HHsearch alignment for GI: 254780280 and conserved domain: PRK05183

>PRK05183 hscA chaperone protein HscA; Provisional.
Probab=95.79  E-value=0.12  Score=28.19  Aligned_cols=200  Identities=16%  Similarity=0.073  Sum_probs=84.8

Q ss_pred             HHHCCCCEEEECHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCEEEECCCCEEEEEEEECCCCCCEECCCCCCCCCCC
Q ss_conf             98289855882126543200001586553530243455766675279931762022454310588630113567866667
Q gi|254780280|r  100 SRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIG  179 (348)
Q Consensus       100 ~~~~~~~v~i~ND~~a~a~~~~~~~~~~~~~lg~~~~~~~~~~~~~~~ig~GtG~g~~~~~~~~~g~~~~agE~Gh~~~~  179 (348)
T Consensus       174 ~iAGL~VlRlINEPTAAAlAYGld---------------~~~e~~vlVyDLGGGTfDVSIl~~~~gvfeVlAt~GD~~LG  238 (621)
T PRK05183        174 RLAGLNVLRLLNEPTAAAIAYGLD---------------SGQEGVIAVYDLGGGTFDISILRLSKGVFEVLATGGDSALG  238 (621)
T ss_pred             HHCCCCEEEEECHHHHHHHHHCCC---------------CCCCCEEEEEECCCCEEEEEEEEEECCEEEEEEECCCCCCC
T ss_conf             974984587416289999980266---------------68875799998788658999999748878999705988758


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHHCCCCCCCCCC----HHH----HHHHCCCHHHHHHHHHH
Q ss_conf             6610234789999853189864877522223899999998740888643698----889----98836895799999999
Q gi|254780280|r  180 PSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLS----SKD----IVSKSEDPIALKAINLF  251 (348)
Q Consensus       180 ~~~~~~~~~~~~l~~~~g~~~~~E~~~SG~gl~~~y~~l~~~~~~~~~~~~~----~~~----~~~~~~D~~A~~~~~~~  251 (348)
T Consensus       239 G-~DfD~~i~~~l~~~~~~~~~-~d~~~~~~L~~~aE~aK~~LS~~~~~~i~~~~~~~~~~~~ltR~~FE~l~~~L~~rt  316 (621)
T PRK05183        239 G-DDFDHLLADWLLEQAGLAPR-LDPEDQRLLLDAARAAKEALSDADSVEVSVALWQGELKLTITREQFEALIAPLVKRT  316 (621)
T ss_pred             C-HHHHHHHHHHHHHHHCCCCC-CCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCEEEEEEEHHHHHHHHHHHHHHH
T ss_conf             0-88999999999987433657-999999999999999999636786389996058953799974999999999999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHCCEEEEECCCCHHHHHHHHHHC
Q ss_conf             999999999999974899738996567765567727648999988379837889738879995787227759998738
Q gi|254780280|r  252 CEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKM  329 (348)
Q Consensus       252 ~~~lg~~i~~l~~~~~p~~~IvlgGGi~~~~~~~l~~~~f~~~f~~~~~~~~~l~~ipv~~~~~~~agl~GAa~~~r~  329 (348)
T Consensus       317 ~~~v~~aL~dA~l~~~dId~ViLVGGSTRi--P~Vq~--~v~~~Fgk~---------~~~~inPDeaVA~GAAiQa~i  381 (621)
T PRK05183        317 LLACRRALRDAGVEADEVLEVVMVGGSTRV--PLVRE--AVGEFFGRT---------PLTSIDPDKVVALGAAIQADI  381 (621)
T ss_pred             HHHHHHHHHHHCCCHHHCEEEEEECCCCCC--HHHHH--HHHHHHCCC---------CCCCCCCHHHHHHHHHHHHHH
T ss_conf             999999998713683002099992885456--68999--999985989---------666899016888769999998