 209
           +G++D+V+  R 
Sbjct: 181 YGLIDQVINRRP 192


>gi|116062109|dbj|BAF34687.1| proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serine
           protease [Aeromonas veronii]
          Length = 207

 Score =  237 bits (605), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 126/198 (63%), Positives = 155/198 (78%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
                 L+PMVVEQT +GERSYDIYSRLLKER++F+TGQ+EDHMA L+ AQLLFLE+ENP
Sbjct: 10  SSPRNALIPMVVEQTAKGERSYDIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLESENP 69

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            ++IS+YINSPGG VTAGM+IYDTMQFIKP +ST CMGQA SMG+ LL+ G KG RF LP
Sbjct: 70  DQDISIYINSPGGAVTAGMSIYDTMQFIKPDVSTVCMGQACSMGAFLLAGGAKGKRFCLP 129

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           NAR+++HQP GGF GQASDI+ HAQ+I+KIK  LNE    + G+    +E+  DRD+ MS
Sbjct: 130 NARVMIHQPLGGFQGQASDIQIHAQEILKIKNTLNERLAFHTGQDMATIERDTDRDNFMS 189

Query: 192 ASEACDWGVVDKVLMSRI 209
           A +A  +G+VD VL  R 
Sbjct: 190 AEQAVAYGLVDGVLSQRS 207


>gi|67923459|ref|ZP_00516936.1| Peptidase S14, ClpP [Crocosphaera watsonii WH 8501]
 gi|67854694|gb|EAM49976.1| Peptidase S14, ClpP [Crocosphaera watsonii WH 8501]
          Length = 262

 Score =  237 bits (605), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 110/211 (52%), Positives = 155/211 (73%), Gaps = 4/211 (1%)

Query: 6   CAKKDSEDVFL---GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQ 62
            + K   +++     +VPMVVEQ+  GER++DIYSRLL+ERIVF+   ++D +A  I AQ
Sbjct: 44  ISSKRPSEIYAAPESVVPMVVEQSGVGERAFDIYSRLLRERIVFLGTPVDDQVADSIVAQ 103

Query: 63  LLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAG 122
           LLFL+AE+P+K+I LYINSPGG V AG+AIYDTMQ I+P + T C G AASMG+ LLS G
Sbjct: 104 LLFLDAEDPEKDIQLYINSPGGSVYAGLAIYDTMQQIRPDVVTICFGLAASMGAFLLSGG 163

Query: 123 EKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK 182
            KG R ALP++RI++HQP GG  GQA +IE  A++I+ IK+RLN++  ++ G+ ++ +  
Sbjct: 164 TKGKRMALPSSRIMIHQPLGGAQGQAVEIEIQAKEILYIKKRLNDMLAEHTGQPFDTIAA 223

Query: 183 TLDRDHIMSASEACDWGVVDKVLMSRIDIEE 213
             +RD  MSA EA D+G++DKV+ SR D+ +
Sbjct: 224 DTERDFFMSAQEAVDYGLIDKVI-SRSDLSD 253


>gi|323144789|ref|ZP_08079363.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Succinatimonas hippei YIT 12066]
 gi|322415435|gb|EFY06195.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Succinatimonas hippei YIT 12066]
          Length = 200

 Score =  237 bits (605), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 125/198 (63%), Positives = 160/198 (80%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +   LVPMV+EQT RGERS+DIYSRLLKER++F+TG++EDHMA LI AQLLFLE+++P K
Sbjct: 1   MASTLVPMVIEQTARGERSFDIYSRLLKERVIFMTGEVEDHMADLIVAQLLFLESDDPDK 60

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I LYINSPGGVVTAGMAIYDTMQ+IKP + T CMGQA SMGS LL+ G  G RFALP++
Sbjct: 61  DIYLYINSPGGVVTAGMAIYDTMQYIKPDVCTLCMGQACSMGSFLLAGGAPGKRFALPHS 120

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           RI++HQP GGF GQASDI  HA++  ++KR L E+  K+ GK+ +EV +  DRD+ MSA 
Sbjct: 121 RIMIHQPLGGFKGQASDIMIHARETERVKRTLTELLAKHTGKSVDEVMQDCDRDNFMSAE 180

Query: 194 EACDWGVVDKVLMSRIDI 211
           EA  +G++D+V+ SR +I
Sbjct: 181 EALAYGLIDRVITSRDEI 198


>gi|289523086|ref|ZP_06439940.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503629|gb|EFD24793.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 194

 Score =  237 bits (605), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 119/191 (62%), Positives = 153/191 (80%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+V+EQT RGER+YDIYSRLLK+RI+F+   IE+H+A L+ AQ+LFLE+E+P K+I+L
Sbjct: 4   LVPIVIEQTGRGERAYDIYSRLLKDRIIFLGDVIEEHLANLVVAQMLFLESEDPDKDINL 63

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG+ IYDTMQ+IK P+ST C+GQAASM ++LL+AG KG R ALPN+R++L
Sbjct: 64  YINSPGGSVTAGLGIYDTMQYIKCPVSTICVGQAASMAAVLLAAGAKGKRIALPNSRVML 123

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  GQA+DIE HA++I KI+ RLNEI   +  +  E+V K  DRD  MSA EA  
Sbjct: 124 HQPLGGVQGQATDIEIHAKEIKKIRDRLNEIIAYHTNQDIEKVAKDTDRDFFMSAEEALA 183

Query: 198 WGVVDKVLMSR 208
           +G+VDKV+  R
Sbjct: 184 YGIVDKVIEKR 194


>gi|322515314|ref|ZP_08068311.1| ATP-dependent Clp protease, protease subunit [Actinobacillus ureae
           ATCC 25976]
 gi|322118690|gb|EFX90902.1| ATP-dependent Clp protease, protease subunit [Actinobacillus ureae
           ATCC 25976]
          Length = 217

 Score =  237 bits (605), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 119/194 (61%), Positives = 156/194 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT++GERSYDIYSRLLKERI+F+ G++EDHMA LI AQLLFLE+E+P+K+I
Sbjct: 22  MAVIPMVVEQTSKGERSYDIYSRLLKERIIFLNGEVEDHMANLIVAQLLFLESEDPEKDI 81

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGVVTAG+AIYDTM FIKP ++T C GQA SMG+ LLS G KG RFALP+AR+
Sbjct: 82  YLYINSPGGVVTAGLAIYDTMNFIKPDVATLCTGQACSMGAFLLSGGAKGKRFALPHARV 141

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+  AQ+I+K+K  L +    + G+ +E+V    +RD+ MSA EA
Sbjct: 142 MIHQPLGGARGQATDIQIQAQEILKLKEMLTKRMAGHSGQPFEKVAADTERDNFMSAFEA 201

Query: 196 CDWGVVDKVLMSRI 209
            ++G++DKVL  R 
Sbjct: 202 AEYGLIDKVLTHRD 215


>gi|56421597|ref|YP_148915.1| ATP-dependent Clp protease proteolytic subunit [Geobacillus
           kaustophilus HTA426]
 gi|261420500|ref|YP_003254182.1| ATP-dependent Clp protease proteolytic subunit [Geobacillus sp.
           Y412MC61]
 gi|319768169|ref|YP_004133670.1| ATP-dependent Clp protease proteolytic subunit ClpP [Geobacillus
           sp. Y412MC52]
 gi|67460172|sp|Q5KVD9|CLPP_GEOKA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56381439|dbj|BAD77347.1| ATP-dependent Clp protease proteolytic subunit (class III
           heat-shock protein) [Geobacillus kaustophilus HTA426]
 gi|261376957|gb|ACX79700.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacillus
           sp. Y412MC61]
 gi|317113035|gb|ADU95527.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacillus
           sp. Y412MC52]
          Length = 196

 Score =  237 bits (605), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 112/195 (57%), Positives = 152/195 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RIVF+   I+D +A  I +QLLFL AE+P K+I
Sbjct: 1   MYLIPTVIEQTNRGERAYDIYSRLLKDRIVFLGSPIDDQVANSIVSQLLFLAAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAG+AIYDTMQFIKP +ST C+G AASMG+ LL+AG KG RFALPN+ I
Sbjct: 61  SLYINSPGGSITAGLAIYDTMQFIKPDVSTICIGMAASMGAFLLAAGAKGKRFALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN I  +N G+  E +E+  DRD+ M+A +A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLRDKLNRILSENTGQPIEVIERDTDRDNFMTAQKA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++D+VL    +
Sbjct: 181 MEYGIIDRVLTRADE 195


>gi|222055723|ref|YP_002538085.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter sp.
           FRC-32]
 gi|254763790|sp|B9M0Y1|CLPP_GEOSF RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|221565012|gb|ACM20984.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Geobacter sp.
           FRC-32]
          Length = 199

 Score =  237 bits (604), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 117/192 (60%), Positives = 157/192 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RI+F+ G I+D ++ L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIIFLGGAIDDTVSNLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTM++IK P+ST C+GQAASMG+ LLS GEKG RF+L N+RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMRYIKAPVSTICVGQAASMGAFLLSGGEKGKRFSLANSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HAQ+I+++K++LNE+  ++ G+T E++E   +RD+ MS  +A  
Sbjct: 122 HQPLGGFQGQATDIHIHAQEILRMKKKLNELLAEHSGQTVEKIEADTERDYFMSGEDAKT 181

Query: 198 WGVVDKVLMSRI 209
           +G++D ++    
Sbjct: 182 YGIIDSIITRNT 193


>gi|88810607|ref|ZP_01125864.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrococcus
           mobilis Nb-231]
 gi|88792237|gb|EAR23347.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Nitrococcus
           mobilis Nb-231]
          Length = 214

 Score =  237 bits (604), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 118/206 (57%), Positives = 159/206 (77%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
            + +  E +  GLVPMVVEQT RGER+YDIYSRLLKER++F+ G +EDH A L+ AQLLF
Sbjct: 4   SSDRRHEPMATGLVPMVVEQTARGERAYDIYSRLLKERVIFLVGPVEDHQANLLIAQLLF 63

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP K+I LYINSPGGVV+AG+AIYDTMQF+KP +ST C+GQAASMG+LLL+ G  G
Sbjct: 64  LESENPDKDIHLYINSPGGVVSAGLAIYDTMQFVKPDVSTVCLGQAASMGALLLTGGAAG 123

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            R+ LPN+RI++HQP GGF GQA+D+E HA++I+ ++ RLN+I  ++ G+  E +++  +
Sbjct: 124 KRYCLPNSRIMIHQPLGGFQGQATDVEIHAREILAMRERLNQILAQHTGQDIETIQQDTE 183

Query: 186 RDHIMSASEACDWGVVDKVLMSRIDI 211
           RD+ M    A  +G+VD VL  R  +
Sbjct: 184 RDNFMGPEAAQSYGIVDGVLRDRGKL 209


>gi|78066693|ref|YP_369462.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia sp.
           383]
 gi|167586932|ref|ZP_02379320.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           ubonensis Bu]
 gi|90101404|sp|Q39FE8|CLPP_BURS3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|77967438|gb|ABB08818.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           sp. 383]
          Length = 217

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 120/198 (60%), Positives = 157/198 (79%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP
Sbjct: 20  EAQALGLVPIVVETSGRGERSYDIYSRLLKERLVFMVGEVNDQTANLVVAQLLFLESENP 79

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+ISLYINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G KG RFALP
Sbjct: 80  DKDISLYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLASGAKGKRFALP 139

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GG  GQASDIE  A++I+ +K RLN++  ++ G+  E + +  DRD+ MS
Sbjct: 140 NSRVMIHQPLGGARGQASDIEIQAREILYLKERLNQLLAQHTGQDVERIARDTDRDNFMS 199

Query: 192 ASEACDWGVVDKVLMSRI 209
           + +A  +G++D+VL+ R 
Sbjct: 200 SEDAKAYGLIDQVLLKRP 217


>gi|15837789|ref|NP_298477.1| ATP-dependent Clp protease proteolytic subunit [Xylella fastidiosa
           9a5c]
 gi|18203347|sp|Q9PE41|CLPP_XYLFA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|9106157|gb|AAF83997.1|AE003953_1 ATP-dependent Clp protease proteolytic subunit [Xylella fastidiosa
           9a5c]
          Length = 208

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 124/201 (61%), Positives = 164/201 (81%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           D     L LVPMVVEQT+RGER+YDIYSRLLKER++F+ G I+D+MA LI AQLLFLEAE
Sbjct: 2   DDVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDDYMANLIVAQLLFLEAE 61

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP+K+I++YINSPGGVVTAGMAIYDTMQ+IKP +ST C+GQAASMG+LLL++G  G R+A
Sbjct: 62  NPEKDINIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAASMGALLLASGASGKRYA 121

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           LPN+R+++HQP GGF GQA+DI+ HA++I+ ++ RLNEI  K+ G++ E +    +RD+ 
Sbjct: 122 LPNSRVMIHQPLGGFQGQATDIDIHAREILALRARLNEILAKHTGQSLETIAHDTERDNF 181

