BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780274|ref|YP_003064687.1| lysophospholipase protein [Candidatus Liberibacter asiaticus str. psy62] (317 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780274|ref|YP_003064687.1| lysophospholipase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 317 Score = 657 bits (1696), Expect = 0.0, Method: Compositional matrix adjust. Identities = 317/317 (100%), Positives = 317/317 (100%) Query: 1 MSQKTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYI 60 MSQKTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYI Sbjct: 1 MSQKTFLTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYI 60 Query: 61 YSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALS 120 YSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALS Sbjct: 61 YSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKHGNTSVLLFGYSLGTIIALS 120 Query: 121 TLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRN 180 TLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRN Sbjct: 121 TLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRN 180 Query: 181 NQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLI 240 NQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLI Sbjct: 181 NQNWKNFLKDHSVKKNSQNYILDSNHIPISVWLEFMSMATDISSRGSFNPLSRFIPFCLI 240 Query: 241 GGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWI 300 GGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWI Sbjct: 241 GGGNVSSKIEDLTQTYKLTTRLQNEEFYDISLMSLPPTMHSNDPHNVFPPPAIKKLRNWI 300 Query: 301 VNSYLPKVIPLISQHKK 317 VNSYLPKVIPLISQHKK Sbjct: 301 VNSYLPKVIPLISQHKK 317 >gi|254780166|ref|YP_003064579.1| hydrolase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Score = 27.3 bits (59), Expect = 0.36, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 20/39 (51%) Query: 99 EKHGNTSVLLFGYSLGTIIALSTLLKYPQKFSGIALWNL 137 E G + V + GYS+G IA S +L YP + L + Sbjct: 93 EHLGISKVHVMGYSMGARIACSMVLFYPSYVRSVILGGV 131 >gi|254780832|ref|YP_003065245.1| putative potassium uptake transport system protein [Candidatus Liberibacter asiaticus str. psy62] Length = 628 Score = 26.9 bits (58), Expect = 0.45, Method: Compositional matrix adjust. Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 6/73 (8%) Query: 7 LTEDETIHKSVHSYNQTHKTPRAIILACQSIEENIEDYNDFREYFAEENVAVYIYSYRNT 66 + ++ I ++++ NQ + P+ C+ I E+ F Y E+NV+ + RN Sbjct: 506 ILHEQNIILTINTANQP-RIPKEKRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNN 564 Query: 67 -----IKTTSDYL 74 I TS YL Sbjct: 565 GLKFEIMNTSFYL 577 >gi|254781090|ref|YP_003065503.1| hypothetical protein CLIBASIA_04960 [Candidatus Liberibacter asiaticus str. psy62] Length = 71 Score = 25.0 bits (53), Expect = 1.7, Method: Compositional matrix adjust. Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 9/42 (21%) Query: 58 VYIYSYRNTIKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISE 99 V I + +IKT +D+++DYP CD ++L L+++ Sbjct: 36 VKIGDHAESIKTLADFIKDYPD--------CD-LELENLVTD 68 >gi|254780284|ref|YP_003064697.1| hypothetical protein CLIBASIA_00845 [Candidatus Liberibacter asiaticus str. psy62] Length = 623 Score = 24.6 bits (52), Expect = 2.5, Method: Compositional matrix adjust. Identities = 15/75 (20%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Query: 133 ALWNLDLCFEKYSCMLMTLLLKIEKFFKGSDTPSRLMRHLTTDLWNRNNQNWKNFLKDHS 192 ++ +LD + YS L + LK + FF G L + L L + + + ++ + Sbjct: 23 SIPSLDSSIKDYSRQLTNIFLKDKVFFDG------LEQELLASLGSMGQEKFVSYARKKR 76 Query: 193 VKKNSQNYILDSNHI 207 +++ ++ + S H+ Sbjct: 77 SQRSPEDQLPSSKHL 91 >gi|254781149|ref|YP_003065562.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 266 Score = 24.3 bits (51), Expect = 3.2, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Query: 106 VLLFGY--SLG-TIIALSTLLKYPQKFSGIALWNLDLCFEKYSCMLMTLLL 153 ++L G S+G T ALST L G+A ++L++ EK ++ LL Sbjct: 144 LILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLEMDREKLGARALSNLL 194 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 22.7 bits (47), Expect = 7.5, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 67 IKTTSDYLRDYPKNTSDTTIVCDVMKLRTLISEKH 101 IK S Y+ D P T D T V ++ R ++S+ H Sbjct: 125 IKEQSIYMGDLPLMTKDGTFVIKGIQ-RIVVSQLH 158 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.134 0.403 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 214,187 Number of Sequences: 1233 Number of extensions: 8781 Number of successful extensions: 26 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 9 length of query: 317 length of database: 328,796 effective HSP length: 74 effective length of query: 243 effective length of database: 237,554 effective search space: 57725622 effective search space used: 57725622 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 38 (19.2 bits)