HHsearch alignment for GI: 254780280 and conserved domain: PRK13326

>PRK13326 pantothenate kinase; Reviewed.
Probab=97.61  E-value=0.0047  Score=36.95  Aligned_cols=133  Identities=17%  Similarity=0.284  Sum_probs=69.9

Q ss_pred             CCCEEEEEECCCCEEEEEEECCCCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEEEEECCCEEEECCCCC
Q ss_conf             77379998575118999987799808899974388735889999999972234565546999730441685564213566
Q gi|254780280|r   12 AFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHW   91 (348)
Q Consensus        12 ~~~vL~iDIGGT~ir~glv~~~~~~i~~~~~~~t~~~~~~~~~i~~~l~~~~~~~~~~igi~v~Gpv~~~~~~~~~~~~~   91 (348)
T Consensus         6 ~m~-L~IDIGNT~ik~g~~~~--~~l~~~~r~~T~~~~t~d~~~~-~~~~~~~~~i~~viiSSVVP~~~-----------   70 (262)
T PRK13326          6 SSQ-LIIDIGNTSISFALYKD--NKMQIFCKLKTKLDLSFDELYS-FLKEKFDFKVNQVFVSSVVPVID-----------   70 (262)
T ss_pred             CCE-EEEEECCCCEEEEEEEC--CEEEEEEEECCCCCCCHHHHHH-HHHHHCCCCCCEEEEECCCCCHH-----------
T ss_conf             665-89998787159999989--9999999970787578999999-99975146898899985682058-----------


Q ss_pred             CCCHHHHHHHHCCCCEEEECHHHHH----H--HHHCCCCHHHHHHHCCCCCCCCCCCCCEEEECCCCEEEEEEEEC
Q ss_conf             6698899998289855882126543----2--00001586553530243455766675279931762022454310
Q gi|254780280|r   92 VIDPEELISRMQFEDVLLINDFEAQ----A--LAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIR  161 (348)
Q Consensus        92 ~~~~~~l~~~~~~~~v~i~ND~~a~----a--~~~~~~~~~~~~~lg~~~~~~~~~~~~~~~ig~GtG~g~~~~~~  161 (348)
T Consensus        71 ~~~~~~~~~~~~~~~~~v~~~~~~~l~i~~~~~~~~~lG~DRian~vaA~~--~y~~~~~iIID~GTAtT~d~v~~  144 (262)
T PRK13326         71 KVLINVIFSLYKVKPLFIGFDLNYDLSFNPYNSNKFLLGSDVFANLVGAIE--YYNINDALVVDLGTACTIFAVSR  144 (262)
T ss_pred             HHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH--HCCCCCEEEEECCCCEEEEEEEC
T ss_conf             999999999859953898578887863021698721365599999999999--66999889997698479999906