BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780281|ref|YP_003064694.1| cytochrome-c oxidase assembly
factor protein [Candidatus Liberibacter asiaticus str. psy62]
         (201 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|150397254|ref|YP_001327721.1| electron transport protein SCO1/SenC [Sinorhizobium medicae WSM419]
 gi|150028769|gb|ABR60886.1| electron transport protein SCO1/SenC [Sinorhizobium medicae WSM419]
          Length = 199

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 79/196 (40%), Positives = 119/196 (60%), Gaps = 3/196 (1%)

Query: 1   MKALGIILGTILLAVLGSIAYVSF---SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK++ I+L   +L ++  + +VSF    SK    +  F     LVAQ+G   +  +   K
Sbjct: 1   MKSIRIVLWAAILVLVAVLGWVSFDMTRSKQQAASGPFGVPFTLVAQNGEPVTEKAFTGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  L++VDP G+ L AYFITVDP+RDTPEV+ ++V   
Sbjct: 61  PTALFFGFTHCPEVCPTTLFELNGWLEKVDPEGSKLQAYFITVDPERDTPEVLGQYVSNV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RI GISG P  V+ + K +R+Y   V  +++  E  Y +DHT ++ L D  G   G I
Sbjct: 121 SKRITGISGPPEKVLEMVKGYRVYYKKVPTDEAKPEGDYTMDHTASVFLLDANGQFSGTI 180

Query: 178 PYKDDSDSAIEKINRL 193
            Y ++ ++A++K+  L
Sbjct: 181 AYGENPETAVKKLENL 196


>gi|241205538|ref|YP_002976634.1| electron transport protein SCO1/SenC [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859428|gb|ACS57095.1| electron transport protein SCO1/SenC [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 200

 Score =  158 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 80/200 (40%), Positives = 113/200 (56%), Gaps = 3/200 (1%)

Query: 1   MKALGIILG---TILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK   I +     IL   LG+       SK V     F     LV+Q+G   +  +L  K
Sbjct: 1   MKTFRIAVWVGVLILAGFLGAFTLDLTKSKDVVAEPPFGVPFTLVSQNGQPITEQALRGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  +++VDP G  L AYF+TVDP+RDTPE+M ++V   
Sbjct: 61  PTALFFGFTHCPEVCPTTLFELNGWMEKVDPKGDKLQAYFVTVDPERDTPEIMNEYVSNV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RI GISG P  +  V K FR+Y   V  ++      Y +DHT ++ L D+AG   G I
Sbjct: 121 SKRITGISGAPDKIAEVIKGFRVYAKKVPVDEKDPNGDYTMDHTASVFLLDSAGRFSGTI 180

Query: 178 PYKDDSDSAIEKINRLITYG 197
            Y ++ D+A++K+  L+  G
Sbjct: 181 AYGENPDTAVKKLENLVNKG 200


>gi|209550154|ref|YP_002282071.1| electron transporter SCO1/SenC [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535910|gb|ACI55845.1| electron transport protein SCO1/SenC [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 200

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 80/200 (40%), Positives = 112/200 (56%), Gaps = 3/200 (1%)

Query: 1   MKALGIILG---TILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK   I +     IL  VLG   +    S  V     F     LV+Q G   +  +L  K
Sbjct: 1   MKTFRIAVWVGVLILAGVLGFFRWYPLKSGDVAVEAPFGVPFTLVSQSGRPITEEALRGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  +++VDP G  L AYF+TVDP+RDTPE+M ++V   
Sbjct: 61  PTALFFGFTHCPEVCPTTLFELNGWMEKVDPKGDKLQAYFVTVDPERDTPEIMNEYVSNV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RI GISG P  +  V K FR+Y   V  ++      Y +DHT ++ L D+AG   G I
Sbjct: 121 SKRITGISGPPDKIAEVIKGFRVYAKKVPVDEKDPNGDYTMDHTASVFLLDSAGRFAGTI 180

Query: 178 PYKDDSDSAIEKINRLITYG 197
            Y ++ D+A++K+  L+  G
Sbjct: 181 AYGENPDTAVKKLENLVNKG 200


>gi|116253029|ref|YP_768867.1| Sco copper chaperone family protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115257677|emb|CAK08775.1| putative Sco copper chaperone family protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 202

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 80/200 (40%), Positives = 114/200 (57%), Gaps = 3/200 (1%)

Query: 1   MKALGIILG---TILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK   I +     IL   LG+       SK V     F     LV+Q+G   +  +L  K
Sbjct: 3   MKTFRIAVWVGVLILAGFLGAFTLNLTKSKDVVAEPPFGVPFTLVSQNGQPITEEALRGK 62

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  +++VDP G  L AYF+TVDP+RDTPE+M ++V   
Sbjct: 63  PTALFFGFTHCPEVCPTTLFELNGWMEKVDPKGDKLQAYFVTVDPERDTPEIMNEYVSNV 122

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RI GISG P  +  V K FR+Y   V  ++      Y +DHT ++ L D+AG   G I
Sbjct: 123 SKRITGISGAPDKIAEVVKGFRVYAKKVPVDEKDPNGDYTMDHTASVFLLDSAGRFSGTI 182

Query: 178 PYKDDSDSAIEKINRLITYG 197
            Y ++ D+A++K+  L++ G
Sbjct: 183 AYGENPDTAVKKLENLVSKG 202


>gi|254780281|ref|YP_003064694.1| cytochrome-c oxidase assembly factor protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039958|gb|ACT56754.1| cytochrome-c oxidase assembly factor protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 201

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 201/201 (100%), Positives = 201/201 (100%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI
Sbjct: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR
Sbjct: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK
Sbjct: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180

Query: 181 DDSDSAIEKINRLITYGNVVK 201
           DDSDSAIEKINRLITYGNVVK
Sbjct: 181 DDSDSAIEKINRLITYGNVVK 201


>gi|190892564|ref|YP_001979106.1| cytochrome c oxidase assembly factor protein [Rhizobium etli CIAT
           652]
 gi|190697843|gb|ACE91928.1| cytochrome c oxidase assembly factor protein [Rhizobium etli CIAT
           652]
          Length = 200

 Score =  157 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 80/200 (40%), Positives = 114/200 (57%), Gaps = 3/200 (1%)

Query: 1   MKALGIILGTILLAV---LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK   I++   +L V   LG+I      S  V     F     L++Q G   +  +L  K
Sbjct: 1   MKTFRIVIWVAVLIVAGVLGAITLYPKKSSDVVAEAPFGVPFTLISQSGQPITEQALRGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  L++VDP G  L AYF+TVDP+RDTPE+M  +V   
Sbjct: 61  PTALFFGFTHCPEVCPTTLFELNGWLEKVDPKGDKLQAYFVTVDPERDTPEIMNAYVSNV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RI GISG P  +  V K FR+Y   V  ++      Y +DHT ++ L D+AG   G I
Sbjct: 121 SKRITGISGSPEKIAEVIKGFRVYAKKVPVDEKDPNGDYTMDHTASVFLLDSAGRFSGTI 180

Query: 178 PYKDDSDSAIEKINRLITYG 197
            Y ++ D+A++K+  L++ G
Sbjct: 181 AYGENPDTAVKKLENLVSKG 200


>gi|15965907|ref|NP_386260.1| putative cytochrome C oxidase assembly factor transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|307308217|ref|ZP_07587926.1| electron transport protein SCO1/SenC [Sinorhizobium meliloti
           BL225C]
 gi|307319684|ref|ZP_07599109.1| electron transport protein SCO1/SenC [Sinorhizobium meliloti AK83]
 gi|15075176|emb|CAC46733.1| Probable electron transport protein SCO1/SenC, cytochrome C oxidase
           [Sinorhizobium meliloti 1021]
 gi|306894615|gb|EFN25376.1| electron transport protein SCO1/SenC [Sinorhizobium meliloti AK83]
 gi|306901215|gb|EFN31821.1| electron transport protein SCO1/SenC [Sinorhizobium meliloti
           BL225C]
          Length = 199

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 75/196 (38%), Positives = 116/196 (59%), Gaps = 3/196 (1%)

Query: 1   MKALGIILGTILLAVLGSIAYVSF---SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK++ I+L   +L ++  + +++F     K    +  F     LVAQ+G   +  +   K
Sbjct: 1   MKSIRIVLWVAILVMVAVLGWLTFDMTQPKQQAASGPFGVPFTLVAQNGEQITEKAFTGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  L +VDP G  L AYFITVDP+RDTPEV+ ++V   
Sbjct: 61  PTALFFGFTHCPEVCPTTLFELNGWLDKVDPEGNKLQAYFITVDPERDTPEVLGQYVSNV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RI GISG P  V+ + K +R+Y   V  +++  +  Y +DHT ++ L D  G   G I
Sbjct: 121 SKRITGISGPPDKVLEMVKGYRVYYKKVPTDEAKPDGDYTMDHTASVFLLDANGQFSGTI 180

Query: 178 PYKDDSDSAIEKINRL 193
            Y ++ ++A++K+  L
Sbjct: 181 AYGENPETAVKKLENL 196


>gi|327194604|gb|EGE61454.1| cytochrome c oxidase assembly factor protein [Rhizobium etli
           CNPAF512]
          Length = 200

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 81/200 (40%), Positives = 114/200 (57%), Gaps = 3/200 (1%)

Query: 1   MKALGIILGTILLAV---LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK   I++   +L V   LG+I      S  V     F     LV+Q G   +  +L  K
Sbjct: 1   MKTFRIVIWVAVLIVAGVLGAITLYPKKSSDVVAEAPFGVPFTLVSQSGQPITEQALRGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  L++VDP G  L AYF+TVDP+RDTPE+M  +V   
Sbjct: 61  PTALFFGFTHCPEVCPTTLFELNGWLEKVDPKGDKLQAYFVTVDPERDTPEIMNAYVSNM 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RI GISG P  +  V K FR+Y   V  ++      Y +DHT ++ L D+AG   G I
Sbjct: 121 SKRITGISGPPEKIAEVIKGFRVYAKKVPVDEKDPNGDYTMDHTASVFLLDSAGRFSGTI 180

