RPSBLAST alignment for GI: 254780272 and conserved domain: TIGR00493

>gnl|CDD|129584 TIGR00493, clpP, ATP-dependent Clp protease, proteolytic subunit ClpP. This model for the proteolytic subunit ClpP has been rebuilt to a higher stringency. In every bacterial genome with the ClpXP machine, a ClpP protein will be found that scores with this model. In general, this ClpP member will be encoded adjacent to the clpX gene, as were all examples used in the seed alignment. A large fraction of genomes have one or more additional ClpP paralogs, sometimes encoded nearby and sometimes elsewhere. The stringency of the trusted cutoff used here excludes the more divergent ClpP paralogs from being called authentic ClpP by this model. Length = 191
 Score =  304 bits (780), Expect = 1e-83
 Identities = 120/189 (63%), Positives = 156/189 (82%)

Query: 17  GLVPMVVEQTNRGERSYDIYSRLLKERIVFVTGQIEDHMATLICAQLLFLEAENPQKEIS 76
            L+PMV+EQT RGERS+DIYSRLLKERI+F++G++ D +A LI AQLLFLEAE+P+K+I 
Sbjct: 1   NLIPMVIEQTGRGERSFDIYSRLLKERIIFLSGEVNDSVANLIVAQLLFLEAEDPEKDIY 60

Query: 77  LYINSPGGVVTAGMAIYDTMQFIKPPISTFCMGQAASMGSLLLSAGEKGMRFALPNARIL 136
           LYINSPGG +TAG+AIYDTMQFIKP +ST C+GQAASMG+ LLSAG KG RF+LPN+RI+
Sbjct: 61  LYINSPGGSITAGLAIYDTMQFIKPDVSTICIGQAASMGAFLLSAGAKGKRFSLPNSRIM 120

Query: 137 LHQPSGGFSGQASDIERHAQDIVKIKRRLNEIYVKNCGKTYEEVEKTLDRDHIMSASEAC 196
           +HQP GG  GQASDIE  A +I+++K  LN+I   + G++ E++EK  +RD  MSA EA 
Sbjct: 121 IHQPLGGAQGQASDIEIQANEILRLKGLLNDILANHTGQSLEQIEKDTERDFFMSAEEAK 180

Query: 197 DWGVVDKVL 205
           ++G++D VL
Sbjct: 181 EYGLIDSVL 189