Query: 190 MSASEACDWGVVDKVLMSRID 210
            SA +A  +G+VD+VL  R +
Sbjct: 182 KSAVDAQAYGLVDQVLGQRPE 202


>gi|30265176|ref|NP_847553.1| ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis
           str. Ames]
 gi|47530690|ref|YP_022039.1| ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49187986|ref|YP_031239.1| ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis
           str. Sterne]
 gi|65317122|ref|ZP_00390081.1| COG0740: Protease subunit of ATP-dependent Clp proteases [Bacillus
           anthracis str. A2012]
 gi|165869926|ref|ZP_02214583.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0488]
 gi|167635263|ref|ZP_02393578.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0442]
 gi|167640458|ref|ZP_02398721.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0193]
 gi|170687959|ref|ZP_02879172.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0465]
 gi|170707727|ref|ZP_02898178.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0389]
 gi|177652976|ref|ZP_02935303.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0174]
 gi|190567666|ref|ZP_03020578.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis Tsiankovskii-I]
 gi|227817909|ref|YP_002817918.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. CDC 684]
 gi|229599890|ref|YP_002869370.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0248]
 gi|254686423|ref|ZP_05150282.1| ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis
           str. CNEVA-9066]
 gi|254735629|ref|ZP_05193336.1| ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis
           str. Western North America USA6153]
 gi|254744284|ref|ZP_05201964.1| ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis
           str. Kruger B]
 gi|254755582|ref|ZP_05207615.1| ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis
           str. Vollum]
 gi|254757037|ref|ZP_05209065.1| ATP-dependent Clp protease proteolytic subunit [Bacillus anthracis
           str. Australia 94]
 gi|67460531|sp|Q81X63|CLPP2_BACAN RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|30259853|gb|AAP29039.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. Ames]
 gi|47505838|gb|AAT34514.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|49181913|gb|AAT57289.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. Sterne]
 gi|164714249|gb|EDR19769.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0488]
 gi|167511501|gb|EDR86884.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0193]
 gi|167529306|gb|EDR92058.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0442]
 gi|170127284|gb|EDS96160.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0389]
 gi|170668068|gb|EDT18818.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0465]
 gi|172081751|gb|EDT66821.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0174]
 gi|190561082|gb|EDV15055.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis Tsiankovskii-I]
 gi|227003920|gb|ACP13663.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. CDC 684]
 gi|229264298|gb|ACQ45935.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           anthracis str. A0248]
          Length = 193

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 105/193 (54%), Positives = 152/193 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLE+++P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG R+ALPN+  
Sbjct: 61  HIYINSPGGSITAGMAIYDTMQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEA 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN+I     G+  E +++  DRD+ M+A +A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQPLEVLQRDTDRDNFMTAEKA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++DK+  +R
Sbjct: 181 LEYGLIDKIFTNR 193


>gi|229541478|ref|ZP_04430538.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           coagulans 36D1]
 gi|229325898|gb|EEN91573.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           coagulans 36D1]
          Length = 196

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 106/194 (54%), Positives = 150/194 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D+++  I +QLLFLEAENP+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVSNSIVSQLLFLEAENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG+AIYDTMQ IKP + T C+G AASMGS+LL+AG KG R+ALPN+ +
Sbjct: 61  YLYINSPGGSVTAGLAIYDTMQIIKPDVQTICVGMAASMGSVLLTAGTKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+  + +LN+I   + G+  E +E+  DRD+ MSA +A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKHILYTRAKLNKILSDHTGQPIEVIERDTDRDNFMSAEKA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D ++  + 
Sbjct: 181 KEYGLIDHIMTKKE 194


>gi|226533042|ref|NP_001147355.1| ATP-dependent Clp protease proteolytic subunit [Zea mays]
 gi|194700894|gb|ACF84531.1| unknown [Zea mays]
 gi|195610476|gb|ACG27068.1| ATP-dependent Clp protease proteolytic subunit [Zea mays]
          Length = 260

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 119/193 (61%), Positives = 156/193 (80%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K + 
Sbjct: 36  GLVPMVIEHTSRGERAYDIFSRLLKERIVCIHGPITDDTASLVVAQLLFLESENPAKPVH 95

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASM SLLL+AG  G R ALPNAR++
Sbjct: 96  LYINSPGGVVTAGLAIYDTMQYIRSPVTTLCIGQAASMASLLLAAGASGERRALPNARVM 155

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI  HA++I+K++ RLN+IY K+ G+  + +E+ ++RD  M   EA 
Sbjct: 156 IHQPSGGASGQASDIAIHAKEILKVRDRLNKIYAKHTGQAIDRIEQCMERDMFMDPEEAH 215

Query: 197 DWGVVDKVLMSRI 209
           +WG++D+V+  R 
Sbjct: 216 EWGLIDEVIEHRP 228


>gi|167464584|ref|ZP_02329673.1| ATP-dependent Clp protease proteolytic subunit [Paenibacillus
           larvae subsp. larvae BRL-230010]
          Length = 196

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 115/197 (58%), Positives = 158/197 (80%), Gaps = 1/197 (0%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+PMVVEQ  RGERSYDIYSRLLK+RI+F+   I+D +  L+ AQLLFL A++  K+I
Sbjct: 1   MSLIPMVVEQEARGERSYDIYSRLLKDRIIFIGSAIDDDVVNLVIAQLLFLSAQDADKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG+ IYDTMQ+IKP +ST C+G AASMGSLLL+AG KG RFALPN+ +
Sbjct: 61  HLYINSPGGSVTAGLGIYDTMQYIKPDVSTICVGMAASMGSLLLTAGAKGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI+ HA  I+K +++LNEIYV + G+TY++++K  DRD+ +SA +A
Sbjct: 121 MIHQPLGGVRGQAADIKIHADWILKTRKKLNEIYVHHTGQTYDKIDKDTDRDNFLSALDA 180

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+V+  R D++
Sbjct: 181 KEYGLIDEVIT-RSDLK 196


>gi|154687585|ref|YP_001422746.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           amyloliquefaciens FZB42]
 gi|308175199|ref|YP_003921904.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           amyloliquefaciens DSM 7]
 gi|166201799|sp|A7Z939|CLPP_BACA2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|154353436|gb|ABS75515.1| ClpP [Bacillus amyloliquefaciens FZB42]
 gi|307608063|emb|CBI44434.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           amyloliquefaciens DSM 7]
 gi|328555171|gb|AEB25663.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           amyloliquefaciens TA208]
 gi|328913529|gb|AEB65125.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           amyloliquefaciens LL3]
          Length = 198

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 110/198 (55%), Positives = 156/198 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLEAE+P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG R+ALPN+ +
Sbjct: 61  SIYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN++  +  G+  E +E+  DRD+  SA EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSADEA 180

Query: 196 CDWGVVDKVLMSRIDIEE 213
            ++G++DKVL    + ++
Sbjct: 181 LEYGLIDKVLTRNTEDQK 198


>gi|315641411|ref|ZP_07896485.1| ATP-dependent Clp protease proteolytic subunit [Enterococcus
           italicus DSM 15952]
 gi|315482847|gb|EFU73369.1| ATP-dependent Clp protease proteolytic subunit [Enterococcus
           italicus DSM 15952]
          Length = 194

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 108/194 (55%), Positives = 151/194 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQ++RGER+YDIYSRLLK+RI+ ++GQ+ D +A  I +QLLFL+A++ +K+I
Sbjct: 1   MNLIPTVIEQSSRGERAYDIYSRLLKDRIIMLSGQVTDDLANSIISQLLFLDAQDSEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG+AIYDTM F+K  + T  MG AASMGS LL+AG+KG RFALPNA I
Sbjct: 61  YLYINSPGGSVTAGLAIYDTMNFVKADVQTIVMGMAASMGSFLLTAGKKGKRFALPNAEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+K + RLN I  +  G+  E +EK  DRD+ M+A EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAARHILKTRERLNNILAERTGQPLEVIEKDTDRDNFMTAQEA 180

Query: 196 CDWGVVDKVLMSRI 209
            D+G++D++L+++ 
Sbjct: 181 KDYGLIDQILVNKK 194


>gi|294501768|ref|YP_003565468.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           megaterium QM B1551]
 gi|295707118|ref|YP_003600193.1| ATP-dependent Clp protease proteolytic subunit ClpP [Bacillus
           megaterium DSM 319]
 gi|294351705|gb|ADE72034.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           megaterium QM B1551]
 gi|294804777|gb|ADF41843.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           megaterium DSM 319]
          Length = 195

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 110/195 (56%), Positives = 152/195 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFL AE+P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIILGSAIDDNVANSIVSQLLFLAAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG RFALPN+ +
Sbjct: 61  SLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN I  +  G+  E +++  DRD+ M+A  A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLREKLNSILAERTGQPLEVLQRDTDRDNFMTAERA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G++DKVL +   
Sbjct: 181 LEYGLIDKVLENDPK 195


>gi|107028898|ref|YP_625993.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           cenocepacia AU 1054]
 gi|115351962|ref|YP_773801.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           ambifaria AMMD]
 gi|116689944|ref|YP_835567.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           cenocepacia HI2424]
 gi|170702050|ref|ZP_02892966.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           ambifaria IOP40-10]
 gi|170733282|ref|YP_001765229.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           cenocepacia MC0-3]
 gi|171320790|ref|ZP_02909797.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           ambifaria MEX-5]
 gi|172060888|ref|YP_001808540.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           ambifaria MC40-6]
 gi|206560359|ref|YP_002231123.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           cenocepacia J2315]
 gi|116243129|sp|Q1BH85|CLPP_BURCA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|122322952|sp|Q0BEF6|CLPP_BURCM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166201802|sp|A0K847|CLPP_BURCH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|105898062|gb|ABF81020.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           cenocepacia AU 1054]
 gi|115281950|gb|ABI87467.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           ambifaria AMMD]
 gi|116648033|gb|ABK08674.1| ATP-dependent Clp protease proteolytic subunit ClpP [Burkholderia
           cenocepacia HI2424]
 gi|169816524|gb|ACA91107.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           cenocepacia MC0-3]
 gi|170133036|gb|EDT01448.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           ambifaria IOP40-10]
 gi|171093960|gb|EDT39074.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           ambifaria MEX-5]
 gi|171993405|gb|ACB64324.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           ambifaria MC40-6]
 gi|198036400|emb|CAR52296.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           cenocepacia J2315]
          Length = 217

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 120/198 (60%), Positives = 156/198 (78%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP
Sbjct: 20  EAQALGLVPIVVETSGRGERSYDIYSRLLKERLVFMVGEVNDQTANLVVAQLLFLESENP 79

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+ISLYINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G KG RFALP
Sbjct: 80  DKDISLYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLASGAKGKRFALP 139

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E + +  DRD+ MS
Sbjct: 140 NSRVMIHQPLGGARGQASDIEIQAREILYLKERLNNLLAQHTGQDVERIARDTDRDNFMS 199

Query: 192 ASEACDWGVVDKVLMSRI 209
           + +A  +G++D+VL+ R 
Sbjct: 200 SEDAKAYGLIDQVLLKRP 217


>gi|119945201|ref|YP_942881.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Psychromonas
           ingrahamii 37]
 gi|259585963|sp|A1SUW7|CLPP_PSYIN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|119863805|gb|ABM03282.1| ATP-dependent Clp protease proteolytic subunit ClpP [Psychromonas
           ingrahamii 37]
          Length = 207

 Score =  237 bits (604), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 118/207 (57%), Positives = 157/207 (75%)

Query: 3   FEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQ 62
                  +++ +   L+PMVVEQT +GERSYDIYSRLLKER++F+TG +EDH+A +I AQ
Sbjct: 1   MSNPFAGNTDPISNALIPMVVEQTAKGERSYDIYSRLLKERVIFLTGPVEDHVANVIAAQ 60

Query: 63  LLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAG 122
           LLFLE+E+P+K+I +YINSPGG ++AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G
Sbjct: 61  LLFLESESPEKDIFIYINSPGGSISAGMAIYDTMQFIKPDVSTVCMGMAASMGAFLLASG 120

Query: 123 EKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK 182
             G R  LPNA++++HQP GGF GQASD E HA++I+  K R+NE+   + GK  E + +
Sbjct: 121 APGKRHCLPNAKVMIHQPLGGFQGQASDFEIHAKEILATKHRMNELLAFHTGKDIEIIAQ 180

Query: 183 TLDRDHIMSASEACDWGVVDKVLMSRI 209
             DRD+ M ASEA ++G+VD VL  R 
Sbjct: 181 DTDRDNFMRASEAVEYGIVDSVLTHRK 207


>gi|116243161|sp|Q1RJH2|CLPP_RICBR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
          Length = 227