Query: 178 PYKDDSDSAIEKINRLITYG 197
            Y ++ D+A++K+  L++ G
Sbjct: 181 AYGENPDTAVKKLENLVSKG 200


>gi|218682389|ref|ZP_03529990.1| electron transport protein SCO1/SenC [Rhizobium etli CIAT 894]
          Length = 200

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 81/200 (40%), Positives = 115/200 (57%), Gaps = 3/200 (1%)

Query: 1   MKALGIILG---TILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK   I +     IL  +LG+I +    S  V     F     LV+Q G   +  +L  K
Sbjct: 1   MKTFRIAVWVGVLILAGILGAIEFFPTKSGDVVAEPPFGVPFTLVSQSGQPITEEALRGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  +++VDP G  L AYF+TVDP+RDTPE+M ++V   
Sbjct: 61  PTALFFGFTHCPEVCPTTLFELNGWMEKVDPKGDKLQAYFVTVDPERDTPEIMNEYVSNV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RIIGISG P  +  V K FR+Y   V  ++      Y +DHT ++ L D+AG   G I
Sbjct: 121 SKRIIGISGPPDKIAEVIKGFRVYAKKVPVDEKDPNGDYTMDHTASVFLLDSAGRFSGTI 180

Query: 178 PYKDDSDSAIEKINRLITYG 197
            Y ++ D+A++K+  L+  G
Sbjct: 181 AYGENPDTAVKKLENLVNKG 200


>gi|86358432|ref|YP_470324.1| cytochrome-c oxidase assembly factor protein [Rhizobium etli CFN
           42]
 gi|86282534|gb|ABC91597.1| cytochrome-c oxidase assembly factor protein [Rhizobium etli CFN
           42]
          Length = 199

 Score =  155 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 82/199 (41%), Positives = 115/199 (57%), Gaps = 2/199 (1%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK--FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           MK   I +   +L + G +  VS+S K   V     F     LV+Q G   +  +L  KP
Sbjct: 1   MKTFRIAVWVGVLILAGVLGAVSYSKKSGDVVAEAPFGVPFTLVSQSGQPITEQALRGKP 60

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS 118
           + +FFGFT+C  VCPTTL  L+  L++VDP GT L AYF+TVDP+RDTPE+M  +V   S
Sbjct: 61  TALFFGFTHCPEVCPTTLFELNGWLEKVDPDGTKLQAYFVTVDPERDTPEIMNAYVSNVS 120

Query: 119 DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
            RI GISG P  +  V K FR+Y   V  ++      Y +DHT ++ L D+AG   G I 
Sbjct: 121 KRITGISGPPEKIADVIKGFRVYAKKVPVDEKDPNGDYTMDHTASVFLLDSAGRFSGTIA 180

Query: 179 YKDDSDSAIEKINRLITYG 197
           Y ++ D+A++K+  L+  G
Sbjct: 181 YGENPDTAVKKLENLVNKG 199


>gi|222086427|ref|YP_002544961.1| cytochrome-c oxidase assembly factor protein [Agrobacterium
           radiobacter K84]
 gi|221723875|gb|ACM27031.1| cytochrome-c oxidase assembly factor protein [Agrobacterium
           radiobacter K84]
          Length = 200

 Score =  155 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 75/200 (37%), Positives = 116/200 (58%), Gaps = 3/200 (1%)

Query: 1   MKALGIILGTILLAVLGSIAYVSF---SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK + I++   +L + G + + +     +        +     L AQ+G   S  +   K
Sbjct: 1   MKTVRIVVWVAVLIMAGVLGWFTIGGSKTPEAAAEGPYGVPFTLTAQNGQPISEQAFRGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFG+T+C  VCPTTL  ++  +++VDP GT L AYF+TVDP+RDTP +M ++V   
Sbjct: 61  PTALFFGYTHCPDVCPTTLFEMNGWMQKVDPDGTKLTAYFVTVDPERDTPAIMNQYVSNV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S+RI GISGDP  VM + K FR+Y   V  ++      Y +DHT ++ L D +G   G I
Sbjct: 121 SNRITGISGDPAKVMDMIKGFRVYAKKVPLDEKDPNGDYTMDHTASVFLLDASGRFAGTI 180

Query: 178 PYKDDSDSAIEKINRLITYG 197
            Y++D+D A++K+  LI  G
Sbjct: 181 AYQEDADIAVKKLENLIKKG 200


>gi|222149110|ref|YP_002550067.1| cytochrome c oxidase assembly factor transmembrane protein
           [Agrobacterium vitis S4]
 gi|221736095|gb|ACM37058.1| cytochrome c oxidase assembly factor transmembrane protein
           [Agrobacterium vitis S4]
          Length = 199

 Score =  154 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 81/198 (40%), Positives = 112/198 (56%), Gaps = 3/198 (1%)

Query: 1   MKALGIILGTILLAVLGSIAYVSF---SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK L I L  ++ A    + Y++     S    G   +     LV Q G   S   L  K
Sbjct: 1   MKRLRIGLWILVAASAALLGYLTLEIGQSSRTVGEAAYGVPFQLVDQRGQAVSEQVLRGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           PS VFFGFT+C  VCPTTL  LD  LKQVDP G  LNAYF++VDP+RDT E++  +V   
Sbjct: 61  PSAVFFGFTHCPEVCPTTLFELDGWLKQVDPQGGHLNAYFVSVDPERDTTEILNTYVSNV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           SDRI GI+G P  VM + K FR+Y   V  +++     Y +DHT ++ L D  G   G I
Sbjct: 121 SDRITGITGAPDKVMEMVKGFRVYAKKVPVDEANPNGDYTMDHTASVFLLDAQGRFKGTI 180

Query: 178 PYKDDSDSAIEKINRLIT 195
            Y ++ ++A++K+ +L+ 
Sbjct: 181 AYGENPETAVQKLQKLMK 198


>gi|227822631|ref|YP_002826603.1| putative electron transport protein [Sinorhizobium fredii NGR234]
 gi|227341632|gb|ACP25850.1| putative electron transport protein [Sinorhizobium fredii NGR234]
          Length = 199

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 76/198 (38%), Positives = 114/198 (57%), Gaps = 3/198 (1%)

Query: 1   MKALGIILGTILL---AVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK++ I L   +L   A+LG + Y    SK       F     LVAQ G   +  +   K
Sbjct: 1   MKSVRIALWAAILVMVALLGWLTYDMTQSKQQASAGPFGVPFTLVAQGGQPITEKAFAGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  L +VDP G  L AYF+TVDP+RDTPE++ ++V   
Sbjct: 61  PTALFFGFTHCPEVCPTTLFELNGWLDKVDPEGKRLQAYFVTVDPERDTPEILGQYVSNV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RI GISG P  V+ + K +R+Y   +  +++  +  Y +DHT ++ L D  G   G I
Sbjct: 121 SKRITGISGPPDKVLEMIKGYRVYYKKIPVDEAKPDGDYTMDHTASVFLLDADGKFSGTI 180

Query: 178 PYKDDSDSAIEKINRLIT 195
            Y ++ ++A++K+  L+ 
Sbjct: 181 SYGENPETAVKKLENLVR 198


>gi|300313437|ref|YP_003777529.1| lipoprotein [Herbaspirillum seropedicae SmR1]
 gi|300076222|gb|ADJ65621.1| lipoprotein [Herbaspirillum seropedicae SmR1]
          Length = 196

 Score =  151 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 55/199 (27%), Positives = 89/199 (44%), Gaps = 7/199 (3%)

Query: 1   MKALGIILGTI----LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           MK     L       LLA  G        +        +  D  L    G   +L+    
Sbjct: 1   MKRFLSALLLAGCATLLAACGPSKPELKFNNTDVTGLDYAKDFALTDHTGKPRTLADFKG 60

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           K  ++FFG+T C  VCPTT+  +  ++K++ P    +   F+TVDP+RDT EV+ ++V  
Sbjct: 61  KVVVMFFGYTQCPDVCPTTMVEMSNVMKELGPDADKVQVLFVTVDPERDTQEVLSQYVPA 120

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F  R +G+ GD     +VAK F+++   V  ++      Y +DHT    +FD  G I   
Sbjct: 121 FDKRFLGLRGDQQQTEKVAKEFKVFYQKVPGKQ---PGSYTMDHTAGSYVFDPQGRIRLF 177

Query: 177 IPYKDDSDSAIEKINRLIT 195
           + +     +    I  L++
Sbjct: 178 VKHGQGPQTLAHDIKLLLS 196


>gi|134096068|ref|YP_001101143.1| SCO1/Sen family protein [Herminiimonas arsenicoxydans]
 gi|133739971|emb|CAL63022.1| putative electron transport protein SCO1/SenC [Herminiimonas
           arsenicoxydans]
          Length = 187

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 55/189 (29%), Positives = 94/189 (49%), Gaps = 4/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           +  + L+     A  +F++  V G   +  D  L   +G   +L+    K  +VFFGFT 
Sbjct: 3   VVVLGLSACSGKAPPAFTNTDVTGLA-YGKDFSLTDHNGKPRTLADFKGKAVVVFFGFTQ 61

Query: 68  CSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGD 127
           C  VCPTT+  +  ++K + P    +   F+TVDP+RDT E++K++V  F  R +G+ GD
Sbjct: 62  CPDVCPTTMLEMANVMKALGPDADKVQVLFVTVDPERDTAELLKQYVPAFDPRFLGLRGD 121

Query: 128 PIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAI 187
             +  + AK F+++   V  +       Y +DHT    +FDT G I   I +   ++  +
Sbjct: 122 LAETEKTAKEFKVFYQKVPGK---TPGSYTIDHTAGSYVFDTQGRIRLFIRHGQGTEPIV 178

