HHsearch alignment for GI: 254780280 and conserved domain: TIGR03192

>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit. Members of this family are the Q subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Probab=93.70  E-value=0.44  Score=24.80  Aligned_cols=49  Identities=12%  Similarity=0.121  Sum_probs=35.0

Q ss_pred             CCEEEEEECCCCEEEEEEECCCCEEEEEEEECCCC--CCCHHHHHHHHHHHCC
Q ss_conf             73799985751189999877998088999743887--3588999999997223
Q gi|254780280|r   13 FPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSD--YENLEHAIQEVIYRKI   63 (348)
Q Consensus        13 ~~vL~iDIGGT~ir~glv~~~~~~i~~~~~~~t~~--~~~~~~~i~~~l~~~~   63 (348)
T Consensus        32 mit~GIDiGSTttK~Vll~d--~~ii~~~~~~tg~~~~~aa~~~l~~~l~~~g   82 (293)
T TIGR03192        32 IITCGIDVGSVSSQAVLVCD--GELYGYNSMRTGNNSPDSAKNALQGIMDKIG   82 (293)
T ss_pred             EEEEEEECCCHHEEEEEEEC--CCEEEEEEEECCCCHHHHHHHHHHHHHHHCC
T ss_conf             79997871802668999948--9299999860699828999999999999859