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 125/202 (61%), Positives = 165/202 (81%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +   E   +  VP+V+EQT+RGER+YDIYSRLLKERI+FV G IEDHMA LI AQLLFLE
Sbjct: 15  ENFKEKYPMSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCGPIEDHMANLITAQLLFLE 74

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+K+I +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGS LL  GEKGMR
Sbjct: 75  AENPEKDIYMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSFLLCGGEKGMR 134

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           ++LP++R+++HQPSGG+ GQA+DIE HAQ+ +KIK+ LN +Y K+ G+  + VEK+++RD
Sbjct: 135 YSLPHSRVMIHQPSGGYRGQATDIEIHAQETLKIKKILNSLYSKHTGQDVKHVEKSMERD 194

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + MS  EA  +G++DK++  R 
Sbjct: 195 NFMSPEEAKKFGIIDKIITHRD 216


>gi|15643458|ref|NP_228504.1| ATP-dependent Clp protease proteolytic subunit [Thermotoga maritima
           MSB8]
 gi|148269380|ref|YP_001243840.1| ATP-dependent Clp protease proteolytic subunit [Thermotoga
           petrophila RKU-1]
 gi|170288038|ref|YP_001738276.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermotoga
           sp. RQ2]
 gi|281411923|ref|YP_003346002.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermotoga
           naphthophila RKU-10]
 gi|6685314|sp|Q9WZF9|CLPP_THEMA RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214719|sp|A5IJ91|CLPP_THEP1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|226706553|sp|B1L812|CLPP_THESQ RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|4981218|gb|AAD35777.1|AE001741_10 ATP-dependent Clp protease, proteolytic subunit [Thermotoga
           maritima MSB8]
 gi|147734924|gb|ABQ46264.1| ATP-dependent Clp protease proteolytic subunit ClpP [Thermotoga
           petrophila RKU-1]
 gi|170175541|gb|ACB08593.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermotoga
           sp. RQ2]
 gi|281373026|gb|ADA66588.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Thermotoga
           naphthophila RKU-10]
          Length = 203

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 113/192 (58%), Positives = 150/192 (78%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
            VP+VVE T R ER+YDI+SRLLK+RIVF+   I+D++A L+ AQLLFLEAE+P K++ L
Sbjct: 12  YVPIVVESTGRYERAYDIFSRLLKDRIVFLGSPIDDYVANLVIAQLLFLEAEDPDKDVYL 71

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAG+AIYDTMQ+IK  +ST C+GQAASM ++LL+AG KG R+ALPNARI++
Sbjct: 72  YINSPGGSVTAGLAIYDTMQYIKCDVSTICVGQAASMAAVLLAAGAKGKRYALPNARIMI 131

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GG  G A D+E   +++++IK  LN I  K+ G+  E++EK  DRD  MSA EA +
Sbjct: 132 HQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKE 191

Query: 198 WGVVDKVLMSRI 209
           +G+VDKV+ +R 
Sbjct: 192 YGIVDKVVSTRE 203


>gi|307822658|ref|ZP_07652889.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylobacter
           tundripaludum SV96]
 gi|307736262|gb|EFO07108.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Methylobacter
           tundripaludum SV96]
          Length = 215

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 120/198 (60%), Positives = 165/198 (83%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVP+V+EQT RGERS+DIYSRLLKER++F+ GQ+ED+ A LI AQLLFLE+ENP K+I 
Sbjct: 18  GLVPIVIEQTARGERSFDIYSRLLKERVIFLVGQVEDYSANLIVAQLLFLESENPDKDIH 77

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+LLL+ G KG R+ LP++R++
Sbjct: 78  LYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGALLLAGGAKGKRYCLPHSRMM 137

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG+ GQASDI+ HA++I+ I+ +LN+I   + G+  E+V++  DRD+ +SA++A 
Sbjct: 138 IHQPLGGYQGQASDIDIHAREILLIREKLNKILSDHTGQPMEKVQQDTDRDNFLSANDAV 197

Query: 197 DWGVVDKVLMSRIDIEEK 214
            +G++D+VL+SR  + +K
Sbjct: 198 SYGLIDQVLLSRATVADK 215


>gi|330817271|ref|YP_004360976.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           gladioli BSR3]
 gi|327369664|gb|AEA61020.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           gladioli BSR3]
          Length = 217

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 123/208 (59%), Positives = 157/208 (75%)

Query: 2   SFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICA 61
           +    A +D E   LGLVP+VVE + RGERSYDIYSRLLKERIVF+ G++ D  A L+ A
Sbjct: 10  TLASHAPQDFETKALGLVPIVVETSGRGERSYDIYSRLLKERIVFMVGEVNDQTANLVVA 69

Query: 62  QLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSA 121
           QLLFLE+ENP K+ISLYINSPGG V+AG+AIYDTMQFIKP +ST CMG AASMG+ LLS+
Sbjct: 70  QLLFLESENPDKDISLYINSPGGSVSAGLAIYDTMQFIKPDVSTLCMGLAASMGAFLLSS 129

Query: 122 GEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVE 181
           G KG R+ALPNAR+++HQP GG  GQASDIE  A++I+ ++ RLN+I   N G+  E + 
Sbjct: 130 GAKGKRYALPNARVMIHQPLGGARGQASDIEIQAREILYLRERLNKILADNTGQDVERIA 189

Query: 182 KTLDRDHIMSASEACDWGVVDKVLMSRI 209
           +  DRD+ MS+ +A  +G++D V   R 
Sbjct: 190 RDTDRDNFMSSDDAKAYGLIDHVTAKRP 217


>gi|329122525|ref|ZP_08251109.1| ATP-dependent Clp protease, protease subunit [Haemophilus aegyptius
           ATCC 11116]
 gi|327473154|gb|EGF18577.1| ATP-dependent Clp protease, protease subunit [Haemophilus aegyptius
           ATCC 11116]
          Length = 211

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 124/193 (64%), Positives = 158/193 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + ++PMVVEQT+RGERSYDIYSRLLKER++F++G++ED MA LI AQLLFLE+E+P K+I
Sbjct: 19  MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDI 78

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           ++YINSPGG VTAGMAIYDTMQFIKP I T C+GQA SMG+ LL+ G  G R ALPNAR+
Sbjct: 79  NIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARV 138

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQASDI+ HAQ+I+KIK  LN+    + G++ E +EK  DRD+ MSA EA
Sbjct: 139 MIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQSIERIEKDTDRDNFMSAEEA 198

Query: 196 CDWGVVDKVLMSR 208
             +G+VD+VL+ R
Sbjct: 199 QVYGLVDEVLVKR 211


>gi|323697668|ref|ZP_08109580.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           sp. ND132]
 gi|323457600|gb|EGB13465.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Desulfovibrio
           desulfuricans ND132]
          Length = 202

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 120/201 (59%), Positives = 163/201 (81%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  +PMV+E T R ER+YDIYSRLLK+RI+ +   I+DH+A+LICAQLLFLE+E+P+KEI
Sbjct: 1   MVAIPMVIETTGRTERAYDIYSRLLKDRIILLGTAIDDHVASLICAQLLFLESEDPEKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            +YINSPGGVVT+GMAIYDTMQ+I  P++T CMGQAASM SLLL AGEKGMR++LP++RI
Sbjct: 61  YMYINSPGGVVTSGMAIYDTMQYISAPVATLCMGQAASMASLLLCAGEKGMRYSLPHSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           L+HQP GG  GQASDI  HA++I+++K  LN I  ++ G++ E++    DRD+ MS+ EA
Sbjct: 121 LIHQPLGGAQGQASDISIHAKEILRMKDELNGIMARHTGQSIEKITADTDRDYFMSSEEA 180

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
            ++G++DKV+ SR D++E  K
Sbjct: 181 LEYGLIDKVMKSRADVDESIK 201


>gi|116785036|gb|ABK23566.1| unknown [Picea sitchensis]
          Length = 243

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 123/193 (63%), Positives = 159/193 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GL+PMV+EQT+RGER+YDI+SRLLKERI+ + G IED  A ++ AQLLFLE+ENP K I+
Sbjct: 32  GLIPMVIEQTSRGERAYDIFSRLLKERIICINGVIEDDTAAVVVAQLLFLESENPAKPIN 91

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P+STFCMGQAASMGSLLL+AG KG R +LPNARI+
Sbjct: 92  LYINSPGGVVTAGLAIYDTMQYIRSPVSTFCMGQAASMGSLLLAAGAKGERRSLPNARIM 151

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI   A++I+  + RLN +Y K+ G++ +++EK ++RD  MS  EA 
Sbjct: 152 IHQPSGGASGQASDIAIQAKEILLTRDRLNSLYAKHTGQSIDKIEKCMERDMFMSPEEAK 211

Query: 197 DWGVVDKVLMSRI 209
           ++G+VD V+  R 
Sbjct: 212 EFGLVDTVIEQRP 224


>gi|34558484|ref|NP_908299.1| ATP-dependent Clp protease proteolytic subunit [Wolinella
           succinogenes DSM 1740]
 gi|60389700|sp|Q7M7M3|CLPP_WOLSU RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|34481778|emb|CAE11199.1| ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT [Wolinella
           succinogenes]
          Length = 195

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 109/192 (56%), Positives = 150/192 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  +P V+E+T RGERSYDIYSRLLK+RI+ ++G+I D +A+ I +Q+LFLEAE+P+K+I
Sbjct: 1   MNYIPYVIEKTGRGERSYDIYSRLLKDRIIMLSGEINDGVASSIVSQMLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGGV+T+GM+IYDTM ++KP I T C+GQAASMG+ LLS G KG RF+LPN+RI
Sbjct: 61  YLYINSPGGVITSGMSIYDTMNYVKPDICTICIGQAASMGAFLLSCGTKGKRFSLPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DIE  A++I+++K  LN I   N G+  E++ K  DRD  MSA E+
Sbjct: 121 MIHQPLGGAQGQATDIEIQAKEILRLKSILNGILASNTGQPLEKIAKDTDRDFFMSAQES 180

Query: 196 CDWGVVDKVLMS 207
            ++G++D VL  
Sbjct: 181 KEYGLIDNVLEK 192


>gi|225028671|ref|ZP_03717863.1| hypothetical protein EUBHAL_02950 [Eubacterium hallii DSM 3353]
 gi|224953981|gb|EEG35190.1| hypothetical protein EUBHAL_02950 [Eubacterium hallii DSM 3353]
          Length = 194

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 111/194 (57%), Positives = 149/194 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP V+EQT+ GERSYDIYSRLLKERI+F+  ++ D  A+LI +QLLFLE+E+P+K+I
Sbjct: 1   MSLVPYVIEQTSHGERSYDIYSRLLKERIIFLGEEVNDTTASLIVSQLLFLESEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYI SPGG VTAGMAIYDTMQF+K  +ST CMG AASMG+ LL+ G KG R ALPN+ I
Sbjct: 61  SLYIMSPGGSVTAGMAIYDTMQFVKCDVSTICMGMAASMGAFLLAGGAKGKRLALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGG  GQA++IE  A+ I+  K +LN I  +N G+ YE++ +  +RD+ M+A +A
Sbjct: 121 MIHQPSGGAQGQATEIEIVAEHILHTKEKLNRILAENTGQPYEKIVQDTERDNYMTAEQA 180

Query: 196 CDWGVVDKVLMSRI 209
             +G++D V+  R 
Sbjct: 181 KAYGLIDAVVEKRQ 194


>gi|126668931|ref|ZP_01739872.1| ATP-dependent Clp protease proteolytic subunit [Marinobacter sp.
           ELB17]
 gi|126626594|gb|EAZ97250.1| ATP-dependent Clp protease proteolytic subunit [Marinobacter sp.
           ELB17]
          Length = 211

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 113/206 (54%), Positives = 151/206 (73%)

Query: 3   FEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQ 62
            +      +      LVPMV+EQT RGERS+DIYSRLLKER++F+ G +EDHMA L+ AQ
Sbjct: 2   MQKPIDGSAMSTSAALVPMVIEQTARGERSFDIYSRLLKERVIFMVGPVEDHMANLVVAQ 61

Query: 63  LLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAG 122
           LLFLE+ENP K+I LYINSPGG V+AGM+IYDTMQFIKP ++T C+GQAASMG+ LL+ G
Sbjct: 62  LLFLESENPDKDIHLYINSPGGSVSAGMSIYDTMQFIKPDVATLCVGQAASMGAFLLAGG 121

Query: 123 EKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEK 182
             G R  LPN+R+++HQP GG+ GQA+DIE H ++I+KI+  LN I   + G+  E + +
Sbjct: 122 AAGKRACLPNSRVMIHQPLGGYQGQATDIEIHTREILKIRHTLNSILAHHTGQDLETISR 181

Query: 183 TLDRDHIMSASEACDWGVVDKVLMSR 208
             DRD+ M  ++A  +G++D VL  R
Sbjct: 182 DTDRDNFMDPTQAKAYGLIDSVLDKR 207