Query: 188 EKINRLITY 196
             +  L+  
Sbjct: 179 HDLKILLAE 187


>gi|152981459|ref|YP_001354833.1| SenC family protein [Janthinobacterium sp. Marseille]
 gi|151281536|gb|ABR89946.1| SenC family protein [Janthinobacterium sp. Marseille]
          Length = 198

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 55/200 (27%), Positives = 97/200 (48%), Gaps = 8/200 (4%)

Query: 1   MKALGIILGTILLAVLGSIA----YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           M+   +++    L  L + +     V+F++  + G   +  +  L   +G   +L+    
Sbjct: 1   MRFRSLLVICAALFALTACSDKAKQVAFNNTDLTGLG-YAKEFSLHDHNGKLRTLADFKG 59

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           K  +VFFGFT C  VCPTT+  +  ++K + P    +   F+TVDP+RDT  ++ ++V  
Sbjct: 60  KAVVVFFGFTQCPDVCPTTMMEMSNVMKALGPDADRVQVLFVTVDPERDTAALLAQYVPA 119

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F  R +G+ GD  +  +VAK F+++   V  +       Y VDHT    +FD  G I   
Sbjct: 120 FDPRFLGLRGDLAETEKVAKEFKVFYQKVPGK---TPGSYTVDHTAGSYVFDPQGRIRLF 176

Query: 177 IPYKDDSDSAIEKINRLITY 196
           I +    D  ++ +  L+  
Sbjct: 177 IRHGQGIDPIVQDLKTLLAE 196


>gi|73540030|ref|YP_294550.1| electron transport protein SCO1/SenC [Ralstonia eutropha JMP134]
 gi|72117443|gb|AAZ59706.1| Electron transport protein SCO1/SenC [Ralstonia eutropha JMP134]
          Length = 231

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/175 (28%), Positives = 89/175 (50%), Gaps = 4/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            SF +  + G   F  D  L+  +G   ++S    K  ++FFG+T+C  VCPTT++ L  
Sbjct: 60  ASFRNVDISGGADFGKDFSLIDHNGKVRTISDFKGKVVVMFFGYTHCPDVCPTTMAELKA 119

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGIS-GDPIDVMRVAKNFRI 140
           +++Q+ P    +   F+TVDP+RDT  ++ ++V  F  R +G+   D   + +VAK+F++
Sbjct: 120 VMEQLGPDADKVQVLFVTVDPERDTQALLAQYVPAFDPRFLGMRPADEAALQKVAKDFKV 179

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           Y   V          Y +DH+    +FD  G +   I +    +     I +L++
Sbjct: 180 YYAKVPG---TSPNNYTMDHSAGSYVFDPEGHLRLFIRHGQGPEPIAHDIKQLLS 231


>gi|27376242|ref|NP_767771.1| cytochrome C oxidase assembly factor transmembrane protein
           [Bradyrhizobium japonicum USDA 110]
 gi|27349382|dbj|BAC46396.1| blr1131 [Bradyrhizobium japonicum USDA 110]
          Length = 196

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 90/191 (47%), Gaps = 4/191 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           +       L+  L  + +       V           L  Q+G   +  SL  KP+++FF
Sbjct: 10  IATAFAASLIVGLLIMFWAMGGVGKVAQPAAIGGPFQLTDQNGKAVTDKSLKGKPTLIFF 69

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           G+T+C  VCPT+L  +  +L+ +      +NA FI+VDP+RDTP  MK ++  F   + G
Sbjct: 70  GYTHCPDVCPTSLFEISEVLRAMGKDADKVNAIFISVDPERDTPATMKNYLSSFDPHLEG 129

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           +SGDP ++ +V  ++R+Y   V  +       Y +DHT  + L D  G  V     K   
Sbjct: 130 LSGDPAEIAKVITSYRVYAKKVPTKD----GDYTMDHTALIYLMDRDGRFVSPFNLKRTP 185

Query: 184 DSAIEKINRLI 194
           + A   + R +
Sbjct: 186 EEAAADLKRYL 196


>gi|163797290|ref|ZP_02191243.1| Electron transport protein SCO1/SenC [alpha proteobacterium BAL199]
 gi|159177381|gb|EDP61937.1| Electron transport protein SCO1/SenC [alpha proteobacterium BAL199]
          Length = 197

 Score =  145 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 52/189 (27%), Positives = 85/189 (44%), Gaps = 3/189 (1%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           L + L +  LA      Y+ ++               LV Q G   + ++L  K S+++F
Sbjct: 8   LVVTLLSAALAATVVGGYLIWTRTQEGTAALIGGPFELVDQSGRTVTDATLKGKWSLIYF 67

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           G+T C  VCPT+L+ + + L Q+ P    +   FITVDP+RDT E +  +   F    + 
Sbjct: 68  GYTFCPDVCPTSLTVMTQALDQIGPVADKVVPVFITVDPERDTVEQLAGYHDHFHPSFVM 127

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           ++G P  V  VAK +R+Y      E       Y +DH++   L D  G+ V    +    
Sbjct: 128 LTGTPAQVKEVAKAYRVYYRKAETE---ASTDYLMDHSSITYLMDPNGNYVTHFGHDATP 184

Query: 184 DSAIEKINR 192
           +   + I  
Sbjct: 185 EGMAKTIRE 193


>gi|154250470|ref|YP_001411294.1| Classical-complement-pathway C3/C5 convertase [Parvibaculum
           lavamentivorans DS-1]
 gi|154154420|gb|ABS61637.1| Classical-complement-pathway C3/C5 convertase [Parvibaculum
           lavamentivorans DS-1]
          Length = 203

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 53/198 (26%), Positives = 86/198 (43%), Gaps = 9/198 (4%)

Query: 4   LGIILGTILLAVLGSIA-------YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           + +I+G  +   LG +                  G  R      LV Q G   + +    
Sbjct: 7   IALIVGIFVAIGLGLLISEVAIDMAEGEKPVASSGEARVGGPFTLVDQTGKTVTEADFRG 66

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           +  +++FGFT C  VCPT L+ +   L  +      +   FITVDP+RDTPEVM ++V  
Sbjct: 67  RYMLIYFGFTFCPDVCPTELAIMAAALDALGDDAEKVQPIFITVDPERDTPEVMARYVPL 126

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F  R+IG++G P  +  VA  + ++     AE     + Y +DH++ + L    G  + +
Sbjct: 127 FHPRLIGLTGSPEQIAEVANAYHVFYRK--AEDESSSQDYTMDHSSIVFLMGPDGEYLKL 184

Query: 177 IPYKDDSDSAIEKINRLI 194
            P     +     I   I
Sbjct: 185 FPPATAPEKMAADIASHI 202


>gi|288957583|ref|YP_003447924.1| copper chaperone SCO1 [Azospirillum sp. B510]
 gi|288909891|dbj|BAI71380.1| copper chaperone SCO1 [Azospirillum sp. B510]
          Length = 204

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 56/204 (27%), Positives = 89/204 (43%), Gaps = 10/204 (4%)

Query: 1   MKA--LGIILGTIL-LAVLGSIAYVSFSSKFVDGNR------RFNSDVHLVAQDGTDFSL 51
           MK   L I   ++L +AV   IA+    S                    L  Q G   + 
Sbjct: 1   MKTRFLRIAAASVLAIAVSAGIAWWQVRSATGTVESGTKSAVPIGGPFTLSNQLGKLVTD 60

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
                K  +++FG+T C  VCPT L  + + L Q+ P    +   FIT+DP RDT   MK
Sbjct: 61  VDFRGKYMLIYFGYTYCPDVCPTELGVMAQALDQLGPKAEQIQPVFITIDPDRDTVAHMK 120

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            +V  F  R++G++G    V   A+ +R+Y      +     ++Y +DH++ + L    G
Sbjct: 121 DYVALFHPRLVGLTGTAEQVRDAARAYRVYYAKAPQKD-AKPDEYLMDHSSFIYLMGPDG 179

Query: 172 SIVGVIPYKDDSDSAIEKINRLIT 195
             VGV P    +D   + ++  I 
Sbjct: 180 KFVGVYPGGTAADKIAQDLSARIA 203


>gi|145590109|ref|YP_001156706.1| electron transport protein SCO1/SenC [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145048515|gb|ABP35142.1| electron transport protein SCO1/SenC [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 196

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/189 (26%), Positives = 87/189 (46%), Gaps = 4/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           +  I   +        F +  + G+  F  D  L+  DG   +L+    K  ++FFG+T 
Sbjct: 11  VAIICCVLAACSPKPEFKNIDITGSTSFGKDFSLLDPDGNVRTLADFKGKVVVMFFGYTQ 70

Query: 68  CSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISG 126
           C  VCPTTL+ + +++  + P    +   F+TVDP+RDT  ++K++V  F  R +G    
Sbjct: 71  CPDVCPTTLTEMQQVMTLLGPQSDKVQVLFVTVDPERDTAAILKQYVPSFDPRFLGLRPA 130

Query: 127 DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSA 186
           D   + +V K+F+IY   V          Y +DHT     FD  G +   I +    ++ 
Sbjct: 131 DDAALEKVTKDFKIYYKKVPG---STPGSYTMDHTAGSYAFDPEGRLRLYIKHAQGPETL 187

Query: 187 IEKINRLIT 195
              +  L+ 
Sbjct: 188 AHDLKELLK 196


>gi|188591090|ref|YP_001795690.1| cytochrome C oxidase assembly factor, scoc [Cupriavidus taiwanensis
           LMG 19424]
 gi|170937984|emb|CAP62968.1| putative cytochrome c oxidase assembly factor, scoC [Cupriavidus
           taiwanensis LMG 19424]
          Length = 206

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 47/175 (26%), Positives = 86/175 (49%), Gaps = 4/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            SF +  + G   F  D  L    G   +L+    K  ++FFG+T+C  VCPTT++ L  
Sbjct: 35  ASFRNVDITGAADFGKDFSLTDHTGKVRTLADYKGKAVVMFFGYTHCPDVCPTTMAELKA 94

