HHsearch results for GI: 254780281 and protein with PDBid: 2pn8_A

>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens}
Probab=99.71  E-value=2.3e-16  Score=118.32  Aligned_cols=145  Identities=14%  Similarity=0.198  Sum_probs=109.2

Q ss_pred             CCCCCCCCCCCEE---EECCCCCEECHHHHCCCEEEEEEE-CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEECCC
Q ss_conf             6676666678707---982999796778849967999960-477765446888877655543024433305887651433
Q gi|254780281|r   28 FVDGNRRFNSDVH---LVAQDGTDFSLSSLYIKPSIVFFG-FTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPK  103 (201)
Q Consensus        28 ~~~~~~~~~~~f~---L~d~~G~~~~~~~~~Gk~~li~F~-~T~Cpd~Cp~~l~~l~~~~~~l~~~~~~v~~v~IsvDP~  103 (201)
                      ...-+...+|+|+   +.|.+|++++++||+|||+|++|+ ..+|| +|+.++..++..++++.+.+  ++++.||+   
T Consensus        17 ~~~~~~~PAPdF~~~a~~d~~~~~vsLsd~kGK~vVL~FyP~~fTp-vCt~E~~~f~~~~~ef~~~g--~~VigIS~---   90 (211)
T 2pn8_A           17 NLYFQSMPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTF-VCPTEIIAFGDRLEEFRSIN--TEVVACSV---   90 (211)
T ss_dssp             --CCSSCBCCCCEEEEEETTEEEEEEGGGGTTSEEEEEECSCTTSS-HHHHHHHHHHHTHHHHHTTT--EEEEEEES---
T ss_pred             CCCCCCCCCCCCCCCEEECCCCCEEEHHHHCCCEEEEEEECCCCCC-CCHHHHHHHHHHHHHHHCCC--CEEEEECC---
T ss_conf             7666789899985200488998688679968993999997666598-58799999987699860489--66760025---


Q ss_pred             CCCHHHHHHHHHHCC-------CCEECCCCCHHHHHHHHHHCCEEEEECCCCCCCCCCCEEEEEEEEEEEECCCCCEEEE
Q ss_conf             333057777753136-------8642245898898988886090886225655677775258742069998589829998
Q gi|254780281|r  104 RDTPEVMKKFVQRFS-------DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV  176 (201)
Q Consensus       104 rDt~e~l~~y~~~~~-------~~~~~ltg~~~~i~~l~~~~~v~~~~~~~~~~~~~~~y~i~H~~~~~lid~~G~i~~~  176 (201)
                       |+++..++|++...       -++..+...   -..+++.||++.+..         ..   ....+||||++|+|+.+
T Consensus        91 -Ds~~sh~aw~~~~~~~~~~~~l~fpllsD~---~~~v~k~yGv~~~~~---------g~---~~R~tFiID~~G~Ir~v  154 (211)
T 2pn8_A           91 -DSQFTHLAWINTPRRQGGLGPIRIPLLSDL---THQISKDYGVYLEDS---------GH---TLRGLFIIDDKGILRQI  154 (211)
T ss_dssp             -SCHHHHHHHHTSCGGGTCCCSCSSCEEECT---TSHHHHHTTCEETTT---------TE---ECEEEEEECTTSBEEEE
T ss_pred             -CCHHHHHHHHHHHHHHCCCCCCCCCEEECC---CCCHHHHCCCCCCCC---------CC---EEEEEEEECCCCEEEEE
T ss_conf             -668879999976886278567664632157---653698849822457---------96---15689998999979999


Q ss_pred             E----CCCCCHHHHHHHHHHHH
Q ss_conf             5----78988899999999998
Q gi|254780281|r  177 I----PYKDDSDSAIEKINRLI  194 (201)
Q Consensus       177 ~----~~~~~~~~i~~~i~~ll  194 (201)
                      +    +.+.+.+++++.|+.|-
T Consensus       155 ~~~~~~~gr~~~EvLr~l~aLq  176 (211)
T 2pn8_A          155 TLNDLPVGRSVDETLRLVQAFQ  176 (211)
T ss_dssp             EEECTTBCCCHHHHHHHHHHHH
T ss_pred             EECCCCCCCCHHHHHHHHHHHH
T ss_conf             9848987869999999999865