RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780274|ref|YP_003064687.1| lysophospholipase protein [Candidatus Liberibacter asiaticus str. psy62] (317 letters) >gnl|CDD|165193 PHA02857, PHA02857, monoglyceride lipase; Provisional. Length = 276 Score = 37.2 bits (86), Expect = 0.005 Identities = 20/108 (18%), Positives = 43/108 (39%), Gaps = 4/108 (3%) Query: 27 PRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTI 86 P+A++ E+ Y + E + + V+ + + ++ + + Sbjct: 24 PKALVFISHGAGEHSGRYEELAENISSLGILVFSHDHIGHGRSNGEKM----MIDDFGVY 79 Query: 87 VCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIAL 134 V DV++ I + V L G+S+G I++ K P F+ + L Sbjct: 80 VRDVVQHVVTIKSTYPGVPVFLLGHSMGATISILAAYKNPNLFTAMIL 127 >gnl|CDD|130316 TIGR01249, pro_imino_pep_1, proline iminopeptidase, Neisseria-type subfamily. This model represents one of two related families of proline iminopeptidase in the alpha/beta fold hydrolase family. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members. Length = 306 Score = 37.1 bits (86), Expect = 0.006 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 7/96 (7%) Query: 48 REYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVL 107 R +F E + ++ R K+T + T D +V D+ KLR EK G + L Sbjct: 46 RRFFDPETYRIVLFDQRGCGKSTP-HACLEENTTWD--LVADIEKLR----EKLGIKNWL 98 Query: 108 LFGYSLGTIIALSTLLKYPQKFSGIALWNLDLCFEK 143 +FG S G+ +AL+ +P+ +G+ L + L EK Sbjct: 99 VFGGSWGSTLALAYAQTHPEVVTGLVLRGIFLLREK 134 >gnl|CDD|163407 TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1- carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase. Length = 251 Score = 36.8 bits (86), Expect = 0.007 Identities = 14/38 (36%), Positives = 22/38 (57%) Query: 97 ISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIAL 134 + ++ G L GYS+G IAL L+YP++ G+ L Sbjct: 63 LLDQLGIEPFFLVGYSMGGRIALYYALQYPERVQGLIL 100 >gnl|CDD|162270 TIGR01250, pro_imino_pep_2, proline-specific peptidases, Bacillus coagulans-type subfamily. This model describes a subfamily of the alpha/beta fold family of hydrolases. Characterized members include prolinases (Pro-Xaa dipeptidase, EC 3.4.13.8), prolyl aminopeptidases (EC 3.4.11.5), and a leucyl aminopeptidase. Length = 288 Score = 34.3 bits (79), Expect = 0.043 Identities = 25/95 (26%), Positives = 38/95 (40%), Gaps = 14/95 (14%) Query: 42 EDYNDFREYFAEENVAVYIY----SYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLI 97 E + RE EE V +Y + SD L + + V ++ ++R Sbjct: 40 EYLENLRELLKEEGREVIMYDQLGCGYSDQPDDSDEL--WTIDYF----VDELEEVR--- 90 Query: 98 SEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGI 132 EK G L G+S G ++A LKY Q G+ Sbjct: 91 -EKLGLDKFYLLGHSWGGMLAQEYALKYGQHLKGL 124 >gnl|CDD|165136 PHA02771, PHA02771, hypothetical protein; Provisional. Length = 90 Score = 31.1 bits (70), Expect = 0.43 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 28 RAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNTIKTTSDY 73 + II++ EE I+D D +A++N+ Y YR I + DY Sbjct: 28 KEIIVSYNQFEEIIKD-GDLTHRYADKNITSDFYEYRENIHSIIDY 72 >gnl|CDD|163135 TIGR03101, hydr2_PEP, hydrolase, ortholog 2, exosortase system type 1 associated. This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 1, TIGR03100) of the same superfamily. Length = 266 Score = 29.0 bits (65), Expect = 1.5 Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 99 EKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALW 135 + G+ V L+G LG ++AL K + + LW Sbjct: 94 IEQGHPPVTLWGLRLGALLALDAANPLAAKCNRLVLW 130 >gnl|CDD|152581 pfam12146, Hydrolase_4, Putative lysophospholipase. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. Many members are annotated as being lysophospholipases, and others as alpha-beta hydrolase fold-containing proteins. Length = 79 Score = 29.0 bits (66), Expect = 1.7 Identities = 11/45 (24%), Positives = 19/45 (42%) Query: 20 YNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYR 64 P+A+++ E+ Y + E A + AVY Y +R Sbjct: 8 RWLPAGPPKAVVVLVHGGGEHSGRYAELAEELAAQGYAVYAYDHR 52 >gnl|CDD|178190 PLN02578, PLN02578, hydrolase. Length = 354 Score = 28.7 bits (64), Expect = 2.0 Identities = 15/31 (48%), Positives = 20/31 (64%) Query: 106 VLLFGYSLGTIIALSTLLKYPQKFSGIALWN 136 +L G SLG ALST + YP+ +G+AL N Sbjct: 154 AVLVGNSLGGFTALSTAVGYPELVAGVALLN 184 >gnl|CDD|162117 TIGR00932, 2a37, transporter, monovalent cation:proton antiporter-2 (CPA2) family. Length = 273 Score = 28.4 bits (64), Expect = 2.3 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 81 TSDTTIVCDVMKLRTLISEKHGNT--SVLLFGYSLGTIIALSTLLKYPQKFSGI 132 S T +V V+K R L+ G T +LLF + + L+ L S Sbjct: 113 LSSTAVVVQVLKERGLLKTPFGQTVLGILLFQ-DIAVVPLLALLPLLATSASTE 165 >gnl|CDD|117130 pfam08553, VID27, VID27 cytoplasmic protein. This is a family of fungal and plant proteins and contains many hypothetical proteins. VID27 is a cytoplasmic protein that plays a potential role in vacuolar protein degradation. Length = 788 Score = 28.6 bits (64), Expect = 2.4 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 11/57 (19%) Query: 149 MTLLLKIEKFFKGSDTPSRLMRHLTTDLWNR-NNQNWKNFLKDHSVKKNSQNYILDS 204 ++ LLK FK +D + T LW N Q W K+ Q+YILD+ Sbjct: 323 LSWLLK----FKDADAFTHFQEGFTQALWETLNKQKWTK------AKETEQDYILDA 369 >gnl|CDD|150830 pfam10216, ChpXY, CO2 hydration protein (ChpXY). This small family of proteins includes paralogues ChpX and ChpY in Synechococcus sp. PCC7942 and other cyanobacteria, associated with distinct NAD(P)H dehydrogenase complexes. These proteins collectively enable light-dependent CO2 hydration and CO2 uptake; loss of both blocks growth at low CO2 concentrations. Length = 353 Score = 28.0 bits (63), Expect = 2.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 157 KFFKGSDTPSRLMRHLTTDLWN 178 K+F G +P +L+RH D N Sbjct: 56 KYFNGEISPPKLLRHWWHDRIN 77 >gnl|CDD|178011 PLN02385, PLN02385, hydrolase; alpha/beta fold family protein. Length = 349 Score = 27.8 bits (62), Expect = 3.4 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Query: 85 TIVCDVMKLRTLISE--KHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIAL 134 +V DV++ + I + LFG S+G +AL LK P + G L Sbjct: 141 DLVDDVIEHYSKIKGNPEFRGLPSFLFGQSMGGAVALKVHLKQPNAWDGAIL 192 >gnl|CDD|181389 PRK08324, PRK08324, short chain dehydrogenase; Validated. Length = 681 Score = 27.1 bits (61), Expect = 5.6 Identities = 9/18 (50%), Positives = 9/18 (50%), Gaps = 2/18 (11%) Query: 238 CLIGGGNVSSKIE--DLT 253 GGGN S K DLT Sbjct: 33 VNHGGGNTSVKTTETDLT 50 >gnl|CDD|150805 pfam10180, DUF2373, Uncharacterized conserved protein (DUF2373). This is the C-terminal conserved region of a family of proteins found from fungi to humans. The function is not known. Length = 65 Score = 27.2 bits (61), Expect = 5.7 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 11/42 (26%) Query: 175 DLWNRNNQNWKNFLKDHSVKKNSQNYIL----DSNHIPISVW 212 W+++ NWK F KN QN++L D + IP + Sbjct: 5 RQWHKDRSNWK-F------SKNKQNWLLKHIFDVDKIPEEYF 39 >gnl|CDD|132456 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines. Length = 382 Score = 27.1 bits (60), Expect = 6.4 Identities = 10/74 (13%), Positives = 27/74 (36%), Gaps = 4/74 (5%) Query: 71 SDYLRDYPKNTSDTTIVC--DVMKLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQK 128 +DY+ D+ +T+ ++ +M R L +H + + + + ++ Sbjct: 258 NDYVADFVAHTNPLNVLTARSLM--RPLTDLEHVDGGWCVSDRRDTWLFTIDKQVRRRDA 315 Query: 129 FSGIALWNLDLCFE 142 + W + E Sbjct: 316 KLPVQAWAAEQEVE 329 >gnl|CDD|183823 PRK12901, secA, preprotein translocase subunit SecA; Reviewed. Length = 1112 Score = 26.9 bits (60), Expect = 6.5 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 20/42 (47%) Query: 248 KIEDLTQTYKLTTRLQN-------------------EEFYDI 270 KIE TQT+ T LQN EF+DI Sbjct: 543 KIEAATQTFATIT-LQNYFRMYHKLAGMTGTAETEAGEFWDI 583 >gnl|CDD|178561 PLN02980, PLN02980, 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding. Length = 1655 Score = 27.1 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Query: 106 VLLFGYSLGTIIALSTLLKYPQKFSG 131 V L GYS+G IAL L++ K G Sbjct: 1447 VTLVGYSMGARIALYMALRFSDKIEG 1472 >gnl|CDD|178457 PLN02866, PLN02866, phospholipase D. Length = 1068 Score = 27.0 bits (60), Expect = 6.9 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 18/40 (45%) Query: 123 LKYPQKFS-GIALWN-----------------LDLCFEKY 144 L+YP FS G+ LW+ LDLCF +Y Sbjct: 432 LRYPDHFSSGVYLWSHHEKLVIVDYQICFIGGLDLCFGRY 471 >gnl|CDD|178636 PLN03087, PLN03087, BODYGUARD 1 domain containing hydrolase; Provisional. Length = 481 Score = 26.7 bits (59), Expect = 7.