>gi|323488686|ref|ZP_08093928.1| ATP-dependent Clp protease proteolytic subunit [Planococcus
           donghaensis MPA1U2]
 gi|323397704|gb|EGA90508.1| ATP-dependent Clp protease proteolytic subunit [Planococcus
           donghaensis MPA1U2]
          Length = 203

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 107/201 (53%), Positives = 152/201 (75%), Gaps = 1/201 (0%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQT+RGER+YDIYSRLLK+R++ +   I+D++A  I AQLLFLEAE+P K+I
Sbjct: 1   MNLIPTVIEQTSRGERAYDIYSRLLKDRVIMLGSAIDDNVANSIVAQLLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG +TAGMAIYDTMQFI+P + T C+G AASMG+ LL+AG KG R ALPNA +
Sbjct: 61  SIYINSPGGSITAGMAIYDTMQFIRPDVQTICIGMAASMGAFLLAAGTKGKRLALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN+I  +  G+  + + K  DRD+ M+A  A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILHLREKLNQILSERTGQPIDVIAKDTDRDNFMTAERA 180

Query: 196 CDWGVVDKVLMSRIDIEEKSK 216
            ++G++D+V+  R  + E  K
Sbjct: 181 LEYGLIDQVIT-RSKLPENHK 200


>gi|254520131|ref|ZP_05132187.1| endopeptidase Clp [Clostridium sp. 7_2_43FAA]
 gi|226913880|gb|EEH99081.1| endopeptidase Clp [Clostridium sp. 7_2_43FAA]
          Length = 198

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 114/195 (58%), Positives = 153/195 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQT+RGERSYDI+SRLLK+RI+ ++G+I D  + L+ +QLLFLE+E+P K+I
Sbjct: 1   MSLVPMVVEQTSRGERSYDIFSRLLKDRIIMLSGEINDTTSNLVVSQLLFLESEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG +TAGMAIYDTMQ+IKP +ST C+G AASMGS LLS+G KG RF LPN+ I
Sbjct: 61  HLYINSPGGSITAGMAIYDTMQYIKPDVSTICIGMAASMGSFLLSSGAKGKRFVLPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GGF GQA+D + HA+ I+KIK  LN I  +N  +  E+++  ++RD+ M+A EA
Sbjct: 121 MIHQPLGGFQGQATDFDIHARRIIKIKESLNRILSENTNQPLEKIKTDVERDYFMTAEEA 180

Query: 196 CDWGVVDKVLMSRID 210
            ++G+VDKV+     
Sbjct: 181 MNYGLVDKVITKNDK 195


>gi|317133441|ref|YP_004092755.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Ethanoligenens harbinense YUAN-3]
 gi|315471420|gb|ADU28024.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Ethanoligenens harbinense YUAN-3]
          Length = 194

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 110/194 (56%), Positives = 151/194 (77%)

Query: 15  FLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKE 74
              LVP V+EQT+RGERSYDI+SRLL +RI+ ++ Q+ D  A+L+ AQLLFLE ++P K+
Sbjct: 1   MSNLVPYVIEQTSRGERSYDIFSRLLNDRIIMLSDQVNDVTASLVVAQLLFLEGQDPDKD 60

Query: 75  ISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNAR 134
           I LYINSPGG +T+GMAI+DTMQ++K  +ST C+G AASMGS LL+AG KG RF LPN+ 
Sbjct: 61  IQLYINSPGGSITSGMAIFDTMQYVKCDVSTICIGMAASMGSFLLAAGTKGKRFVLPNSE 120

Query: 135 ILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASE 194
           I++HQPSGG  GQASDI+  A+ I++I++R+NE+Y    GK  EE+E+  +RD+ ++A E
Sbjct: 121 IMIHQPSGGAQGQASDIKIAAEHIIRIRKRMNELYSGFTGKPVEEIERDTERDNFLTAEE 180

Query: 195 ACDWGVVDKVLMSR 208
           A  +G+VDKV+  R
Sbjct: 181 AVAYGLVDKVITKR 194


>gi|160902469|ref|YP_001568050.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Petrotoga
           mobilis SJ95]
 gi|160360113|gb|ABX31727.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Petrotoga
           mobilis SJ95]
          Length = 205

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 106/197 (53%), Positives = 152/197 (77%)

Query: 19  VPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISLY 78
           +P+V+E   R ER+YDIYSRLLK+RIVF+   I D +A +I AQLLFLE+++P K+I LY
Sbjct: 5   MPVVIETEGRYERAYDIYSRLLKDRIVFLGTPINDDVANVIIAQLLFLESQDPDKDIFLY 64

Query: 79  INSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILLH 138
           INSPGG VT+G+ IYDTMQ++KP IST C+GQAASMG++LL+AG KG R++LP +RI++H
Sbjct: 65  INSPGGSVTSGLGIYDTMQYVKPDISTICIGQAASMGAVLLAAGAKGKRYSLPYSRIMIH 124

Query: 139 QPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACDW 198
           QP GG  G A DI+ HA++I+++K  LN I  K+ G++ E++EK  +RD  M+A EA ++
Sbjct: 125 QPWGGAEGTAIDIQIHAREILRLKDDLNNILSKHTGQSLEKIEKDTERDFFMNAQEALNY 184

Query: 199 GVVDKVLMSRIDIEEKS 215
           G++DKV+ ++ +   K 
Sbjct: 185 GLIDKVITTKSEATAKE 201


>gi|319891770|ref|YP_004148645.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161466|gb|ADV05009.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           pseudintermedius HKU10-03]
          Length = 195

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 105/194 (54%), Positives = 148/194 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+E TNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFL+A++ +K+I
Sbjct: 1   MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLQAQDAEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG AIYDT+Q IKP + T C+G AASMGS LL+AG KG RFALPNA +
Sbjct: 61  YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I++ + RLN+I  +  G+  E++EK  DRD+ ++A EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKHILRTRERLNKILSELTGQPIEKIEKDTDRDNFLTAQEA 180

Query: 196 CDWGVVDKVLMSRI 209
            ++G++D+V+    
Sbjct: 181 KEYGLIDEVMEPEK 194


>gi|302804055|ref|XP_002983780.1| hypothetical protein SELMODRAFT_48156 [Selaginella moellendorffii]
 gi|300148617|gb|EFJ15276.1| hypothetical protein SELMODRAFT_48156 [Selaginella moellendorffii]
          Length = 206

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 118/194 (60%), Positives = 161/194 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GL+PMV+E T RGER+YDI+SRLLKERIV + G I D  A+L+ AQLL+LE+ENP K I 
Sbjct: 5   GLIPMVIEHTARGERAYDIFSRLLKERIVCIHGPIADDTASLVVAQLLYLESENPLKPIH 64

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P+ST C+GQAASMGSLLL+AGE G R +LPNAR++
Sbjct: 65  LYINSPGGVVTAGLAIYDTMQYIRSPVSTLCVGQAASMGSLLLAAGEPGQRRSLPNARVM 124

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG SGQASDI   A++I+ ++ RLN++Y K+ G + E+++++++RDH MS  EA 
Sbjct: 125 VHQPSGGASGQASDIAIQAREILDMRSRLNKLYAKHTGSSIEKIDQSMERDHFMSPEEAK 184

Query: 197 DWGVVDKVLMSRID 210
           ++G++D+V++ R +
Sbjct: 185 EFGLIDEVIVQRPE 198


>gi|303257392|ref|ZP_07343405.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Burkholderiales bacterium 1_1_47]
 gi|302859749|gb|EFL82827.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Burkholderiales bacterium 1_1_47]
          Length = 209

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 111/209 (53%), Positives = 159/209 (76%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
             D  +    L+PMV+EQ+ RGERS+DIYSRLL++R+VF+ G + D  A L+ AQLLFLE
Sbjct: 1   MPDFSNFNSALIPMVIEQSGRGERSFDIYSRLLRDRVVFLVGPVTDQSANLVVAQLLFLE 60

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           +ENP K+ISLYI+SPGG V AG++IYDTMQFIKP +ST C+G AASMG+ LL+AG KG R
Sbjct: 61  SENPDKDISLYIDSPGGSVYAGLSIYDTMQFIKPDVSTICLGMAASMGAFLLAAGAKGKR 120

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           FALPN+RI++HQPSGG +G A+DIE  A++I++++ RLN I  ++ G++ E++    +RD
Sbjct: 121 FALPNSRIMIHQPSGGTNGTAADIEIQAKEILELRSRLNTILSEHTGQSIEKIAVDTERD 180

Query: 188 HIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           + MS+++A ++G++D V   R +   + K
Sbjct: 181 NFMSSAQAVEYGIIDGVFRKRSEQIIRKK 209


>gi|239636619|ref|ZP_04677621.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus warneri L37603]
 gi|239597974|gb|EEQ80469.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus warneri L37603]
          Length = 196

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 104/191 (54%), Positives = 147/191 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+E TNRGER+YDIYSRLLK+RI+ +  QI+D++A  I +QLLFL+A++ +K+I
Sbjct: 1   MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG AIYDT+Q IKP + T C+G AASMGS LL+AG KG R+ALPNA +
Sbjct: 61  YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRYALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A  I+K + +LN I  +  G++ E++++  DRD+ ++A EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAANHILKTREKLNRILAERTGQSIEKIQQDTDRDNFLTAEEA 180

Query: 196 CDWGVVDKVLM 206
             +G+VD+V+ 
Sbjct: 181 KAYGLVDEVME 191


>gi|73663232|ref|YP_302013.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
 gi|124013830|sp|Q49VZ2|CLPP_STAS1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|72495747|dbj|BAE19068.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 194

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 108/190 (56%), Positives = 149/190 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+E TNRGER+YDIYSRLLK+RI+ +  QI+D++A  I +QLLFL+A++ +K+I
Sbjct: 1   MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDAEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG AIYDT+Q IKP + T C+G AASMGS LL+AG KG RFALPNA +
Sbjct: 61  YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A  I+K + +LN+I  +  G++ E++E+  DRD+ +SA EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAANHILKTRAKLNQILAERTGQSIEKIEQDTDRDNFLSAEEA 180

Query: 196 CDWGVVDKVL 205
            D+G+VD+V+
Sbjct: 181 KDYGLVDQVM 190


>gi|94264491|ref|ZP_01288278.1| Endopeptidase Clp [delta proteobacterium MLMS-1]
 gi|94266601|ref|ZP_01290283.1| Endopeptidase Clp [delta proteobacterium MLMS-1]
 gi|93452772|gb|EAT03310.1| Endopeptidase Clp [delta proteobacterium MLMS-1]
 gi|93455050|gb|EAT05277.1| Endopeptidase Clp [delta proteobacterium MLMS-1]
          Length = 200

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 110/200 (55%), Positives = 158/200 (79%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQT RGERSYDIYSRLLKERI+F+   + D +A ++ AQ+LFLEA++P K+I
Sbjct: 1   MSLIPFVIEQTPRGERSYDIYSRLLKERIIFLGTGVNDEVANVVIAQMLFLEADDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGG VTAG+AIYDTM+++K  I+T C+GQAASMG++LL+AG KG R+ALPNARI
Sbjct: 61  TFYINSPGGSVTAGLAIYDTMRYVKCDIATLCLGQAASMGAVLLAAGTKGKRYALPNARI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           L+HQP GGF GQASDI+ HA++I+++++ LN++   + G+  ++++   +RD+ MS+ EA
Sbjct: 121 LIHQPMGGFQGQASDIDIHAREILRMRQGLNKMLADHTGQKLKKIQTDTERDYFMSSEEA 180

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
             +G++DKVL+ R    E  
Sbjct: 181 KTYGLIDKVLLERTTASEDD 200


>gi|34498013|ref|NP_902228.1| ATP-dependent Clp protease proteolytic subunit [Chromobacterium
           violaceum ATCC 12472]
 gi|60389718|sp|Q7NUY9|CLPP_CHRVO RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|34103868|gb|AAQ60228.1| ATP-dependent Clp protease proteolytic subunit [Chromobacterium
           violaceum ATCC 12472]
          Length = 210

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 122/208 (58%), Positives = 157/208 (75%), Gaps = 3/208 (1%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            K   E   LGLVPMVVEQ+ RGER+YDIYSRLLKERIVF+ G + D  A L+ AQ+LFL
Sbjct: 1   MKSMMEPQGLGLVPMVVEQSGRGERAYDIYSRLLKERIVFLVGPVTDESANLVVAQMLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP K+I  YINSPGG +TAGM+IYDTM FIKP +ST C+GQAASMG+ LL+AG  G 
Sbjct: 61  ESENPDKDIHFYINSPGGSITAGMSIYDTMNFIKPDVSTLCIGQAASMGAFLLAAGTHGK 120