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           +++++ P    +   F+TVDP+RDT  ++ ++V  F  R +G    D   + ++AK+F++
Sbjct: 95  VMEKLGPDADRVQVLFVTVDPERDTQALLAQYVPAFDPRFVGLRPADEASLQKLAKDFKV 154

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           +   V          Y VDH+    +FD  G +   I +    +     + +L++
Sbjct: 155 FYAKVPG---SSPNNYTVDHSAGSYVFDPNGKLRLFIRHGQGPEPIAHDLKQLLS 206


>gi|163760764|ref|ZP_02167844.1| putative cytochrome c oxidase assembly factor transmembrane protein
           [Hoeflea phototrophica DFL-43]
 gi|162282086|gb|EDQ32377.1| putative cytochrome c oxidase assembly factor transmembrane protein
           [Hoeflea phototrophica DFL-43]
          Length = 199

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 72/198 (36%), Positives = 111/198 (56%), Gaps = 3/198 (1%)

Query: 1   MKALG---IILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MKA      +L  I+   LG + Y    ++     + +     LV Q G   + ++   +
Sbjct: 1   MKAFRTVLWVLIAIMAVALGWLTYEWQRTENAIAGKPYGVPFELVDQTGGPITEAAFRGR 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  +CPTTL  LD  L+QVDP G  + AYF+TVDP+RDTP+++ ++V   
Sbjct: 61  PTALFFGFTHCPEICPTTLFELDGWLRQVDPEGGRIGAYFVTVDPERDTPDLLGEYVSGV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           +DR+IGISG+P D+  V K F +Y   V  +    +  Y +DHT ++ L D  G   G I
Sbjct: 121 TDRVIGISGEPDDISGVVKGFNVYAKKVPLDAGDPDGDYTMDHTASVFLLDAEGRFKGTI 180

Query: 178 PYKDDSDSAIEKINRLIT 195
            + ++ D A+ K+  LI 
Sbjct: 181 AWGENPDIAVRKLENLIK 198


>gi|171464210|ref|YP_001798323.1| electron transport protein SCO1/SenC [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193748|gb|ACB44709.1| electron transport protein SCO1/SenC [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 194

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/197 (28%), Positives = 94/197 (47%), Gaps = 5/197 (2%)

Query: 1   MKALGIILGTILLAVLGSIAY-VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           M  L I    IL  VL + +    F +  + G+  F  D  L+  D    +L+    K  
Sbjct: 1   MNLLRICFLAILCFVLTACSPKPKFKNIDITGSTAFGKDFSLLDSDDKVRTLTDFKGKVV 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           ++FFG+T C  +CPTTL+ + +++  + P    +   F+TVDP+RDT E++K++V  F  
Sbjct: 61  VMFFGYTQCPDICPTTLTEMQQVMALLGPQSDKVQVLFVTVDPERDTAEILKQYVPAFDP 120

Query: 120 RIIG-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
           R +G    D   + +V K+F+IY   V   K      Y +DHT     FD  G +   + 
Sbjct: 121 RFLGLRPADEAGLEKVTKDFKIYYKKVPGTK---PGSYTMDHTAGSYAFDPEGRLRLYVK 177

Query: 179 YKDDSDSAIEKINRLIT 195
           +    ++    +  L+ 
Sbjct: 178 HAQGPETLAHDLKELLK 194


>gi|13471531|ref|NP_103097.1| inner mitochondrial membrane protein Sco1p [Mesorhizobium loti
           MAFF303099]
 gi|14022273|dbj|BAB48883.1| inner mitochondrial membrane protein; Sco1p [Mesorhizobium loti
           MAFF303099]
          Length = 245

 Score =  143 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 75/197 (38%), Positives = 113/197 (57%), Gaps = 6/197 (3%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           M+++ + +  ++ A +G + +  +   +  G   F +   LV Q G   + ++   +PS+
Sbjct: 55  MRSILVGILVLMAAGIGWLTFDWYRGHY--GGEPFGAPFTLVDQKGAPITEAAFRGQPSV 112

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  L   LK +   G  L+AYF++VDP+RDTP VM  +V  FSDR
Sbjct: 113 VFFGFTHCPEVCPTTLFELSGWLKTLGDDGKTLHAYFVSVDPERDTPAVMNAYVSNFSDR 172

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I GI+GDP  V  +AK+F IY   V          Y +DHT ++LL ++ G   G I Y 
Sbjct: 173 ITGITGDPDKVHAMAKSFGIYWKKVDTGD----GDYTMDHTASVLLLNSKGDFAGTIAYG 228

Query: 181 DDSDSAIEKINRLITYG 197
           + + +A+EK+ RL   G
Sbjct: 229 ESASAAVEKLKRLAAKG 245


>gi|110634342|ref|YP_674550.1| electron transport protein SCO1/SenC [Mesorhizobium sp. BNC1]
 gi|110285326|gb|ABG63385.1| electron transport protein SCO1/SenC [Chelativorans sp. BNC1]
          Length = 220

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 73/197 (37%), Positives = 116/197 (58%), Gaps = 6/197 (3%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           M+ + + +  +     G+IA+  +S +  +    F +   L+  +G   +  +L  +P+ 
Sbjct: 30  MRYILVGIILLTAGAFGAIAFNFYSGQ--NQAVAFGAPFELIDHEGQPITEKALQGRPTA 87

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFGFT+C  VCPTTL  +   L Q+   G  L A+F+TVDP+RDTPEVMK ++  FSDR
Sbjct: 88  LFFGFTHCPDVCPTTLFEMQGWLDQLGDEGKDLQAFFVTVDPERDTPEVMKTYLSNFSDR 147

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           ++GI+GDP  V  + K +RIY   V  E       Y +DHT +++L D++G   G I Y+
Sbjct: 148 VVGITGDPQKVEEMVKAYRIYFRKVELE----GGGYTMDHTASVMLLDSSGDFFGTISYE 203

Query: 181 DDSDSAIEKINRLITYG 197
           ++ ++AI K+ RLI  G
Sbjct: 204 ENQETAIAKLRRLIREG 220


>gi|312113036|ref|YP_004010632.1| electron transporter SCO1/SenC [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218165|gb|ADP69533.1| electron transport protein SCO1/SenC [Rhodomicrobium vannielii ATCC
           17100]
          Length = 208

 Score =  141 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 63/201 (31%), Positives = 95/201 (47%), Gaps = 9/201 (4%)

Query: 1   MKA---LGIILGTILLAVLGSIAYVSFSSKFVDGNRR-FNSDVHLVAQDGTDFSLSSLYI 56
           MK    + I L  +  A     A   FS+      +        LV  +G   + +    
Sbjct: 1   MKRKSVIVIALAFLCAAGAALYAISHFSNAGSTATKPLIGGAFSLVDTNGKRVTDADFRG 60

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           K  +VFFG+T+C  VCPT L +   +L ++ P    +   FI+VDP RDTP VMK +V+ 
Sbjct: 61  KLMLVFFGYTHCPDVCPTGLQQAADVLAKLGPDAGDVVPVFISVDPARDTPPVMKSYVEN 120

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F  RI+G++GDP +V   AK +R+Y        SG  E Y VDH+  + L D  G  +  
Sbjct: 121 FDPRIVGLTGDPAEVASAAKAYRVYFRK-----SGSGEDYSVDHSAFVYLMDRHGKFITN 175

Query: 177 IPYKDDSDSAIEKINRLITYG 197
             +    D  + ++ + I  G
Sbjct: 176 FMFNAPIDVMVGELKKQIAAG 196


>gi|113866383|ref|YP_724872.1| Sco1/SenC family cytochrome oxidase assembly protein [Ralstonia
           eutropha H16]
 gi|113525159|emb|CAJ91504.1| cytochrome oxidase assembly protein, Sco1/SenC family [Ralstonia
           eutropha H16]
          Length = 206

 Score =  141 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 85/175 (48%), Gaps = 4/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            SF +  + G   F  D  L    G   +++    K  ++FFG+T+C  VCPTT++ L  
Sbjct: 35  ASFRNVDITGAADFGKDFSLTDHHGKVRTIADFKGKAVVMFFGYTHCPDVCPTTMAELKA 94

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           +++++ P    +   F+TVDP+RDT  ++ ++V  F  R +G    D   + ++ K+F++
Sbjct: 95  VMEKLGPDADRVQVLFVTVDPERDTQALLAQYVPAFDARFLGLRPADEAALQKLTKDFKV 154

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           +   V          Y VDH+    +FD  G +   I +    D     + +L++
Sbjct: 155 FYAKVPG---SSPNNYTVDHSAGSYVFDPDGKLRLFIRHGQGPDPIAHDLKQLLS 206


>gi|146343515|ref|YP_001208563.1| putative electron transport protein (SCO1/SenC/PrrC-like)
           [Bradyrhizobium sp. ORS278]
 gi|146196321|emb|CAL80348.1| putative Electron transport protein (SCO1/SenC/PrrC-like)
           [Bradyrhizobium sp. ORS278]
          Length = 197

 Score =  141 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 57/195 (29%), Positives = 93/195 (47%), Gaps = 6/195 (3%)

Query: 2   KALGII--LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           + L I+      L+  L  +  V    + +           L  Q G   +  SL  +P+
Sbjct: 7   RPLVIVGAFAASLVVGLSLMFLVMGGGRNIAAPAAIGGPFQLTDQTGAVVTEKSLEGRPT 66

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           ++FFGFT+C  VCPT+L  +  +L+ +   G  +NAYFI+VDP+RD P  MK ++  F  
Sbjct: 67  LIFFGFTHCPDVCPTSLFEISEVLRAMGKDGDGVNAYFISVDPERDNPATMKDYLSSFDP 126

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
           R+ G++GDP  + +V   +R+Y   V  +       Y +DHT  + L D  G  V     
Sbjct: 127 RLKGLTGDPEVLAKVLTEYRVYAKKVPLKD----GDYTMDHTALVYLMDRNGRFVAPFNL 182

