RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780275|ref|YP_003064688.1| SsrA-binding protein [Candidatus Liberibacter asiaticus str. psy62] (159 letters) >1j1h_A Small protein B; SMPB, SSRA associated protein, OB fold, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Thermus thermophilus} (A:) Length = 144 Score = 200 bits (511), Expect = 7e-53 Identities = 71/143 (49%), Positives = 96/143 (67%) Query: 12 KVVSDNRKARYNYHIVRSFEAGIVLTGTEVKSLRVSKVNISDSYATFENDEIWLTNSYIP 71 V +NR+AR++Y I+ ++EAGI L GTEVKSLR KV+ + S+A FE+ E++L N YI Sbjct: 2 APVLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDGELYLENLYIA 61 Query: 72 EYLQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAKGLAKIDLALAQ 131 Y + + N PRR RKLLL K E+ RL V + G+TLVP+KIYFN +G AK+ L LA+ Sbjct: 62 PYEKGSYANVDPRRKRKLLLHKHELRRLLGKVEQKGLTLVPLKIYFNERGYAKVLLGLAR 121 Query: 132 GKKNYDKRETEKKRDWDRQKHRI 154 GKK Y+KR +KK R + Sbjct: 122 GKKAYEKRREDKKEAVRRALEEL 144 >1p6v_A SSRA-binding protein; SMPB, tmRNA, trans-translation, protein-RNA complex, RNA binding protein/RNA complex; 3.20A {Aquifex aeolicus} (A:) Length = 156 Score = 197 bits (502), Expect = 7e-52 Identities = 65/153 (42%), Positives = 92/153 (60%), Gaps = 2/153 (1%) Query: 8 NPPKKVVSDNRKARYNYHIVRSFEAGIVLTGTEVKSLR-VSKVNISDSYATFENDEIWLT 66 + +++N++A+ Y I+ ++EAGIVL G+EVKSLR V+ DS+ EN E WL Sbjct: 3 SDKIIPIAENKEAKAKYDILETYEAGIVLKGSEVKSLREKGTVSFKDSFVRIENGEAWLY 62 Query: 67 NSYIPEYLQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAKGLAKID 126 N YI Y A NH P R RKLLL KREI RLY V+ G T++P+K+Y+ K+ Sbjct: 63 NLYIAPYKHATIENHDPLRKRKLLLHKREIMRLYGKVQEKGYTIIPLKLYWK-NNKVKVL 121 Query: 127 LALAQGKKNYDKRETEKKRDWDRQKHRILREHN 159 +ALA+GKK YD+R K++ R+ R + Sbjct: 122 IALAKGKKLYDRRRELKEKAMKRELEREFKGKI 154 >1wjx_A Small protein B, SSRA-binding protein; RNA binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.70A {Thermus thermophilus} (A:) Length = 122 Score = 177 bits (452), Expect = 5e-46 Identities = 64/120 (53%), Positives = 86/120 (71%) Query: 14 VSDNRKARYNYHIVRSFEAGIVLTGTEVKSLRVSKVNISDSYATFENDEIWLTNSYIPEY 73 V +NR+AR++Y I+ ++EAGI L GTEVKSLR KV+ + S+A FE+ E++L N YI Y Sbjct: 3 VLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDGELYLENLYIAPY 62 Query: 74 LQANRFNHYPRRNRKLLLSKREIHRLYAAVRRDGMTLVPMKIYFNAKGLAKIDLALAQGK 133 + + N PRR RKLLL K E+ RL V + G+TLVP+KIYFN +G AK+ L LA+GK Sbjct: 63 EKGSYANVDPRRKRKLLLHKHELRRLLGKVEQKGLTLVPLKIYFNERGYAKVLLGLARGK 122 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.319 0.134 0.387 Gapped Lambda K H 0.267 0.0629 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,199,235 Number of extensions: 50314 Number of successful extensions: 123 Number of sequences better than 10.0: 1 Number of HSP's gapped: 121 Number of HSP's successfully gapped: 18 Length of query: 159 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 77 Effective length of database: 2,184,039 Effective search space: 168171003 Effective search space used: 168171003 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.6 bits)