Query: 127 RFALPNARILLHQPSGG---FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
           RFAL N+R+++HQP       SGQ +DIE HA+++VK+K ++NE+  K+ G+T E V+  
Sbjct: 121 RFALENSRVMIHQPLLYGGGLSGQVTDIEIHARELVKVKAKMNELLAKHSGQTLERVQSD 180

Query: 184 LDRDHIMSASEACDWGVVDKVLMSRIDI 211
            +RD+ MSA EA  +G++DKVL SR D+
Sbjct: 181 TERDNFMSAEEARAYGMIDKVLSSRRDV 208


>gi|254448838|ref|ZP_05062294.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium HTCC5015]
 gi|198261528|gb|EDY85817.1| ATP-dependent Clp protease, proteolytic subunit ClpP [gamma
           proteobacterium HTCC5015]
          Length = 236

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 123/205 (60%), Positives = 163/205 (79%), Gaps = 1/205 (0%)

Query: 5   GCAKKDSEDVF-LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQL 63
           G A   +++     LVPMVVEQ+ RGER++DIYSRLLKER++F+ GQ+E+HMA LI AQL
Sbjct: 32  GVAMNHTDNNIQANLVPMVVEQSARGERAFDIYSRLLKERVIFMVGQVEEHMANLIVAQL 91

Query: 64  LFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGE 123
           LFLEA+NP K+ISLYINSPGG VTAGMAIYDTM+FIKP +ST C+GQAASMG+ LLS G 
Sbjct: 92  LFLEADNPDKDISLYINSPGGSVTAGMAIYDTMRFIKPDVSTLCIGQAASMGAFLLSGGA 151

Query: 124 KGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKT 183
           KG RFALPN+ +++HQP GGF GQA+DI+ HA++I+K K +LN +   + G+ +E V + 
Sbjct: 152 KGKRFALPNSSVMIHQPLGGFQGQATDIDIHARNILKTKEKLNRMLADHTGQPFERVVED 211

Query: 184 LDRDHIMSASEACDWGVVDKVLMSR 208
            +RD+ M A EA ++G++D VL++R
Sbjct: 212 TERDNFMGADEAKEYGLIDDVLVTR 236


>gi|323527161|ref|YP_004229314.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1001]
 gi|323384163|gb|ADX56254.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           sp. CCGE1001]
          Length = 227

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 114/206 (55%), Positives = 152/206 (73%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
                     LGLVP V+EQ+ RGER+YDIYSRLL+ERIVF+ G + +  A+LI AQLLF
Sbjct: 1   MQSSYLSATGLGLVPTVIEQSGRGERAYDIYSRLLRERIVFLVGPVNEQSASLIVAQLLF 60

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           LE+ENP K+IS YINSPGG V  G+AIYDTMQFIKP +ST C G AASMG+ LL AG++G
Sbjct: 61  LESENPDKDISFYINSPGGSVYDGLAIYDTMQFIKPEVSTLCTGFAASMGTFLLCAGQRG 120

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
            R+ALPNARI++HQPSGG  G A+DI+  A++++ ++ RLN +  +  G++ EE+ +  D
Sbjct: 121 KRYALPNARIMIHQPSGGSQGTAADIDIQAKEVLYLRERLNAMMAERTGRSVEEIARDTD 180

Query: 186 RDHIMSASEACDWGVVDKVLMSRIDI 211
           RD+ MSA  A  +G+VD+VL +R  +
Sbjct: 181 RDNFMSALAAKTYGLVDEVLETRAAL 206


>gi|298491692|ref|YP_003721869.1| ATP-dependent Clp protease proteolytic subunit ClpP ['Nostoc
           azollae' 0708]
 gi|298233610|gb|ADI64746.1| ATP-dependent Clp protease, proteolytic subunit ClpP ['Nostoc
           azollae' 0708]
          Length = 232

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 103/192 (53%), Positives = 142/192 (73%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
             +VPMVVEQ+  GER++DIYSRLL+ERI+F+   I+D++A  I AQLLFL+AE+  K+I
Sbjct: 27  NNIVPMVVEQSGMGERAFDIYSRLLRERIIFLGTPIDDNVANSIVAQLLFLDAEDSGKDI 86

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG V AGMAIYDT+Q I+P + T C G AASMG+ LL+AG  G R +LP++RI
Sbjct: 87  QLYINSPGGSVYAGMAIYDTIQQIRPDVVTICFGLAASMGAFLLTAGTAGKRMSLPDSRI 146

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA DIE  A++I+ IK  LN++  K+ G+  + +E   +RD  MSA EA
Sbjct: 147 MIHQPLGGAQGQAIDIEIQAREILYIKGNLNQLMAKHTGQPLDRIEADTERDFFMSAEEA 206

Query: 196 CDWGVVDKVLMS 207
            ++G++D+V+  
Sbjct: 207 KNYGLIDQVISR 218


>gi|148263972|ref|YP_001230678.1| ATP-dependent Clp protease proteolytic subunit [Geobacter
           uraniireducens Rf4]
 gi|189082459|sp|A5GFA0|CLPP_GEOUR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|146397472|gb|ABQ26105.1| ATP-dependent Clp protease proteolytic subunit ClpP [Geobacter
           uraniireducens Rf4]
          Length = 199

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 117/192 (60%), Positives = 157/192 (81%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP+VVEQT RGERSYDIYSRLLK+RIVF+ G I+D ++ L+ AQLLFLEAE+P K+I L
Sbjct: 2   LVPIVVEQTGRGERSYDIYSRLLKDRIVFLGGAIDDAISNLVIAQLLFLEAEDPDKDIHL 61

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGGVVTAGMAIYDTM++IK P+ST C+GQAASMG+ LLS GEKG RF+L N+RI++
Sbjct: 62  YINSPGGVVTAGMAIYDTMRYIKAPVSTICVGQAASMGAFLLSGGEKGKRFSLTNSRIMI 121

Query: 138 HQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEACD 197
           HQP GGF GQA+DI  HAQ+I+++K++LNE+  ++ G+  E++E   +RD+ MS  +A +
Sbjct: 122 HQPLGGFQGQATDIHIHAQEILRMKKKLNELMAEHTGQPVEKLEADTERDYFMSGEDAKN 181

Query: 198 WGVVDKVLMSRI 209
           +G++D ++    
Sbjct: 182 YGIIDSIISRNT 193


>gi|152995749|ref|YP_001340584.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Marinomonas
           sp. MWYL1]
 gi|254763795|sp|A6VW20|CLPP_MARMS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|150836673|gb|ABR70649.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Marinomonas
           sp. MWYL1]
          Length = 210

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 123/194 (63%), Positives = 156/194 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
            GLVPMV+EQT RGERS+DIYSRLLKER++F+ GQ+EDHMA L+ AQLLFLE+ENP K+I
Sbjct: 16  NGLVPMVIEQTARGERSFDIYSRLLKERVIFLVGQVEDHMANLVVAQLLFLESENPDKDI 75

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAGM+IYDTMQFIKP +ST C+GQAASMG+LLL+AG  G R+ LPN+R+
Sbjct: 76  HLYINSPGGSVTAGMSIYDTMQFIKPDVSTMCIGQAASMGALLLTAGAAGKRYCLPNSRV 135

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG+ GQASDIE H ++I+ IK +LNEI   + GK  E+V    DRD+ M+   A
Sbjct: 136 MIHQPLGGYQGQASDIEIHTREILSIKHKLNEIISFHTGKPIEQVALDTDRDNFMNPQTA 195

Query: 196 CDWGVVDKVLMSRI 209
            D+G++D++L  R 
Sbjct: 196 KDYGLIDEILQKRT 209


>gi|125582984|gb|EAZ23915.1| hypothetical protein OsJ_07636 [Oryza sativa Japonica Group]
          Length = 318

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 118/193 (61%), Positives = 158/193 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K + 
Sbjct: 72  GLVPMVIETTSRGERAYDIFSRLLKERIVLIHGPIADETASLVVAQLLFLESENPLKPVH 131

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG +G R ALPNAR++
Sbjct: 132 LYINSPGGVVTAGLAIYDTMQYIRCPVTTLCIGQAASMGSLLLAAGARGERRALPNARVM 191

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DI   A++I+K++ RLN+IY K+ G+  +++E+ ++RD  M   EA 
Sbjct: 192 IHQPSGGAQGQATDIAIQAKEILKLRDRLNKIYQKHTGQEIDKIEQCMERDLFMDPEEAR 251

Query: 197 DWGVVDKVLMSRI 209
           DWG++D+V+ +R 
Sbjct: 252 DWGLIDEVIENRP 264


>gi|125540417|gb|EAY86812.1| hypothetical protein OsI_08189 [Oryza sativa Indica Group]
          Length = 318

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 118/193 (61%), Positives = 158/193 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K + 
Sbjct: 72  GLVPMVIETTSRGERAYDIFSRLLKERIVLIHGPIADETASLVVAQLLFLESENPLKPVH 131

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG +G R ALPNAR++
Sbjct: 132 LYINSPGGVVTAGLAIYDTMQYIRCPVTTLCIGQAASMGSLLLAAGARGERRALPNARVM 191

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DI   A++I+K++ RLN+IY K+ G+  +++E+ ++RD  M   EA 
Sbjct: 192 IHQPSGGAQGQATDIAIQAKEILKLRDRLNKIYQKHTGQEIDKIEQCMERDLFMDPEEAR 251

Query: 197 DWGVVDKVLMSRI 209
           DWG++D+V+ +R 
Sbjct: 252 DWGLIDEVIENRP 264


>gi|115447465|ref|NP_001047512.1| Os02g0634500 [Oryza sativa Japonica Group]
 gi|49388184|dbj|BAD25310.1| unknown protein [Oryza sativa Japonica Group]
 gi|113537043|dbj|BAF09426.1| Os02g0634500 [Oryza sativa Japonica Group]
 gi|215692767|dbj|BAG88235.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 298

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 118/193 (61%), Positives = 158/193 (81%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
           GLVPMV+E T+RGER+YDI+SRLLKERIV + G I D  A+L+ AQLLFLE+ENP K + 
Sbjct: 72  GLVPMVIETTSRGERAYDIFSRLLKERIVLIHGPIADETASLVVAQLLFLESENPLKPVH 131

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGGVVTAG+AIYDTMQ+I+ P++T C+GQAASMGSLLL+AG +G R ALPNAR++
Sbjct: 132 LYINSPGGVVTAGLAIYDTMQYIRCPVTTLCIGQAASMGSLLLAAGARGERRALPNARVM 191

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQPSGG  GQA+DI   A++I+K++ RLN+IY K+ G+  +++E+ ++RD  M   EA 
Sbjct: 192 IHQPSGGAQGQATDIAIQAKEILKLRDRLNKIYQKHTGQEIDKIEQCMERDLFMDPEEAR 251

Query: 197 DWGVVDKVLMSRI 209
           DWG++D+V+ +R 
Sbjct: 252 DWGLIDEVIENRP 264


>gi|258646880|ref|ZP_05734349.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dialister
           invisus DSM 15470]
 gi|260404319|gb|EEW97866.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Dialister
           invisus DSM 15470]
          Length = 207

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 113/198 (57%), Positives = 153/198 (77%), Gaps = 1/198 (0%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           +  VP+VVEQT+ GERSYDIYSRLLK+RIVF+ G I+DH A +I AQ LFLEAE+P K+I
Sbjct: 1   MPYVPIVVEQTSHGERSYDIYSRLLKDRIVFLDGPIDDHTANVIIAQFLFLEAEDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGGVVTAGMAIYDTMQ+I+P +ST C+G  ASM ++LL+AGEKG R+ALP+A +
Sbjct: 61  HFYINSPGGVVTAGMAIYDTMQYIRPDVSTICIGSCASMAAVLLTAGEKGKRYALPHASV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA+DI  HA++I++++  LN I   + G+T + V K  +RD+ M+A  A
Sbjct: 121 MIHQPLGGAQGQATDIAIHAKEIIRLRSELNGIIAAHSGQTLKTVMKDTERDNFMTADAA 180

Query: 196 CDWGVVDKVLMSRIDIEE 213
             +G++DK+L  R ++ E
Sbjct: 181 LKYGLIDKILT-RNELAE 197


>gi|328676003|gb|AEB28678.1| ATP-dependent Clp protease proteolytic subunit [Francisella cf.
           novicida 3523]
          Length = 201

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 115/200 (57%), Positives = 155/200 (77%)

Query: 14  VFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQK 73
           +   LVP V+E+T  GER++DIYSRLLKERIVF+ G++ DH A L+ AQLLFLE+E+P K
Sbjct: 2   ITNNLVPTVIEKTAGGERAFDIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESEDPDK 61

Query: 74  EISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNA 133
           +I  YINSPGG+VTAGM +YDTMQFIKP +ST C+G AASMGSLLL+ G KG R++LP++
Sbjct: 62  DIYFYINSPGGMVTAGMGVYDTMQFIKPDVSTICIGLAASMGSLLLAGGAKGKRYSLPSS 121