Query: 180 KDDSDSAIEKINRLI 194
           K   + A   + + +
Sbjct: 183 KRTPEEAAADLKKYL 197


>gi|298290579|ref|YP_003692518.1| electron transporter SCO1/SenC [Starkeya novella DSM 506]
 gi|296927090|gb|ADH87899.1| electron transport protein SCO1/SenC [Starkeya novella DSM 506]
          Length = 196

 Score =  141 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 95/197 (48%), Gaps = 8/197 (4%)

Query: 2   KALGIILGTILL----AVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           + + ++L   ++     V G++A +  +   V G         LV QDG   +  S   +
Sbjct: 4   RRILLLLAAFVVGAVAIVGGALALLPQAPTTVSGQVAIGGPFELVDQDGQKVTQESFVGE 63

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P++VFFGFT+C  +CPTTL  + +L + + P    +   F+TVDP+RDTPE MK ++  F
Sbjct: 64  PTLVFFGFTHCPDICPTTLFEMSQLFEALGPDARKVTGLFVTVDPERDTPESMKSYLGSF 123

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
              I G++G P  V  V K +R Y   V  +       Y +DHT  + L    G+ +   
Sbjct: 124 HPSIQGLTGTPEQVAAVIKAYRAYAKKVPTQD----GDYTMDHTAIVYLMGKDGAFIAPF 179

Query: 178 PYKDDSDSAIEKINRLI 194
             K     A  ++ R +
Sbjct: 180 NLKRPPADAAAELRRYL 196


>gi|323137116|ref|ZP_08072195.1| electron transport protein SCO1/SenC [Methylocystis sp. ATCC 49242]
 gi|322397474|gb|EFX99996.1| electron transport protein SCO1/SenC [Methylocystis sp. ATCC 49242]
          Length = 215

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 88/193 (45%), Gaps = 5/193 (2%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K L I  G +   +  +    + +               L A +G   S   L  +P +V
Sbjct: 28  KNLLIGAGAVFALIFAAFVAFTSNKPAAPPPSSIGGPFQLTAHNGQQVSERDLLGRPFLV 87

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFG+T+C  +C TTL  +  +L+ + P   +    F+TVDP+RDTPEV+K ++  F  RI
Sbjct: 88  FFGYTHCPDICHTTLFEMSEILRAMGPDAKVGA-LFVTVDPERDTPEVLKDYLSNFDPRI 146

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           IG++G    +  + + +RIY      +     E Y VDHTT + L D  G  V       
Sbjct: 147 IGLTGPHAQLDPMLREYRIYSKRAPGKD----EDYSVDHTTVVYLMDKEGRFVSAFNVGR 202

Query: 182 DSDSAIEKINRLI 194
               A   +++ +
Sbjct: 203 KPADAARDLSKYL 215


>gi|144897168|emb|CAM74032.1| SCO1/SenC family protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 194

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 53/195 (27%), Positives = 82/195 (42%), Gaps = 4/195 (2%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K   +     +LAV+G            DG+        L   +G   +  S   +  ++
Sbjct: 3   KKSSMWALIAVLAVIGIAVGSRLLVWSGDGHAAIGGPFTLTDHNGRTVTEKSFAGRFMLI 62

Query: 62  FFGFTNCSAVCPTTLSRLDRLLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FG+T C  VCPT L      L          L   FITVDP+RDT  VMK +V  F+  
Sbjct: 63  YFGYTYCPDVCPTALGVTSVALDGLASAERAKLVPVFITVDPERDTAAVMKDYVTAFAPD 122

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           ++G+ G P       K F++Y       K G  E Y VDH++ L L    G  +   P+ 
Sbjct: 123 MVGLMGTPEQTNAAKKAFKVYAEK---AKGGDGENYTVDHSSILYLMGPDGRFIQHFPHG 179

Query: 181 DDSDSAIEKINRLIT 195
            ++D  +  + + + 
Sbjct: 180 TNADELLAGLKKHLK 194


>gi|34496063|ref|NP_900278.1| hypothetical protein CV_0608 [Chromobacterium violaceum ATCC 12472]
 gi|34101917|gb|AAQ58284.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 192

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 55/194 (28%), Positives = 89/194 (45%), Gaps = 4/194 (2%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           + L  +LG  ++ VL + A           +     +  L    G   +L     K   +
Sbjct: 3   RFLKRLLGLFIVLVLSACAQKIDFKGTAIEDASMGGNFKLTDFHGQPRALDEFRGKVVAL 62

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFG+T+C  VCPTT+     ++KQ+   G  +   F++VDP+RDTP+V+  +V  F  R 
Sbjct: 63  FFGYTSCPDVCPTTMLEYASVMKQLGADGDKVQVLFVSVDPERDTPQVLAGYVPHFDKRF 122

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           IG++G   D+ +V K +++    V  E    E  Y VDH+    L D  G +     Y  
Sbjct: 123 IGLTGGAADIEKVMKQYKVVAQKVKNE----EGGYTVDHSAGSYLLDKEGKLRVYEAYGT 178

Query: 182 DSDSAIEKINRLIT 195
            S +    I +L+ 
Sbjct: 179 PSANLASDIRQLLR 192


>gi|218463250|ref|ZP_03503341.1| putative Sco copper chaperone family protein [Rhizobium etli Kim 5]
          Length = 178

 Score =  140 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 75/173 (43%), Positives = 105/173 (60%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           +SK V     +     LV+Q G   +  +L  KP+ +FFGFT+C  VCPTTL  L+  ++
Sbjct: 6   TSKDVVAEAPYGVPFTLVSQSGQPITEQALRGKPTALFFGFTHCPEVCPTTLYELNGWME 65

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
           +VDP GT L AYF+TVDP+RDTPEV+ ++V   S RIIGISG P  V  V K FRIY   
Sbjct: 66  KVDPDGTKLQAYFVTVDPERDTPEVINQYVSNVSKRIIGISGPPDKVTEVIKGFRIYAKK 125

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
           V  +       Y +DH  ++ L D+AG   G I Y ++ D+A++K+  L++ G
Sbjct: 126 VPVDDKDPNGDYTMDHYASVFLLDSAGRFAGTIAYGENPDTAVKKLENLVSKG 178


>gi|167648607|ref|YP_001686270.1| electron transport protein SCO1/SenC [Caulobacter sp. K31]
 gi|167351037|gb|ABZ73772.1| electron transport protein SCO1/SenC [Caulobacter sp. K31]
          Length = 197

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 59/196 (30%), Positives = 85/196 (43%), Gaps = 7/196 (3%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           + + I+ G   + +   + Y S                 LV Q+G   + + L  + + V
Sbjct: 5   RMIAILAGVAAVLLACGLVYTSGVFNRQPQPSLVGGPFQLVDQNGKPTTEAVLKGQWNAV 64

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFV--QRFSD 119
           FFGFT C  VCP TL  L     Q+ P    L   FI+VDP RD P+ +K F+       
Sbjct: 65  FFGFTYCPDVCPGTLQALAAASDQLGPKAKDLQIVFISVDPGRDNPQQVKAFLSGDNLPK 124

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
            I+G++G P  V   AK +R+Y   V     G    Y VDH+TA+ L D  G    VI Y
Sbjct: 125 NIVGLTGTPQQVAAAAKAYRVYYKAV-----GDGPGYSVDHSTAVYLMDPKGRFDKVIAY 179

Query: 180 KDDSDSAIEKINRLIT 195
               +    +I   + 
Sbjct: 180 NLPPEEIARQIKDAMA 195


>gi|148252370|ref|YP_001236955.1| putative electron transport protein [Bradyrhizobium sp. BTAi1]
 gi|146404543|gb|ABQ33049.1| putative electron transport protein [Bradyrhizobium sp. BTAi1]
          Length = 197

 Score =  140 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/195 (27%), Positives = 91/195 (46%), Gaps = 6/195 (3%)

Query: 2   KALGII--LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           + L I+      L+  L  +  +    + +           L  Q G   +  SL  +P+
Sbjct: 7   RPLVIVGAFAASLVVGLSLMFLIMGGGRNIAAPAAIGGPFQLTDQSGAVVTEQSLQGRPT 66

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           ++FFGFT+C  VCPT+L  +  +L+ +      +NAYFI+VDP+RD P  MK ++  F  
Sbjct: 67  LIFFGFTHCPDVCPTSLFEISEVLRAMGKDADSVNAYFISVDPERDNPATMKDYLSSFDP 126

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
            + G++GDP  + +V   +R+Y   V  +       Y +DHT  + L D  G  V     
Sbjct: 127 HLKGLTGDPEVLAKVLTEYRVYAKKVPLKD----GDYTMDHTALVYLMDRNGRFVAPFNL 182

Query: 180 KDDSDSAIEKINRLI 194
           K   + A   + + +
Sbjct: 183 KRTPEEAAADLKKYL 197


>gi|332040453|gb|EGI76829.1| electron transport protein sco1/senc [Hylemonella gracilis ATCC
           19624]
          Length = 197

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 53/200 (26%), Positives = 89/200 (44%), Gaps = 8/200 (4%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK L  +LG +L+    S    +  +        +     L   DG   +L+    K   
Sbjct: 1   MKKLLCVLGAVLILGACSEGKQAQFNAIDITGADYAKGFALTDHDGQPRTLADFKGKVVA 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQ----VDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           +FFG+T C  VCPTT++ +  + +         G  L   F+TVDP+RDTP +MK ++  
Sbjct: 61  MFFGYTQCPDVCPTTMTEMVAVKQALSAGGRADGDKLQVLFVTVDPERDTPAIMKNYMAA 120

Query: 117 FSDRIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
           F    + +    P  +  +AK++++Y   V  +       Y +DH+  L L+DT G +  
Sbjct: 121 FDPAFLALYASSPEQLAALAKDYKVYYKKVDGK---APGSYTMDHSAGLYLYDTQGRLRL 177

