RPSBLAST alignment for GI: 254780277 and conserved domain: cd00128

>gnl|CDD|29030 cd00128, XPG, Xeroderma pigmentosum G N- and I-regions (XPGN, XPGI); contains the HhH2 motif; domain in nucleases. XPG is a eukaryotic enzyme that functions in nucleotide-excision repair and transcription-coupled repair of oxidative DNA damage. Functionally/structurally related to FEN-1; divalent metal ion-dependent exo- and endonuclease, and bacterial and bacteriophage 5'3' exonucleases.. Length = 316
 Score = 51.0 bits (122), Expect = 1e-06
 Identities = 44/132 (33%), Positives = 68/132 (51%), Gaps = 14/132 (10%)

Query: 103 QAFGIPAIEIQGFEADDIIATYTYIAEKEGFAVTIISTDKDLMQLVSPTTCLYDTVKE-- 160
           +  GIP I    +EA+   A   Y+  K+G    II+ D DL+   +P            
Sbjct: 138 RLMGIPYIVA-PYEAE---AQCAYL-AKKGLVDAIITEDSDLLLFGAPRVYRNLFDSGAK 192

Query: 161 --EKIDIEHVIKKWGIPPEKMVCLQALTGDSIDNIPGIPGIGYKTAALLLQEYGNLENIL 218
             E+ID+E ++K+ G+  EK++ L  L G   D   GIPGIG  TA  L+++YG++E  +
Sbjct: 193 PVEEIDLEKILKELGLTREKLIDLAILLG--CDYTEGIPGIGPVTALKLIKKYGDIEKDI 250

Query: 219 INASRIKQKKRR 230
               R+K+K  R
Sbjct: 251 ---ERLKKKLYR 259