Query: 134 RILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSAS 193
           +I++HQP GGF GQASDIE HA++I++IK RLN++   + G+  + + K  DRD+ M A 
Sbjct: 122 QIMIHQPLGGFRGQASDIEIHAKNILRIKDRLNKVLAHHTGQDLDTIIKDTDRDNFMMAD 181

Query: 194 EACDWGVVDKVLMSRIDIEE 213
           EA  +G++D V+ SR  I +
Sbjct: 182 EAKAYGLIDHVIESREAIIK 201


>gi|304413826|ref|ZP_07395243.1| ATP-dependent serine protease [Candidatus Regiella insecticola
           LSR1]
 gi|304283546|gb|EFL91941.1| ATP-dependent serine protease [Candidatus Regiella insecticola
           LSR1]
          Length = 261

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 128/216 (59%), Positives = 169/216 (78%), Gaps = 7/216 (3%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
            +  +   + LVPMVVEQT+RGER+YDIYSRLLKER++F+TGQ+EDHMA LI AQ+LFLE
Sbjct: 42  SRADQVSTMALVPMVVEQTSRGERAYDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLE 101

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP K+ISLYINSPGGV+TAGM+IYDTMQFIKP + T C+GQA SMG+ LL+AG KG R
Sbjct: 102 AENPDKDISLYINSPGGVITAGMSIYDTMQFIKPDVITLCIGQACSMGAFLLTAGTKGKR 161

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           F LPN+R+++HQP GG+ GQ SDIE H+++I  +K R+N +  K+ GK  EE+EK  +RD
Sbjct: 162 FCLPNSRVMIHQPLGGYQGQVSDIEIHSKEIRNVKNRMNTLMAKHTGKALEEIEKDTERD 221

Query: 188 HIMSASEACDWGVVDKVLMSR-------IDIEEKSK 216
           + +SA E+ ++G+VD+VL +R          ++KSK
Sbjct: 222 YFLSAEESVNYGLVDQVLCTRETVSNLDEKADKKSK 257


>gi|297569273|ref|YP_003690617.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296925188|gb|ADH85998.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 200

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 112/200 (56%), Positives = 160/200 (80%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQT RGERSYDIYSRLLKERI+F+   + D +A +I AQ+LFLEA++P K+I
Sbjct: 1   MSLIPFVIEQTPRGERSYDIYSRLLKERIIFLGTGVNDDVANVIIAQMLFLEADDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           + YINSPGGVVTAG+AIYDTM++IK  ++T C+GQAASMG++LL+AG +G R+ALPN+RI
Sbjct: 61  TFYINSPGGVVTAGLAIYDTMRYIKCDVATLCLGQAASMGAVLLAAGTEGKRYALPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           L+HQP GG+ GQASDI+ HA++I+++++ LN I   + G++ + ++K  +RD+ MSA E+
Sbjct: 121 LIHQPMGGYQGQASDIDIHAKEILRMRQDLNRILASHTGQSIKRIQKDTERDYFMSAEES 180

Query: 196 CDWGVVDKVLMSRIDIEEKS 215
             +G++DKVL  R    E+S
Sbjct: 181 KTYGIIDKVLYERTKTSEES 200


>gi|307692047|ref|ZP_07634284.1| ATP-dependent Clp protease proteolytic subunit [Ruminococcaceae
           bacterium D16]
          Length = 193

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 107/193 (55%), Positives = 148/193 (76%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVP VVEQTNRGERSYDI+SRLL +RI+F++ ++ D  A+L+ AQLL+LE+++P K+I
Sbjct: 1   MSLVPYVVEQTNRGERSYDIFSRLLNDRIIFLSEEVNDTTASLVVAQLLYLESQDPDKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
             YINSPGG VTAGMAIYDTMQ++K  +ST C+G AASMG+ LLSAG KG R ALPN+ I
Sbjct: 61  QFYINSPGGSVTAGMAIYDTMQYVKCDVSTICIGLAASMGAFLLSAGAKGKRLALPNSEI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPS G  GQ +D+  H + +  +K+R+N I  +N GK+ E+V    +RD+ MSA EA
Sbjct: 121 MIHQPSAGTQGQITDMALHLKRLEVVKKRMNRILAENTGKSIEQVTADCERDNFMSAQEA 180

Query: 196 CDWGVVDKVLMSR 208
            ++G++D+V+  R
Sbjct: 181 LEYGLIDRVIEKR 193


>gi|313668450|ref|YP_004048734.1| endopeptidase [Neisseria lactamica ST-640]
 gi|309379242|emb|CBX22199.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005912|emb|CBN87368.1| endopeptidase [Neisseria lactamica 020-06]
          Length = 206

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 118/197 (59%), Positives = 154/197 (78%), Gaps = 2/197 (1%)

Query: 18  LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEISL 77
           LVP V+EQ+ RGER++DIYSRLLKERIVF+ G + D  A L+ AQLLFLE+ENP K+I  
Sbjct: 9   LVPTVIEQSGRGERAFDIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFF 68

Query: 78  YINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARILL 137
           YINSPGG VTAGM+IYDTM FIKP +ST C+GQAASMG+ LLSAG KG RFALPN+RI++
Sbjct: 69  YINSPGGSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGGKGKRFALPNSRIMI 128

Query: 138 HQPSGG--FSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           HQP       GQASDIE HA++++KIK +LN +  K+C +   ++E+  DRD+ MSA EA
Sbjct: 129 HQPLISGGLGGQASDIEIHARELLKIKEKLNRLMAKHCNRDLADLERDTDRDNFMSAEEA 188

Query: 196 CDWGVVDKVLMSRIDIE 212
            ++G++D+VL +R  ++
Sbjct: 189 KEYGLIDQVLENRASLQ 205


>gi|194015348|ref|ZP_03053964.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           pumilus ATCC 7061]
 gi|194012752|gb|EDW22318.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Bacillus
           pumilus ATCC 7061]
          Length = 198

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 109/198 (55%), Positives = 155/198 (78%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I +QLLFLEAE+P+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           S+YINSPGG +TAGMAIYDTMQFIKP +ST C+G AASMG+ LL+AGEKG R+ALPN+ +
Sbjct: 61  SIYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN++  +  G+  E +E+  DRD+  +A EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILSLRDKLNQVLAERTGQPIEVIERDTDRDNFKTAEEA 180

Query: 196 CDWGVVDKVLMSRIDIEE 213
             +G++DKVL    + ++
Sbjct: 181 LQYGLIDKVLTRNAEEQK 198


>gi|25019682|gb|AAN71768.1| ClpP2 [Synechococcus elongatus PCC 7942]
          Length = 302

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 108/191 (56%), Positives = 142/191 (74%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            +VP VVEQ+ RGER++DIYSRLL+ERIVF+   ++D +A  I AQLLFLEAE+P+K+I 
Sbjct: 98  AIVPTVVEQSGRGERAFDIYSRLLRERIVFLGTGVDDAVADSIVAQLLFLEAEDPEKDIQ 157

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG VTAGMAIYDTMQ + P ++T C G AASMG+ LLS G +G R ALP+ARI+
Sbjct: 158 LYINSPGGSVTAGMAIYDTMQQVAPDVATICFGLAASMGAFLLSGGAQGKRMALPSARIM 217

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQA DIE  A++I+  K  LN++  ++ G+  E++E   DRD  MS  EA 
Sbjct: 218 IHQPLGGAQGQAVDIEIQAREILYHKSTLNDLLAQHTGQPLEKIEVDTDRDFFMSPEEAK 277

Query: 197 DWGVVDKVLMS 207
            +G++D+VL  
Sbjct: 278 AYGLIDQVLTR 288


>gi|91205226|ref|YP_537581.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia bellii
           RML369-C]
 gi|157827437|ref|YP_001496501.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia bellii
           OSU 85-389]
 gi|91068770|gb|ABE04492.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia bellii
           RML369-C]
 gi|157802741|gb|ABV79464.1| ATP-dependent Clp protease proteolytic subunit [Rickettsia bellii
           OSU 85-389]
          Length = 264

 Score =  236 bits (603), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 125/202 (61%), Positives = 165/202 (81%)

Query: 8   KKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLE 67
           +   E   +  VP+V+EQT+RGER+YDIYSRLLKERI+FV G IEDHMA LI AQLLFLE
Sbjct: 52  ENFKEKYPMSYVPIVIEQTSRGERAYDIYSRLLKERIIFVCGPIEDHMANLITAQLLFLE 111

Query: 68  AENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMR 127
           AENP+K+I +YINSPGGVVTAG+AIYDTMQ+IKP ++T C+GQA SMGS LL  GEKGMR
Sbjct: 112 AENPEKDIYMYINSPGGVVTAGLAIYDTMQYIKPKVATLCIGQACSMGSFLLCGGEKGMR 171

Query: 128 FALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRD 187
           ++LP++R+++HQPSGG+ GQA+DIE HAQ+ +KIK+ LN +Y K+ G+  + VEK+++RD
Sbjct: 172 YSLPHSRVMIHQPSGGYRGQATDIEIHAQETLKIKKILNSLYSKHTGQDVKHVEKSMERD 231

Query: 188 HIMSASEACDWGVVDKVLMSRI 209
           + MS  EA  +G++DK++  R 
Sbjct: 232 NFMSPEEAKKFGIIDKIITHRD 253


>gi|296446284|ref|ZP_06888230.1| Endopeptidase Clp [Methylosinus trichosporium OB3b]
 gi|296256185|gb|EFH03266.1| Endopeptidase Clp [Methylosinus trichosporium OB3b]
          Length = 211

 Score =  236 bits (602), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 142/210 (67%), Positives = 181/210 (86%), Gaps = 1/210 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  +V+   L+P V+E T+RGER +DIYSRLL+ERI+F+TGQ+EDHMA++I AQLLFL
Sbjct: 1   MRDPLEVYNQYLIPQVIENTSRGERGFDIYSRLLRERIIFLTGQVEDHMASVIIAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           EAENP++EI LYINSPGGVVT+G+AIYDTMQ+I+P ++T C+GQAASMGSLLL AGE G 
Sbjct: 61  EAENPKREIFLYINSPGGVVTSGLAIYDTMQYIRPKVATLCIGQAASMGSLLLCAGEAGQ 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPNARI++HQPSGGF GQASDI RHA+DI+KIK+RLNEIYV++ G+ YE +EKTLDR
Sbjct: 121 RFALPNARIMVHQPSGGFQGQASDILRHAEDIMKIKKRLNEIYVRHTGRDYETIEKTLDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRIDIEEKSK 216
           DH MSA EA D+G+VD V ++R + + ++K
Sbjct: 181 DHFMSAEEAKDFGIVDHVQVNRPEEQSETK 210


>gi|93007058|ref|YP_581495.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Psychrobacter
           cryohalolentis K5]
 gi|92394736|gb|ABE76011.1| ATP-dependent Clp protease proteolytic subunit ClpP [Psychrobacter
           cryohalolentis K5]
          Length = 231

 Score =  236 bits (602), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 121/200 (60%), Positives = 160/200 (80%)

Query: 10  DSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAE 69
           +       LVPMVVEQ+ RGERS+DI+SRLL+ER++F+TGQ+EDHMA LI AQLLFLEAE
Sbjct: 29  NQSATQAALVPMVVEQSARGERSFDIFSRLLRERVIFLTGQVEDHMANLIVAQLLFLEAE 88

Query: 70  NPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFA 129
           NP K+I LYINSPGG V+AG+AI+DTM FIKP +ST CMG A SMGS LL+AGEKG R+A
Sbjct: 89  NPDKDIHLYINSPGGSVSAGLAIFDTMNFIKPEVSTICMGGAYSMGSFLLAAGEKGKRYA 148

Query: 130 LPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHI 189
           L NAR+++HQPSGG  GQA+DIE +A++I+K + RLNEI  +  G+  +++EK ++RD+ 
Sbjct: 149 LANARVMIHQPSGGAQGQATDIEINAREILKTRARLNEILAERTGQPVDKIEKDVERDYW 208

Query: 190 MSASEACDWGVVDKVLMSRI 209
           + A EA ++G++D+VL  R 
Sbjct: 209 LDAKEAKEYGLIDEVLERRP 228


>gi|205375127|ref|ZP_03227918.1| ATP-dependent Clp protease proteolytic subunit [Bacillus
           coahuilensis m4-4]
          Length = 198

 Score =  236 bits (602), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 110/199 (55%), Positives = 154/199 (77%), Gaps = 1/199 (0%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+EQTNRGER+YDIYSRLLK+RI+ +   I+D++A  I AQLLFLE ENP+K+I
Sbjct: 1   MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVAQLLFLETENPEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           SLYINSPGG +TAGMAIYDTMQ+IKP + T C+G AASMG+ LL+AGE G RFALPN+ +
Sbjct: 61  SLYINSPGGSITAGMAIYDTMQYIKPKVQTICIGMAASMGAFLLAAGEPGKRFALPNSEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A+ I+ ++ +LN I  +  G+  + + +  DRD+ M+A  A
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILFLREKLNTILSERTGQPLDVIAQDTDRDNFMTAERA 180