Query: 176 VIPYKDDSDSAIEKINRLIT 195
              Y    +S    I +L+ 
Sbjct: 178 YARYGSSVESLTADIRQLLK 197


>gi|241661868|ref|YP_002980228.1| electron transport protein SCO1/SenC [Ralstonia pickettii 12D]
 gi|240863895|gb|ACS61556.1| electron transport protein SCO1/SenC [Ralstonia pickettii 12D]
          Length = 203

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/175 (26%), Positives = 88/175 (50%), Gaps = 4/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G++ F +D  L    G   +L     K  ++FFG+T+C  VCPTTL+ L  
Sbjct: 31  PAFKNLDITGSKSFGTDFSLTDHTGKRRTLEDFRGKVVVMFFGYTHCPDVCPTTLAELRA 90

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           ++  +      +   F+TVDP+RDT +++ K+V  F  R IG    +  ++ +VA +F++
Sbjct: 91  VMDTLGKDADRVQVLFVTVDPERDTQDLLAKYVPAFDPRFIGLRPANEAELKKVASDFKV 150

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           + + V        + Y +DH+    +FD  G++   I +    +     I +L+ 
Sbjct: 151 FYSKVPG---SSPDNYTMDHSAGSYMFDPKGNLRLFIKHGQGPEPIAHDIKQLLA 202


>gi|115522765|ref|YP_779676.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           BisA53]
 gi|115516712|gb|ABJ04696.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           BisA53]
          Length = 197

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 56/195 (28%), Positives = 92/195 (47%), Gaps = 6/195 (3%)

Query: 2   KALGIILGTI--LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           + L I       L   L  + ++    + +           L  Q+G   +  SL  KP+
Sbjct: 7   RPLVIFAAFAGSLAIGLVVVMWLLGGLQNITPPSAIGGPFRLSDQNGQIVTEQSLKGKPT 66

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           ++FFGFT C  VCPT L  +  +L+ +      +N YF++VDP+RDT ++MK+++  F  
Sbjct: 67  LIFFGFTRCPDVCPTALFEISEVLRAMGKDADRINTYFVSVDPERDTAQLMKEYLSSFDP 126

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
            + G+SGDP  + +V  N+R+Y   V  +       Y +DHT  + L D  G  V     
Sbjct: 127 HLKGLSGDPESIAKVLVNYRVYARKVPLKD----GDYTMDHTALVYLMDRDGRFVAPFNI 182

Query: 180 KDDSDSAIEKINRLI 194
           K   + A   + R +
Sbjct: 183 KRKPEEAAADLKRYL 197


>gi|156742928|ref|YP_001433057.1| electron transport protein SCO1/SenC [Roseiflexus castenholzii DSM
           13941]
 gi|156234256|gb|ABU59039.1| electron transport protein SCO1/SenC [Roseiflexus castenholzii DSM
           13941]
          Length = 197

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 52/198 (26%), Positives = 87/198 (43%), Gaps = 4/198 (2%)

Query: 1   MKA-LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           M+  L + L      ++ +     F    +D   +   D  L   DG  F LS    K  
Sbjct: 1   MRRSLRMALLIAFAIIVSACGRYEFRGVTLDP-PKEAPDFTLTDFDGKPFHLSDHRGKVV 59

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           I+FFGFTNC  +CP  LS +    +++      +   F+++DP RDTPE +K++V  F  
Sbjct: 60  ILFFGFTNCPDMCPAALSDMAAARRKLGADAEKVQGVFVSLDPDRDTPERLKRYVTAFDP 119

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
             IG+ G   ++    K++ +       E  G    Y +DH+T + + D AG    +  +
Sbjct: 120 TFIGVRGSETELAPAVKDYGVTYMR--RELPGSALGYTIDHSTFIYVIDAAGRWRLLFTH 177

Query: 180 KDDSDSAIEKINRLITYG 197
               D  +  +  L+  G
Sbjct: 178 GMPVDDIVSDLRYLVRRG 195


>gi|296137014|ref|YP_003644256.1| electron transport protein SCO1/SenC [Thiomonas intermedia K12]
 gi|295797136|gb|ADG31926.1| electron transport protein SCO1/SenC [Thiomonas intermedia K12]
          Length = 204

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 46/194 (23%), Positives = 84/194 (43%), Gaps = 9/194 (4%)

Query: 6   IILGTIL-----LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           ++L         L +        F    + G   +     L   +G   +L+    K  +
Sbjct: 12  LVLSAAFAPLAPLVLAACSKPYVFHGVDITGVP-YADGFSLTDFNGKTRTLADFAGKVVV 70

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           ++FG+T C  +CP ++  + + +  +      +   F+TVDP+RDTPE++K +V  F+  
Sbjct: 71  MYFGYTQCPDICPASMQVVAQAMDDLGEKARDVQFLFVTVDPERDTPEILKAYVTHFNPT 130

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
            + ++G P  +   AK+F++Y   V  +       Y +DHT    +FD  G I       
Sbjct: 131 FLALTGTPAQIALTAKDFKVYYKKVPGK---TPGSYTMDHTAGFYVFDPKGKIRLFEREG 187

Query: 181 DDSDSAIEKINRLI 194
             +    + IN LI
Sbjct: 188 VSAKDLAQDINALI 201


>gi|209883815|ref|YP_002287672.1| electron transport protein SCO1/SenC [Oligotropha carboxidovorans
           OM5]
 gi|209872011|gb|ACI91807.1| electron transport protein SCO1/SenC [Oligotropha carboxidovorans
           OM5]
          Length = 228

 Score =  138 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 58/188 (30%), Positives = 91/188 (48%), Gaps = 4/188 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
                L   L ++ ++    +             L  Q G   +  SL  +PS+VFFGFT
Sbjct: 45  AFTVSLAIGLMAVLFLMGGFRTNTPVSTVGGAFELTDQAGKTVTEKSLKGRPSLVFFGFT 104

Query: 67  NCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISG 126
           +C  +CPT+L  +  +L+ + P  T +NAYF++VDP+RDTP VMK ++Q F   + G++G
Sbjct: 105 HCPDICPTSLFEISEVLRAMGPDATKVNAYFVSVDPERDTPAVMKDYLQSFDPNLKGLTG 164

Query: 127 DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSA 186
            P  V ++   +R+Y   V  +       Y +DHT A+ L D  G  V     K     A
Sbjct: 165 SPEAVAKMLSAYRVYAKKVPLKD----GSYTMDHTAAVYLLDRDGRFVAPFNLKQTPQQA 220

Query: 187 IEKINRLI 194
              + R +
Sbjct: 221 ATDLKRYL 228


>gi|187927336|ref|YP_001897823.1| electron transport protein SCO1/SenC [Ralstonia pickettii 12J]
 gi|309779963|ref|ZP_07674717.1| SCO1/SenC family protein [Ralstonia sp. 5_7_47FAA]
 gi|187724226|gb|ACD25391.1| electron transport protein SCO1/SenC [Ralstonia pickettii 12J]
 gi|308921322|gb|EFP66965.1| SCO1/SenC family protein [Ralstonia sp. 5_7_47FAA]
          Length = 203

 Score =  138 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 48/175 (27%), Positives = 88/175 (50%), Gaps = 4/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G++ F +D  L    G   +L     K  ++FFG+T+C  VCPTTL+ L  
Sbjct: 31  PAFKNLDITGSKSFGTDFSLTDHTGKRRTLEDFRGKVVVMFFGYTHCPDVCPTTLAELRA 90

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           ++  +      +   F+TVDP+RDT +++ K+V  F  R IG    +  ++ +VA +F++
Sbjct: 91  VMDTLGKDADRVQVLFVTVDPERDTQDLLAKYVPAFDPRFIGLRPANETELKKVASDFKV 150

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           + + V        + Y +DHT    +FD  G++   I +    +     I +L+ 
Sbjct: 151 FYSKVPG---SSPDNYTMDHTAGSYMFDPKGNLRLFIKHGQGPEPIAHDIKQLLA 202


>gi|294341191|emb|CAZ89592.1| putative Electron transport protein SCO1/SenC [Thiomonas sp. 3As]
          Length = 204

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 46/194 (23%), Positives = 84/194 (43%), Gaps = 9/194 (4%)

Query: 6   IILGTIL-----LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           ++L         L +        F    + G   +     L   +G   +L+    K  +
Sbjct: 12  LVLSAAFAPLASLVLTACSKPYVFHGVDITGVP-YADGFSLTDFNGKTRTLADFAGKVVV 70

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           ++FG+T C  +CP ++  + + +  +      +   F+TVDP+RDTPE++K +V  F+  
Sbjct: 71  MYFGYTQCPDICPASMQVVAQAMDDLGEKARDVQFLFVTVDPERDTPEILKAYVTHFNPT 130

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
            + ++G P  +   AK+F++Y   V  +       Y +DHT    +FD  G I       
Sbjct: 131 FLALTGTPAQIALTAKDFKVYYKKVPGK---TPGSYTMDHTAGFYVFDPKGKIRLFEREG 187

Query: 181 DDSDSAIEKINRLI 194
             +    + IN LI
Sbjct: 188 VSAKDLAQDINALI 201


>gi|75674343|ref|YP_316764.1| electron transport protein SCO1/SenC [Nitrobacter winogradskyi
           Nb-255]
 gi|74419213|gb|ABA03412.1| Electron transport protein SCO1/SenC [Nitrobacter winogradskyi
           Nb-255]
          Length = 197

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 57/195 (29%), Positives = 93/195 (47%), Gaps = 6/195 (3%)

Query: 2   KALGIILGTI--LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           + L ++      L+  L  + ++                  L  Q G   +   +  +P+
Sbjct: 7   RPLILVAAFAGSLVVGLTVVMWLLGGLASKPTAASIGGPFQLTDQTGQTVTEKDMVGRPT 66

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           IVFFG+T+C  VCPT+L  +  +L+ + P    +NAYFITVDP+RDT E MK ++  F  
Sbjct: 67  IVFFGYTHCPDVCPTSLFEMSEVLRAMGPDADRVNAYFITVDPERDTQETMKSYLSSFDP 126

