HHsearch alignment for GI: 254780276 and conserved domain: cd06322

>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. This group includes the periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consist of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=94.23  E-value=0.58  Score=27.65  Aligned_cols=31  Identities=16%  Similarity=0.093  Sum_probs=21.8

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             8868999999999999769989998672325
Q gi|254780276|r   17 NLIDEDAFVEHIEWQITEGSGGLVPAGTTGE   47 (292)
Q Consensus        17 ~~iD~~~~~~~i~~l~~~gv~gi~~~G~tGE   47 (292)
T Consensus        37 s~~d~~~q~~~i~~li~~~vDgiIi~p~~~~   67 (267)
T cd06322          37 ANQDLNKQLSDVEDFITKKVDAIVLSPVDSK   67 (267)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             9999999999999999749999999067610