Query: 196 CDWGVVDKVLMSRIDIEEK 214
            ++G++DK++  R DI++K
Sbjct: 181 LEYGLIDKIIT-RHDIDKK 198


>gi|189219051|ref|YP_001939692.1| ATP-dependent Clp protease proteolytic subunit [Methylacidiphilum
           infernorum V4]
 gi|189185909|gb|ACD83094.1| ATP-dependent Clp protease proteolytic subunit [Methylacidiphilum
           infernorum V4]
          Length = 219

 Score =  236 bits (602), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 115/202 (56%), Positives = 155/202 (76%)

Query: 7   AKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            K  +  +   ++PMVVEQT RGER YDI+SRLLK+RIVF+   I+D+MA L+ AQLLFL
Sbjct: 1   MKIMNSPIISQVIPMVVEQTGRGERGYDIFSRLLKDRIVFIGTPIDDNMANLVIAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           + E+P+K+I+LYI+SPGG VTAGMAIYDTMQF+   ++T+C+GQAASM ++LL+AG KG 
Sbjct: 61  QMEDPKKDINLYIHSPGGYVTAGMAIYDTMQFLSCDVNTYCIGQAASMAAVLLAAGTKGK 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           RFALPNARI++HQP GG  GQASDI   AQ+I++ KR LNEI   +  +  E +EK  DR
Sbjct: 121 RFALPNARIMIHQPLGGAQGQASDISIQAQEILRTKRLLNEILSYHTKQPLERIEKDTDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSR 208
           D  MSA +A  +G++D+V+ ++
Sbjct: 181 DFFMSAEDAKAYGIIDEVVKTK 202


>gi|78188367|ref|YP_378705.1| peptidase S14, ClpP [Chlorobium chlorochromatii CaD3]
 gi|90101406|sp|Q3ATL3|CLPP_CHLCH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|78170566|gb|ABB27662.1| ATP-dependent Clp protease proteolytic subunit ClpP [Chlorobium
           chlorochromatii CaD3]
          Length = 225

 Score =  236 bits (602), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 103/204 (50%), Positives = 153/204 (75%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           + +   LVPMV+E + RGER++DI+SRLL+ERI+F+   I++H+A LI AQL+FLE+E+P
Sbjct: 22  QGISNSLVPMVIETSGRGERAFDIFSRLLRERIIFLGTGIDEHVAGLIMAQLIFLESEDP 81

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
           +++I +YINSPGG V+AG+ IYDTMQ+I+P IST C+G AASMG+ LL++G KG R +LP
Sbjct: 82  ERDIYIYINSPGGSVSAGLGIYDTMQYIRPEISTVCVGMAASMGAFLLASGNKGKRASLP 141

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           ++RI++HQPSGG  GQ +DI   A++I KI+R L E+  K+ G+  E+V +  +RD  M+
Sbjct: 142 HSRIMIHQPSGGAQGQETDIVIQAREIEKIRRLLEELLAKHTGQPVEKVREDSERDRWMN 201

Query: 192 ASEACDWGVVDKVLMSRIDIEEKS 215
             EA ++G++D +   R   E+K 
Sbjct: 202 PQEALEYGLIDAIFEKRPTPEKKD 225


>gi|161524522|ref|YP_001579534.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           multivorans ATCC 17616]
 gi|189350722|ref|YP_001946350.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia
           multivorans ATCC 17616]
 gi|221198217|ref|ZP_03571263.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD2M]
 gi|221209201|ref|ZP_03582193.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD2]
 gi|254252156|ref|ZP_04945474.1| Peptidase S14 [Burkholderia dolosa AUO158]
 gi|124894765|gb|EAY68645.1| Peptidase S14 [Burkholderia dolosa AUO158]
 gi|160341951|gb|ABX15037.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans ATCC 17616]
 gi|189334744|dbj|BAG43814.1| ATP-dependent Clp protease [Burkholderia multivorans ATCC 17616]
 gi|221170939|gb|EEE03394.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD2]
 gi|221182149|gb|EEE14550.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Burkholderia
           multivorans CGD2M]
 gi|325518991|gb|EGC98514.1| ATP-dependent Clp protease proteolytic subunit [Burkholderia sp.
           TJI49]
          Length = 217

 Score =  236 bits (602), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 120/198 (60%), Positives = 156/198 (78%)

Query: 12  EDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENP 71
           E   LGLVP+VVE + RGERSYDIYSRLLKER+VF+ G++ D  A L+ AQLLFLE+ENP
Sbjct: 20  EAQALGLVPIVVETSGRGERSYDIYSRLLKERLVFMVGEVNDQTANLVVAQLLFLESENP 79

Query: 72  QKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALP 131
            K+ISLYINSPGG V+AGMAIYDTMQFIKP +ST CMG AASMG+ LL++G KG RFALP
Sbjct: 80  DKDISLYINSPGGSVSAGMAIYDTMQFIKPDVSTLCMGLAASMGAFLLASGAKGKRFALP 139

Query: 132 NARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMS 191
           N+R+++HQP GG  GQASDIE  A++I+ +K RLN +  ++ G+  E + +  DRD+ MS
Sbjct: 140 NSRVMIHQPLGGARGQASDIEIQAREILYLKERLNHLLAQHTGQDVERIARDTDRDNFMS 199

Query: 192 ASEACDWGVVDKVLMSRI 209
           + +A  +G++D+VL+ R 
Sbjct: 200 SEDAKAYGLIDQVLLKRP 217


>gi|66515781|ref|XP_392540.2| PREDICTED: putative ATP-dependent Clp protease proteolytic subunit,
           mitochondrial-like [Apis mellifera]
          Length = 237

 Score =  236 bits (602), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 111/210 (52%), Positives = 161/210 (76%)

Query: 6   CAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLF 65
              +     +L  +P+VVEQ+ RGER+YDIYSRLLKERI+ + G I D++++++ AQLLF
Sbjct: 13  VPGQKVSKRYLNFIPVVVEQSGRGERAYDIYSRLLKERIICLMGPITDNVSSVVIAQLLF 72

Query: 66  LEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKG 125
           L++EN +  I +YINSPGG VTAG+ IYDTMQ++ PP++T+C+GQA SM SLLL+AG KG
Sbjct: 73  LQSENSKNPIHMYINSPGGSVTAGLGIYDTMQYVLPPVATWCVGQACSMASLLLAAGTKG 132

Query: 126 MRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLD 185
           MR +LPNARI+ HQPSGG SGQA+DI+  A +I+K+K+++N +YVK+ G   E++E+ ++
Sbjct: 133 MRHSLPNARIMTHQPSGGVSGQATDIQIQALEILKLKKQINNLYVKHTGLDLEKIERCME 192

Query: 186 RDHIMSASEACDWGVVDKVLMSRIDIEEKS 215
           RD+ MS  EA ++G++DKVL   +  +E  
Sbjct: 193 RDNFMSPKEAKEFGIIDKVLSHPMQEDEPD 222


>gi|114321437|ref|YP_743120.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311052|sp|Q0A6A7|CLPP_ALHEH RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|114227831|gb|ABI57630.1| ATP-dependent Clp protease proteolytic subunit ClpP
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 214

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 125/214 (58%), Positives = 163/214 (76%)

Query: 1   MSFEGCAKKDSEDVFLGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLIC 60
           MS E       E    GLVPMVVEQ+ RGER+YDIYSRLLKER++F+ G +EDHMA LI 
Sbjct: 1   MSDERREGLAPEIEATGLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDHMANLIV 60

Query: 61  AQLLFLEAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLS 120
           AQLLFLE+ENP K+I +YINSPGG VTAG+AIYDTMQFIKP +ST C+GQAASMG+LLL+
Sbjct: 61  AQLLFLESENPDKDIHIYINSPGGAVTAGLAIYDTMQFIKPDVSTVCIGQAASMGALLLT 120

Query: 121 AGEKGMRFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEV 180
            G KG R+ALPN+R+++HQP GGF GQA+D++ HA++I+ ++ RLN I   + G+  E +
Sbjct: 121 GGTKGKRYALPNSRMMIHQPLGGFQGQATDVDIHAREILDMRDRLNRIMAHHTGQDMETI 180

Query: 181 EKTLDRDHIMSASEACDWGVVDKVLMSRIDIEEK 214
            +  DRD+ MS   AC++G+VD VL  R  +++ 
Sbjct: 181 ARDTDRDNFMSPDTACEYGLVDAVLADRKALDQA 214