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
           R+ G++GDP  V +    FR+Y   +  +       Y +DHT  + L D  G  V     
Sbjct: 127 RLKGLTGDPAAVEKALSGFRVYAKKIPLKD----GGYSMDHTALIYLMDRDGRFVSSFDL 182

Query: 180 KDDSDSAIEKINRLI 194
           K  +++A   + R +
Sbjct: 183 KRSAEAAAADLRRYL 197


>gi|299134034|ref|ZP_07027227.1| electron transport protein SCO1/SenC [Afipia sp. 1NLS2]
 gi|298590781|gb|EFI50983.1| electron transport protein SCO1/SenC [Afipia sp. 1NLS2]
          Length = 197

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 89/186 (47%), Gaps = 4/186 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
                L   L  + ++    +             L  Q G   +  +L  KP+++FFGFT
Sbjct: 14  AFAISLAIGLMGVLFLVGGFRSSTPVSSIGGPFQLTDQTGATVTEKNLQGKPTLMFFGFT 73

Query: 67  NCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISG 126
           +C  +CPT+L  +  +L+ + P    +NAYF++VDP+RDTP VMK ++Q F   + G+SG
Sbjct: 74  HCPDICPTSLFEISEILRAMGPDAGRINAYFVSVDPERDTPAVMKDYLQSFDPHLKGLSG 133

Query: 127 DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSA 186
            P  + ++ K +R+Y   V  +       Y +DHT A+ L D  G  V     K     A
Sbjct: 134 SPEAIAKMIKAYRVYAKKVPLKD----GDYTMDHTAAVYLLDREGRFVVPFNLKQTPQQA 189

Query: 187 IEKINR 192
              + R
Sbjct: 190 ATDLKR 195


>gi|209966762|ref|YP_002299677.1| Sco1 [Rhodospirillum centenum SW]
 gi|209960228|gb|ACJ00865.1| Sco1 [Rhodospirillum centenum SW]
          Length = 211

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/201 (26%), Positives = 86/201 (42%), Gaps = 11/201 (5%)

Query: 3   ALGIILGTILLAVLGSI--------AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
           A+GI+ G IL A++           A    +            D  LV + G + + +  
Sbjct: 10  AIGILAGLILAALVAFWTVRQDAGRAGGVPAGAIATPGVTIGGDFRLVDETGREVTSADY 69

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
             K  ++FFGFT C  +CPT L  + R L  + P    +   F+++DP+RD P  + ++ 
Sbjct: 70  AGKYRLIFFGFTFCPDICPTELQLIARALDALGPDAAAVQPLFVSIDPERDGPAQLAEYT 129

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F   I+G++G P  V   A+ FR+Y     A        Y +DH+T   L    G  +
Sbjct: 130 DMFHPAIVGLTGTPEQVAAAARAFRVYYAKAPAAD---GSTYTMDHSTYTYLMGPDGGFL 186

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
            V P    +    + I + I 
Sbjct: 187 TVFPRGTGAGEIADAIRQYIR 207


>gi|217969485|ref|YP_002354719.1| electron transporter SCO1/SenC [Thauera sp. MZ1T]
 gi|217506812|gb|ACK53823.1| electron transport protein SCO1/SenC [Thauera sp. MZ1T]
          Length = 201

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/195 (25%), Positives = 89/195 (45%), Gaps = 4/195 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           ++ L + +   LL + G                 +   + L   +G + +L+    K   
Sbjct: 9   LRTLLLAVIAPLLLLAGCTPAEPVFKSTDITGTSYGKTLRLTDHNGRERTLADFKGKVVT 68

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFG+T C  VCPT LS +  +++++ P    +   F+TVDP+RDTPE++ ++V  F  R
Sbjct: 69  IFFGYTQCPDVCPTALSGMSTVMQELGPDAERVQVLFVTVDPERDTPELLAQYVPVFDAR 128

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
            +G+ G P  +  +AK FR++          +   Y +DHT    +F   G     + + 
Sbjct: 129 FLGLYGTPEKIAELAKEFRVFYRK----SGDLAGHYTIDHTAGTYVFGPDGRPRLYVRHA 184

Query: 181 DDSDSAIEKINRLIT 195
           +D    +  I  L+ 
Sbjct: 185 EDPQVVVADIKALLA 199


>gi|83746848|ref|ZP_00943895.1| Hypothetical Protein RRSL_03288 [Ralstonia solanacearum UW551]
 gi|83726433|gb|EAP73564.1| Hypothetical Protein RRSL_03288 [Ralstonia solanacearum UW551]
          Length = 235

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 89/174 (51%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G + F +D  L    G   +L+    K  ++FFG+T+C  VCPTTL+ L  
Sbjct: 64  PAFQNLDITGAKSFGADFSLTDHTGKRRTLADFRGKVVVMFFGYTHCPDVCPTTLAELRG 123

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           +++ +      +   F+TVDP+RDT +++ K+V  F  R IG    +  ++ +VAK+F++
Sbjct: 124 VMEGLGKDADRVQVLFVTVDPQRDTQDLLAKYVPAFDPRFIGLRPANDQELQKVAKDFKV 183

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           + + V        + Y +DHT    +FD  G++   I +       +  +  L+
Sbjct: 184 FYSKVPG---SSPDNYTMDHTAGSYMFDPQGNLRLFIKHGQGPAPIVHDVKLLL 234


>gi|86748011|ref|YP_484507.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           HaA2]
 gi|86571039|gb|ABD05596.1| Electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           HaA2]
          Length = 199

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 57/193 (29%), Positives = 88/193 (45%), Gaps = 11/193 (5%)

Query: 9   GTILLAVLGSIAYVSFSS-------KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
             I+ A  GS+                V           L   +G   +  SL  KP+++
Sbjct: 11  LVIIAAFAGSLVVGLVVVLWLLGGLNKVAAPASIGGPFQLTDHNGRIVTEQSLKGKPTLI 70

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFGFT C  VCPT+L  + ++L+ + P    LNAYF++VDP+RDTPE MK+++  F   +
Sbjct: 71  FFGFTRCPDVCPTSLFEITQVLQALGPDADRLNAYFVSVDPERDTPESMKEYLSSFDPHL 130

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
            G+ G      ++ K +R+Y   V       +  Y +DHT  + L D  G  V     K 
Sbjct: 131 KGLIGSREATDKIEKGYRVYAKKVPT----SDGDYTMDHTALIYLMDKDGRFVAPFNMKR 186

Query: 182 DSDSAIEKINRLI 194
             + A   + R +
Sbjct: 187 KPEEAAADLKRYL 199


>gi|38567240|emb|CAE76531.1| probable SCO1 protein precursor [Neurospora crassa]
          Length = 303

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/204 (24%), Positives = 89/204 (43%), Gaps = 14/204 (6%)

Query: 9   GTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYIK 57
              +L   G + Y     + +            G  +      L+ Q+G   +   L  +
Sbjct: 75  LLFVLTGAGLLWYFEHEKQRMQRKRIADATKGVGRPKVGGPFELIDQNGKPVTEKDLKGR 134

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
            S+V+FGF++C  +CP  L ++  + ++V+      L   F+T DP RDTP+V+K+++  
Sbjct: 135 YSLVYFGFSHCPDICPEELDKMAAMFEKVEAERPGALKPVFVTCDPARDTPQVLKEYLAE 194

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F    IG++G    +  + K +R+Y +     K    + Y VDH+    L D  G  V  
Sbjct: 195 FHPLFIGLTGTYDQIKAMCKAYRVYFST--PSKVEPGQDYLVDHSIYFYLMDPEGDFVEA 252

Query: 177 IPYKDDSDSAIEKINRLITYGNVV 200
           +  +   D A + I   +    V+
Sbjct: 253 LGRQHSPDQAAKVILDHMKDWQVL 276


>gi|294084570|ref|YP_003551328.1| hypothetical protein SAR116_1001 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664143|gb|ADE39244.1| Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of
           respiratory and photosynthetic systems [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 230

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 54/201 (26%), Positives = 90/201 (44%), Gaps = 12/201 (5%)

Query: 1   MKALGIILGTILLAV-LGSIAYVSFSSKFVDGNRR---------FNSDVHLVAQDGTDFS 50
           ++A+      ++L + L    Y  + +                   S+  LV   G   S
Sbjct: 29  LRAIRYASWAVVLVMTLAFAGYAGWRTLGPQPEPPTINQVGQSLIKSEFDLVDHRGDQVS 88

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
            +    K  +VFFGFT C  VCPT L+ +  +++++      +   FITVDP+RDTPE M
Sbjct: 89  AADYRGKWLLVFFGFTTCPDVCPTALNEIAEVMEKLGAKAAKVQPLFITVDPERDTPERM 148

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            +FV  F  RI G++G    +    K+F++Y    + ++    + Y ++HTT L L D  
Sbjct: 149 AEFVGAFDPRITGLTGTLDQIKASTKSFKVYYAKAVQKE--APDGYTMEHTTYLYLIDPK 206

Query: 171 GSIVGVIPYKDDSDSAIEKIN 191
           G  V    Y    +   + + 
Sbjct: 207 GRFVRPYSYNATVNEIADDLQ 227


>gi|189202278|ref|XP_001937475.1| mitochondrial metallochaperone Sco1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187984574|gb|EDU50062.1| mitochondrial metallochaperone Sco1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 313

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/203 (28%), Positives = 89/203 (43%), Gaps = 15/203 (7%)

Query: 6   IILGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSS 53
           +  G + +A  G +       K               G  +      LV QDG  FS   
Sbjct: 100 LTAGILFIATCGGLWAYFTYEKERLARKRIAEQTKGIGKPKVGGPFQLVDQDGKVFSNED 159

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPEVMKK 112
           +  K S+V+FGFT+C  +CP  L ++  +  +V      +L    IT DP RD P+V+K+
Sbjct: 160 MLGKYSLVYFGFTHCPDICPDELDKMALMYDKVVAQCGNVLLPIMITCDPARDNPKVLKE 219