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Query: 99 EKHGNTSVLLFGYSLGTIIALSTLLKYP 126 E++ S + +SLG I+AL+ +K+P Sbjct: 269 ERYKVKSFHIVAHSLGCILALALAVKHP 296 >gnl|CDD|149085 pfam07819, PGAP1, PGAP1-like protein. The sequences found in this family are similar to PGAP1. This is an endoplasmic reticulum membrane protein with a catalytic serine containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body. Length = 225 Score = 26.6 bits (59), Expect = 8.0 Identities = 18/82 (21%), Positives = 32/82 (39%), Gaps = 27/82 (32%) Query: 45 NDFREYFAEENVAVYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLIS----EK 100 DF E + T+ ++YL D +R ++S + Sbjct: 45 VDFNEEL------SAFHGR--TLLDQAEYLND---------------AIRYILSLYNSGR 81 Query: 101 HGNTSVLLFGYSLGTIIALSTL 122 TSV+L G+S+G ++A + L Sbjct: 82 PPPTSVILIGHSMGGLVARAAL 103 >gnl|CDD|183538 PRK12460, PRK12460, 2-keto-3-deoxygluconate permease; Provisional. Length = 312 Score = 26.9 bits (60), Expect = 8.0 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Query: 92 KLRTLISEKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIAL 134 +R ++ K G + F ++LG I LS LL+ +GI L Sbjct: 185 DMRKFLT-KGGPLLIPFFAFALGAGINLSMLLQ--AGLAGILL 224 >gnl|CDD|148105 pfam06296, DUF1044, Protein of unknown function (DUF1044). This family consists of several hypothetical bacterial proteins of unknown function. Length = 120 Score = 26.8 bits (60), Expect = 8.1 Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 94 RTLISEKHGNTSVLLFGYS 112 RT++ K G+ + LFG++ Sbjct: 60 RTIVLFKSGDRAFFLFGFA 78 >gnl|CDD|181727 PRK09249, PRK09249, coproporphyrinogen III oxidase; Provisional. Length = 453 Score = 26.6 bits (60), Expect = 8.4 Identities = 11/33 (33%), Positives = 13/33 (39%), Gaps = 6/33 (18%) Query: 28 RAIILA--CQ---SIEENIEDYN-DFREYFAEE 54 R +I C + DF EYFAEE Sbjct: 369 RDVIEQLMCNFELDFAAIEAAFGIDFAEYFAEE 401 >gnl|CDD|131525 TIGR02472, sucr_P_syn_N, sucrose-phosphate synthase, putative, glycosyltransferase domain. This family consists of the N-terminal regions, or in some cases the entirety, of bacterial proteins closely related to plant sucrose-phosphate synthases (SPS). The C-terminal domain (TIGR02471), found with most members of this family, resembles both bona fide plant sucrose-phosphate phosphatases (SPP) and the SPP-like domain of plant SPS. At least two members of this family lack the SPP-like domain, which may have binding or regulatory rather than enzymatic activity by analogy to plant SPS. This enzyme produces sucrose 6-phosphate and UDP from UDP-glucose and D-fructose 6-phosphate, and may be encoded near the gene for fructokinase. Length = 439 Score = 26.6 bits (59), Expect = 8.9 Identities = 7/29 (24%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Query: 239 LIGGGNVSSKIEDLTQTYKLTTRLQNEEF 267 L+ G K + + + Y ++ R++ EE Sbjct: 155 LLAAG---LKPQQIEKQYNISRRIEAEEE 180 >gnl|CDD|178344 PLN02743, PLN02743, nicotinamidase. Length = 239 Score = 26.6 bits (59), Expect = 9.8 Identities = 15/65 (23%), Positives = 30/65 (46%), Gaps = 13/65 (20%) Query: 237 FCLIGGGNVSSKIEDLTQTYKLTTRLQNE------EFYDISL--MSLPPTMHSNDPHNVF 288 FC +G GN++ + D K +++ +E EF + ++ + H + P + + Sbjct: 39 FCTVGAGNLAPREPD-----KQISKMVDESARLAREFCERKWPVLAFLDSHHPDKPEHPY 93 Query: 289 PPPAI 293 PP I Sbjct: 94 PPHCI 98 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.134 0.403 Gapped Lambda K H 0.267 0.0711 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,081,653 Number of extensions: 309642 Number of successful extensions: 634 Number of sequences better than 10.0: 1 Number of HSP's gapped: 633 Number of HSP's successfully gapped: 32 Length of query: 317 Length of database: 5,994,473 Length adjustment: 93 Effective length of query: 224 Effective length of database: 3,984,929 Effective search space: 892624096 Effective search space used: 892624096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 57 (25.8 bits)