>gi|15923758|ref|NP_371292.1| ATP-dependent Clp protease proteolytic subunit-like protein
           [Staphylococcus aureus subsp. aureus Mu50]
 gi|15926445|ref|NP_373978.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus N315]
 gi|21282459|ref|NP_645547.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus MW2]
 gi|49483025|ref|YP_040249.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus MRSA252]
 gi|49485640|ref|YP_042861.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus MSSA476]
 gi|57650109|ref|YP_185707.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus COL]
 gi|82750474|ref|YP_416215.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus RF122]
 gi|87161484|ref|YP_493453.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|88194551|ref|YP_499347.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus NCTC 8325]
 gi|148267228|ref|YP_001246171.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus JH9]
 gi|150393277|ref|YP_001315952.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus JH1]
 gi|151220948|ref|YP_001331770.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus str. Newman]
 gi|156979096|ref|YP_001441355.1| ATP-dependent Clp protease proteolytic subunit homologue
           [Staphylococcus aureus subsp. aureus Mu3]
 gi|161509038|ref|YP_001574697.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|221141842|ref|ZP_03566335.1| endopeptidase ClpP [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253317258|ref|ZP_04840471.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus str. CF-Marseille]
 gi|253731397|ref|ZP_04865562.1| ATP-dependent Clp protease proteolytic subunit family protein
           [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253732783|ref|ZP_04866948.1| ATP-dependent Clp protease proteolytic subunit family protein
           [Staphylococcus aureus subsp. aureus TCH130]
 gi|255005559|ref|ZP_05144160.2| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus Mu50-omega]
 gi|257424888|ref|ZP_05601315.1| clp protease [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257427556|ref|ZP_05603955.1| clp protease [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257430187|ref|ZP_05606571.1| endopeptidase ClpP [Staphylococcus aureus subsp. aureus 68-397]
 gi|257432888|ref|ZP_05609248.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus E1410]
 gi|257435792|ref|ZP_05611840.1| clp protease [Staphylococcus aureus subsp. aureus M876]
 gi|257794910|ref|ZP_05643889.1| clp protease [Staphylococcus aureus A9781]
 gi|258418226|ref|ZP_05682491.1| ATP-dependent Clp protease proteolytic subunit ClpP [Staphylococcus
           aureus A9763]
 gi|258421524|ref|ZP_05684449.1| clp protease [Staphylococcus aureus A9719]
 gi|258423417|ref|ZP_05686308.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus A9635]
 gi|258439133|ref|ZP_05690177.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus A9299]
 gi|258440939|ref|ZP_05690774.1| ATP-dependent Clp protease proteolytic subunit ClpP [Staphylococcus
           aureus A8115]
 gi|258445769|ref|ZP_05693946.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus A6300]
 gi|258449581|ref|ZP_05697683.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus A6224]
 gi|258452184|ref|ZP_05700200.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus A5948]
 gi|258453981|ref|ZP_05701953.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus A5937]
 gi|262049552|ref|ZP_06022422.1| hypothetical protein SAD30_0974 [Staphylococcus aureus D30]
 gi|262052698|ref|ZP_06024889.1| hypothetical protein SA930_1868 [Staphylococcus aureus 930918-3]
 gi|269202390|ref|YP_003281659.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus ED98]
 gi|282895064|ref|ZP_06303285.1| Clp protease [Staphylococcus aureus A8117]
 gi|282903398|ref|ZP_06311289.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus C160]
 gi|282905178|ref|ZP_06313035.1| endopeptidase ClpP [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282908157|ref|ZP_06315988.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282910415|ref|ZP_06318219.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282913610|ref|ZP_06321399.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus M899]
 gi|282916110|ref|ZP_06323873.1| Clp protease [Staphylococcus aureus subsp. aureus D139]
 gi|282918561|ref|ZP_06326298.1| Clp protease [Staphylococcus aureus subsp. aureus C427]
 gi|282922066|ref|ZP_06329763.1| Clp protease [Staphylococcus aureus A9765]
 gi|282923527|ref|ZP_06331207.1| Clp protease [Staphylococcus aureus subsp. aureus C101]
 gi|282926635|ref|ZP_06334265.1| Clp protease [Staphylococcus aureus A10102]
 gi|283769931|ref|ZP_06342823.1| ATP-dependent Clp protease subunit [Staphylococcus aureus subsp.
           aureus H19]
 gi|283957600|ref|ZP_06375053.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|284023791|ref|ZP_06378189.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus 132]
 gi|293500653|ref|ZP_06666504.1| Clp protease [Staphylococcus aureus subsp. aureus 58-424]
 gi|293509601|ref|ZP_06668312.1| Clp protease [Staphylococcus aureus subsp. aureus M809]
 gi|293524187|ref|ZP_06670874.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus M1015]
 gi|294850496|ref|ZP_06791225.1| Clp protease [Staphylococcus aureus A9754]
 gi|295406492|ref|ZP_06816298.1| Clp protease [Staphylococcus aureus A8819]
 gi|295427347|ref|ZP_06819982.1| Clp protease [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296276994|ref|ZP_06859501.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus MR1]
 gi|297208504|ref|ZP_06924933.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus ATCC 51811]
 gi|297245218|ref|ZP_06929092.1| Clp protease [Staphylococcus aureus A8796]
 gi|297590298|ref|ZP_06948937.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus MN8]
 gi|300912596|ref|ZP_07130039.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus TCH70]
 gi|304381609|ref|ZP_07364259.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus ATCC BAA-39]
 gi|54036854|sp|P63786|CLPP_STAAW RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|54036862|sp|P99089|CLPP_STAAN RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|54040892|sp|P63785|CLPP_STAAM RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56748671|sp|Q6GB62|CLPP_STAAS RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|56748685|sp|Q6GIM3|CLPP_STAAR RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|67460165|sp|Q5HHQ0|CLPP_STAAC RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|90183185|sp|Q2YSF8|CLPP_STAAB RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|116243169|sp|Q2G036|CLPP_STAA8 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|124013828|sp|Q2FIM5|CLPP_STAA3 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|166214713|sp|A7WZR9|CLPP_STAA1 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|172048797|sp|A6QF76|CLPP_STAAE RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082468|sp|A6TZP7|CLPP_STAA2 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082469|sp|A5IQX2|CLPP_STAA9 RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|189082470|sp|A8Z045|CLPP_STAAT RecName: Full=ATP-dependent Clp protease proteolytic subunit;
           AltName: Full=Endopeptidase Clp
 gi|13700659|dbj|BAB41956.1| clpP [Staphylococcus aureus subsp. aureus N315]
 gi|14246537|dbj|BAB56930.1| ATP-dependent Clp protease proteolytic subunit homologue
           [Staphylococcus aureus subsp. aureus Mu50]
 gi|21203896|dbj|BAB94595.1| clpP [Staphylococcus aureus subsp. aureus MW2]
 gi|49241154|emb|CAG39832.1| putative ATP-dependent Clp protease proteolytic subunit
           [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49244083|emb|CAG42509.1| putative ATP-dependent Clp protease proteolytic subunit
           [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57284295|gb|AAW36389.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus COL]
 gi|82656005|emb|CAI80410.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus RF122]
 gi|87127458|gb|ABD21972.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|87202109|gb|ABD29919.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|147740297|gb|ABQ48595.1| ATP-dependent Clp protease proteolytic subunit ClpP [Staphylococcus
           aureus subsp. aureus JH9]
 gi|149945729|gb|ABR51665.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus JH1]
 gi|150373748|dbj|BAF67008.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus str. Newman]
 gi|156721231|dbj|BAF77648.1| ATP-dependent Clp protease proteolytic subunit homologue
           [Staphylococcus aureus subsp. aureus Mu3]
 gi|160367847|gb|ABX28818.1| S14 family endopeptidase ClpP [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253724847|gb|EES93576.1| ATP-dependent Clp protease proteolytic subunit family protein
           [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253729257|gb|EES97986.1| ATP-dependent Clp protease proteolytic subunit family protein
           [Staphylococcus aureus subsp. aureus TCH130]
 gi|257272458|gb|EEV04581.1| clp protease [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257275749|gb|EEV07222.1| clp protease [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257279384|gb|EEV09985.1| endopeptidase ClpP [Staphylococcus aureus subsp. aureus 68-397]
 gi|257282303|gb|EEV12438.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus E1410]
 gi|257284983|gb|EEV15102.1| clp protease [Staphylococcus aureus subsp. aureus M876]
 gi|257788882|gb|EEV27222.1| clp protease [Staphylococcus aureus A9781]
 gi|257839019|gb|EEV63498.1| ATP-dependent Clp protease proteolytic subunit ClpP [Staphylococcus
           aureus A9763]
 gi|257842450|gb|EEV66874.1| clp protease [Staphylococcus aureus A9719]
 gi|257846478|gb|EEV70501.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus A9635]
 gi|257847705|gb|EEV71702.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus A9299]
 gi|257852453|gb|EEV76374.1| ATP-dependent Clp protease proteolytic subunit ClpP [Staphylococcus
           aureus A8115]
 gi|257855345|gb|EEV78283.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus A6300]
 gi|257857089|gb|EEV79988.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus A6224]
 gi|257860399|gb|EEV83231.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus A5948]
 gi|257863846|gb|EEV86602.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus A5937]
 gi|259159395|gb|EEW44448.1| hypothetical protein SA930_1868 [Staphylococcus aureus 930918-3]
 gi|259162388|gb|EEW46960.1| hypothetical protein SAD30_0974 [Staphylococcus aureus D30]
 gi|262074680|gb|ACY10653.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus ED98]
 gi|269940345|emb|CBI48722.1| putative ATP-dependent Clp protease proteolyticsubunit
           [Staphylococcus aureus subsp. aureus TW20]
 gi|282314395|gb|EFB44785.1| Clp protease [Staphylococcus aureus subsp. aureus C101]
 gi|282317695|gb|EFB48067.1| Clp protease [Staphylococcus aureus subsp. aureus C427]
 gi|282320058|gb|EFB50405.1| Clp protease [Staphylococcus aureus subsp. aureus D139]
 gi|282322642|gb|EFB52964.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus M899]
 gi|282325807|gb|EFB56115.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282327822|gb|EFB58104.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282331585|gb|EFB61097.1| endopeptidase ClpP [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282591528|gb|EFB96600.1| Clp protease [Staphylococcus aureus A10102]
 gi|282593724|gb|EFB98716.1| Clp protease [Staphylococcus aureus A9765]
 gi|282596353|gb|EFC01314.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus C160]
 gi|282762560|gb|EFC02699.1| Clp protease [Staphylococcus aureus A8117]
 gi|283460078|gb|EFC07168.1| ATP-dependent Clp protease subunit [Staphylococcus aureus subsp.
           aureus H19]
 gi|283470062|emb|CAQ49273.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus ST398]
 gi|283791051|gb|EFC29866.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|285816470|gb|ADC36957.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus 04-02981]
 gi|290921150|gb|EFD98211.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus M1015]
 gi|291095658|gb|EFE25919.1| Clp protease [Staphylococcus aureus subsp. aureus 58-424]
 gi|291467698|gb|EFF10213.1| Clp protease [Staphylococcus aureus subsp. aureus M809]
 gi|294822634|gb|EFG39074.1| Clp protease [Staphylococcus aureus A9754]
 gi|294968637|gb|EFG44660.1| Clp protease [Staphylococcus aureus A8819]
 gi|295128735|gb|EFG58366.1| Clp protease [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296886759|gb|EFH25663.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus ATCC 51811]
 gi|297177889|gb|EFH37138.1| Clp protease [Staphylococcus aureus A8796]
 gi|297576597|gb|EFH95312.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus MN8]
 gi|298694101|gb|ADI97323.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus ED133]
 gi|300886842|gb|EFK82044.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus TCH70]
 gi|302332479|gb|ADL22672.1| putative ATP-dependent Clp protease proteolytic subunit
           [Staphylococcus aureus subsp. aureus JKD6159]
 gi|302750665|gb|ADL64842.1| putative ATP-dependent Clp protease proteolytic subunit
           [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|304339972|gb|EFM05916.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus ATCC BAA-39]
 gi|312438803|gb|ADQ77874.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus TCH60]
 gi|312829260|emb|CBX34102.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129024|gb|EFT85021.1| S14 family endopeptidase ClpP [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315194387|gb|EFU24779.1| S14 family endopeptidase ClpP [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315196246|gb|EFU26600.1| S14 family endopeptidase ClpP [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320139896|gb|EFW31757.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320142013|gb|EFW33841.1| ATP-dependent Clp protease, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323438624|gb|EGA96368.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus O11]
 gi|323441949|gb|EGA99586.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus O46]
 gi|329313489|gb|AEB87902.1| ATP-dependent Clp protease proteolytic subunit [Staphylococcus
           aureus subsp. aureus T0131]
 gi|329723806|gb|EGG60334.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus 21189]
 gi|329724642|gb|EGG61149.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus 21172]
 gi|329729644|gb|EGG66045.1| ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
           [Staphylococcus aureus subsp. aureus 21193]
          Length = 195

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 105/190 (55%), Positives = 148/190 (77%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + L+P V+E TNRGER+YDIYSRLLK+RI+ +  QI+D++A  I +QLLFL+A++ +K+I
Sbjct: 1   MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
            LYINSPGG VTAG AIYDT+Q IKP + T C+G AASMGS LL+AG KG RFALPNA +
Sbjct: 61  YLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEV 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQP GG  GQA++IE  A  I+K + +LN I  +  G++ E+++K  DRD+ ++A EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEA 180

Query: 196 CDWGVVDKVL 205
            ++G++D+V+
Sbjct: 181 KEYGLIDEVM 190


>gi|116243118|sp|Q1MIM7|CLPP2_RHIL3 RecName: Full=ATP-dependent Clp protease proteolytic subunit 2;
           AltName: Full=Endopeptidase Clp 2
 gi|115256102|emb|CAK07183.1| putative ATP-dependent Clp protease proteolytic subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 201

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 159/199 (79%), Positives = 183/199 (91%)

Query: 16  LGLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEI 75
           + LVPMVVEQTNRGERSYDIYSRLLKERI+F+TG +EDHMATL+CAQLLFLEAENP+KEI
Sbjct: 1   MALVPMVVEQTNRGERSYDIYSRLLKERIIFLTGAVEDHMATLVCAQLLFLEAENPKKEI 60

Query: 76  SLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARI 135
           +LYINSPGGVVTAGMAIYDTMQFIKP +ST C+GQAASMGSLLL+AG K MRFA PN+RI
Sbjct: 61  ALYINSPGGVVTAGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLAAGHKDMRFATPNSRI 120

Query: 136 LLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEA 195
           ++HQPSGGF GQASDIERHA+DI+K+KRRLNE+YVK+ G+TYEEVEKTLDRDH M A EA
Sbjct: 121 MVHQPSGGFQGQASDIERHARDILKMKRRLNEVYVKHTGRTYEEVEKTLDRDHFMDADEA 180

Query: 196 CDWGVVDKVLMSRIDIEEK 214
             WGV+DKVL SR+++E +
Sbjct: 181 QSWGVIDKVLTSRLEMEGE 199


>gi|329850562|ref|ZP_08265407.1| clp protease family protein [Asticcacaulis biprosthecum C19]
 gi|328840877|gb|EGF90448.1| clp protease family protein [Asticcacaulis biprosthecum C19]
          Length = 208

 Score =  236 bits (602), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 126/204 (61%), Positives = 161/204 (78%), Gaps = 1/204 (0%)

Query: 8   KKDSEDVFLG-LVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFL 66
            +D  D     L+P V+EQ++RGER+YDIYSR+LKERI+F+TG  ED MAT ICAQLLFL
Sbjct: 1   MRDPVDNLTSYLIPTVIEQSSRGERAYDIYSRMLKERIIFLTGPFEDGMATSICAQLLFL 60

Query: 67  EAENPQKEISLYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGM 126
           E+ENP+KEIS+YINSPGG VT+ +AIYDTMQ+IK P++T CMG AAS GSL+L AGE G 
Sbjct: 61  ESENPKKEISMYINSPGGQVTSALAIYDTMQYIKSPVTTVCMGMAASAGSLILQAGENGQ 120

Query: 127 RFALPNARILLHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDR 186
           R +LPN++I++HQPSGG  G ASDIE  A+D+ K K+ LNEIYVK+ G+ YE +E+TLDR
Sbjct: 121 RISLPNSKIMVHQPSGGARGMASDIEIQAEDMRKTKKLLNEIYVKHTGQPYEVIERTLDR 180

Query: 187 DHIMSASEACDWGVVDKVLMSRID 210
           D  M+A EA ++G++D V   R D
Sbjct: 181 DRYMTAEEAKEFGLIDHVYEKRAD 204


>gi|238917377|ref|YP_002930894.1| ATP-dependent Clp protease, protease subunit [Eubacterium eligens
           ATCC 27750]
 gi|259585953|sp|C4Z1T