HHsearch results for GI: 254780280 and protein with PDBid: 1sz2_A

>1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A*
Probab=100.00  E-value=0  Score=337.12  Aligned_cols=315  Identities=30%  Similarity=0.511  Sum_probs=267.6

Q ss_pred             CCCEEEEEECCCCEEEEEEECCCCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEEEEECCCEEEECCCCC
Q ss_conf             77379998575118999987799808899974388735889999999972234565546999730441685564213566
Q gi|254780280|r   12 AFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIYRKISIRLRSAFLAIATPIGDQKSFTLTNYHW   91 (348)
Q Consensus        12 ~~~vL~iDIGGT~ir~glv~~~~~~i~~~~~~~t~~~~~~~~~i~~~l~~~~~~~~~~igi~v~Gpv~~~~~~~~~~~~~   91 (348)
                      ..=.|++||||||||+|++|+++.++...++++++++++++++|++++++. ..++.++||++||||+.+... ..+..+
T Consensus        13 ~~y~L~~DIGGT~ir~alvd~~~~~i~~~~~~~~~~~~~~~~~l~~~~~~~-~~~~~~igI~~pGpv~~~~~~-~~~~~~   90 (332)
T 1sz2_A           13 TKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEH-KVEVKDGCIAIACPITGDWVA-MTNHTW   90 (332)
T ss_dssp             -CEEEEEEEETTEEEEEEEETTTCCEEEEEEEEGGGCSCHHHHHHHHHHHS-CCCCCEEEEEESSCCCSSEEC-CSSSCC
T ss_pred             CCEEEEEEECHHHHHHEEEECCCCEEEEEEEECCCCHHHHHHHHHHHHHHC-CCCCCEEEEEECCCCCCCEEE-EECCCC
T ss_conf             328999998815432556989999897889878987647999999999865-998775999902564287346-631433


Q ss_pred             CCCHHHHHHHHCCCCEEEECHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCEEEECCCCEEEEEEEECCCCCCEECCC
Q ss_conf             66988999982898558821265432000015865535302434557666752799317620224543105886301135
Q gi|254780280|r   92 VIDPEELISRMQFEDVLLINDFEAQALAICSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISC  171 (348)
Q Consensus        92 ~~~~~~l~~~~~~~~v~i~ND~~a~a~~~~~~~~~~~~~lg~~~~~~~~~~~~~~~ig~GtG~g~~~~~~~~~g~~~~ag  171 (348)
                      .++..++...+...++.+.||+++.++++....+.....++.   +....+..++++++|||.|.+...+...|.+..++
T Consensus        91 ~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~g~---~~~~~~~~~~~lgtG~G~g~~~~~~~~~g~~~~ag  167 (332)
T 1sz2_A           91 AFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGG---AEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPG  167 (332)
T ss_dssp             CEEHHHHHHHHTCSEEEEEEHHHHHHHHGGGCCGGGEEECSS---CCCCTTCCEEEEEESSSEEEEEEEEETTEEEEEEC
T ss_pred             CCCHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHCC---CCCCCCCEEEEECCCCCCEEEEEECCCCCCCCCCC
T ss_conf             578689987642563566237332122444455646777376---77888626999837665656786034566543455


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHH--HHHHHCCCHHHHHHHH
Q ss_conf             67866667661023478999985318986487752222389999999874088864369888--9988368957999999
Q gi|254780280|r  172 EGGHMDIGPSTQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSK--DIVSKSEDPIALKAIN  249 (348)
Q Consensus       172 E~Gh~~~~~~~~~~~~~~~~l~~~~g~~~~~E~~~SG~gl~~~y~~l~~~~~~~~~~~~~~~--~~~~~~~D~~A~~~~~  249 (348)
                      |.||+.+.+....+....++ .|.|++.+|+|+++||++|.++|+++...............  +......|+.+.++++
T Consensus       168 e~G~~~~~~~~~~~~~~~~~-~~~~~~~g~~E~~~Sg~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  246 (332)
T 1sz2_A          168 EGGHVDFAPNSEEEAIILEI-LRAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALS  246 (332)
T ss_dssp             CGGGSBCCCCSHHHHHHHHH-HHHHSSSCBGGGTSSHHHHHHHHHHHHHHTTCCCCCCCHHHHHHHHHHTCCHHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHH-HHHCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCHHHHHHHHH
T ss_conf             55665667765033211112-22036743001013121389999999742688831146278999987301267899999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHCCHHHHHHHHHCCCHHHHHHHCCEEEEECCCCHHHHHHHHHHC
Q ss_conf             99999999999999974899738996567765567727648999988379837889738879995787227759998738
Q gi|254780280|r  250 LFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSPHKELMRQIPTYVITNPYIAIAGMVSYIKM  329 (348)
Q Consensus       250 ~~~~~lg~~i~~l~~~~~p~~~IvlgGGi~~~~~~~l~~~~f~~~f~~~~~~~~~l~~ipv~~~~~~~agl~GAa~~~r~  329 (348)
                      .+.++++..+.++++.+.|.+.|||||||+.++.+++.++.|+++|.+++++.++++++||++++++|+||+|||+|+||
T Consensus       247 ~~~~~~~~~~~~~~~~~~~~~~IviGGGv~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ipv~~~~~~dagliGAa~~ar~  326 (332)
T 1sz2_A          247 LFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQ  326 (332)
T ss_dssp             HHHHHHHHHHHHHHHHHTCTTEEEEECSSSGGGHHHHHHSSHHHHHHCCGGGHHHHTTCCEEEECCSCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHHCCHHHHHHHHHCCCHHHHHCCCCEEEEECCCHHHHHHHHHHHH
T ss_conf             99999999999999985899789996417750476628099999998446356686068889998985749999999998


Q ss_pred             CCC
Q ss_conf             001
Q gi|254780280|r  330 TDC  332 (348)
Q Consensus       330 ~~~  332 (348)
                      +-.
T Consensus       327 ~l~  329 (332)
T 1sz2_A          327 TLG  329 (332)
T ss_dssp             HTT
T ss_pred             HHC
T ss_conf             611