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           ++  F    IG++GD   +  V K +R+Y +   + K    + Y VDH+    L D  G 
Sbjct: 220 YLAEFHPDFIGLTGDYEQIKSVCKAYRVYFSTPSSVK--PGQDYLVDHSIYFYLMDPEGD 277

Query: 173 IVGVIPYKDDSDSAIEKINRLIT 195
            V  I     +D A + I+  I 
Sbjct: 278 FVEAIGRNFTADQAAKVISDHIK 300


>gi|91774983|ref|YP_544739.1| electron transport protein SCO1/SenC [Methylobacillus flagellatus
           KT]
 gi|91708970|gb|ABE48898.1| electron transport protein SCO1/SenC [Methylobacillus flagellatus
           KT]
          Length = 191

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/190 (25%), Positives = 86/190 (45%), Gaps = 4/190 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           ++ L + L   L+A       +      +  +R       L    G    L     K  +
Sbjct: 2   LRWLWMFLVFSLVACGPGKQELELYGTDIS-DRELEGAFTLTDHLGQVRHLEDFKGKVVV 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFG+T+C  VCPTT+  +   +K +      +   FI+VDP+RDTPEV+ ++V  F  R
Sbjct: 61  VFFGYTHCPDVCPTTMLSMANAMKLMGDKAQEVQVLFISVDPERDTPEVLAQYVPFFDAR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
            IG++G P  + + A+N+++       E     + Y VDH+  + + D  G +   + + 
Sbjct: 121 FIGLNGTPEQLKQAARNYKVVYAKRSVE---GGDAYTVDHSAGIYVVDRKGRVRAYLRHD 177

Query: 181 DDSDSAIEKI 190
              +  +  I
Sbjct: 178 ATPEQLVHDI 187


>gi|300692653|ref|YP_003753648.1| cytochrome c oxidase assembly factor, scoC [Ralstonia solanacearum
           PSI07]
 gi|299079713|emb|CBJ52390.1| putative cytochrome c oxidase assembly factor, scoC [Ralstonia
           solanacearum PSI07]
          Length = 200

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/174 (28%), Positives = 88/174 (50%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G + F +D  L    G   +L+    K  ++FFG+T+C  VCPTTL+ L  
Sbjct: 29  PAFQNLDITGAKSFGADFSLTDHTGKRRTLADFRGKVVVMFFGYTHCPDVCPTTLAELRG 88

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           ++  +      +   F+TVDP+RDT +++ K+V  F  R IG    +  ++ +VAK+F++
Sbjct: 89  VMDGLGKDADRVQVLFVTVDPQRDTQDLLAKYVPAFDPRFIGLRPANDEELQKVAKDFKV 148

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           + + V        + Y +DHT    +FD  G++   I +       +  I  L+
Sbjct: 149 FYSKVPG---SSPDNYTMDHTAGSYMFDPKGNLRLFIKHGQGPAPIVHDIRLLL 199


>gi|16124504|ref|NP_419068.1| SCO1/2 family protein [Caulobacter crescentus CB15]
 gi|221233188|ref|YP_002515624.1| SCO1/SenC family protein [Caulobacter crescentus NA1000]
 gi|13421380|gb|AAK22236.1| SCO1/2 family protein [Caulobacter crescentus CB15]
 gi|220962360|gb|ACL93716.1| SCO1/SenC family protein [Caulobacter crescentus NA1000]
          Length = 196

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 60/197 (30%), Positives = 83/197 (42%), Gaps = 7/197 (3%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            L +IL  ++   +      +      +          LV Q+G   S  +L  K S VF
Sbjct: 5   RLVLILACVVGLAVAVGLAWNVGVFRSEPAVTVGGPFELVDQNGAPTSEKALKGKWSAVF 64

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR-- 120
           FGFT C  VCP TL  L     Q+ P        FI++DP RDT + MK ++        
Sbjct: 65  FGFTYCPDVCPGTLQGLAAATDQLGPKAKDFQIVFISIDPARDTVKQMKAYLSAPYVPKA 124

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
            IG++G    V   AK +R+Y   V     G    Y +DH+TA+ L D  G    VIPY 
Sbjct: 125 TIGLTGTQAQVDAAAKAYRVYHAKV-----GDGVDYTMDHSTAIYLMDPKGRFKTVIPYN 179

Query: 181 DDSDSAIEKINRLITYG 197
              D    +I   +  G
Sbjct: 180 LPPDEIARRIKDAVREG 196


>gi|330917940|ref|XP_003298022.1| hypothetical protein PTT_08603 [Pyrenophora teres f. teres 0-1]
 gi|311328994|gb|EFQ93869.1| hypothetical protein PTT_08603 [Pyrenophora teres f. teres 0-1]
          Length = 313

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/203 (28%), Positives = 89/203 (43%), Gaps = 15/203 (7%)

Query: 6   IILGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSS 53
           +  G + +A  G +       K               G  +      LV QDG  FS   
Sbjct: 100 LTAGILFIATCGGLWAYFTYEKERLARKRIAEQTKGIGKPKVGGPFQLVDQDGKVFSNED 159

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPEVMKK 112
           +  K S+V+FGFT+C  +CP  L ++  +  +V      +L    IT DP RD P+V+K+
Sbjct: 160 MLGKYSLVYFGFTHCPDICPDELDKMALMYDKVVAECGNVLLPIMITCDPARDNPKVLKE 219

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           ++  F    IG++GD   +  V K +R+Y +   + K    + Y VDH+    L D  G 
Sbjct: 220 YLAEFHPDFIGLTGDYEQIKSVCKAYRVYFSTPSSVK--PGQDYLVDHSIYFYLMDPEGD 277

Query: 173 IVGVIPYKDDSDSAIEKINRLIT 195
            V  I     +D A + I+  I 
Sbjct: 278 FVEAIGRNFTADQAAKVISDHIK 300


>gi|295689001|ref|YP_003592694.1| electron transport protein SCO1/SenC [Caulobacter segnis ATCC
           21756]
 gi|295430904|gb|ADG10076.1| electron transport protein SCO1/SenC [Caulobacter segnis ATCC
           21756]
          Length = 348

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 61/162 (37%), Positives = 90/162 (55%), Gaps = 4/162 (2%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
           +     +LV  +G   + +SL  KP+ +FFGFT C  VCPTTL+ L   LK + P    L
Sbjct: 190 KIGGPFNLVDMNGKPVTETSLLGKPTAIFFGFTYCPEVCPTTLTDLTVWLKMLGPDADKL 249

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
           N  F++VDP+RDTPE M+ ++  F  RI G +G P  V + AK +R+Y   V  E     
Sbjct: 250 NVVFVSVDPERDTPEQMRLYLSNFDPRIQGFTGTPDAVAKAAKAYRVYYQKVPQE----G 305

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
             Y +DH++++ LFD  G  V  I Y+   D A+ ++  L+ 
Sbjct: 306 GGYTIDHSSSVYLFDANGQFVAPIAYQSPPDRAVHQLKALVA 347


>gi|171680097|ref|XP_001904994.1| hypothetical protein [Podospora anserina S mat+]
 gi|170939675|emb|CAP64901.1| unnamed protein product [Podospora anserina S mat+]
          Length = 285

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 47/202 (23%), Positives = 84/202 (41%), Gaps = 15/202 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLSSLY 55
            G + L     + +     K               G  +      L+ Q+G   +   L 
Sbjct: 78  AGILFLMTGAGLLFYFEKEKERMQRKRIAESTKGVGRPKVGGPFSLIDQNGNTVTDEDLK 137

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL-NAYFITVDPKRDTPEVMKKFV 114
            + S+V+FGFT+C  +CP  L ++ R+   V+     +    F+T DP RD P+ +K+++
Sbjct: 138 GRYSLVYFGFTHCPDICPEELDKMARMFDLVEEKRPGVLAPVFVTCDPARDGPKELKEYL 197

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  + IG++G    +  + K +R+Y +     K    + Y VDH+    L D  G  V
Sbjct: 198 AEFHPKFIGLTGTYDQIKAMCKAYRVYFSTPNEVK--PGQDYLVDHSIYFYLMDPEGDFV 255

Query: 175 GVIPYKDDSDSAIEKINRLITY 196
             +  +   D A + I   +  
Sbjct: 256 EALGRQHSPDQAAKIIVDHMKE 277


>gi|319782864|ref|YP_004142340.1| electron transport protein SCO1/SenC [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168752|gb|ADV12290.1| electron transport protein SCO1/SenC [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 192

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 76/197 (38%), Positives = 113/197 (57%), Gaps = 6/197 (3%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           M+++ + +  ++ A +G + +  +   +  G   F +   LV Q G   + ++   +PS+
Sbjct: 2   MRSILVGILVLMAAGIGWLTFDWYRGHY--GGEPFGAAFTLVDQKGAPITEAAFRGQPSV 59

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  L   LK +   G  L+AYF++VDP+RDTPEVM  +V  FSDR
Sbjct: 60  VFFGFTHCPEVCPTTLFELAGWLKTLGDDGKNLHAYFVSVDPERDTPEVMNAYVSNFSDR 119

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+GI+G P  V  +AK+F IY   V          Y +DHT ++LL +  G   G I Y 
Sbjct: 120 IVGITGAPDKVHAMAKSFGIYWKKVDTGD----GDYTMDHTASVLLLNAKGDFAGTIAYG 175

Query: 181 DDSDSAIEKINRLITYG 197
           + +D+AI K+ RL   G
Sbjct: 176 ESADTAIAKLKRLAAKG 192


>gi|260462107|ref|ZP_05810351.1| electron transport protein SCO1/SenC [Mesorhizobium opportunistum
           WSM2075]
 gi|259031967|gb|EEW33234.1| electron transport protein SCO1/SenC [Mesorhizobium opportunistum
           WSM2075]
          Length = 192

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 77/197 (39%), Positives = 113/197 (57%), Gaps = 6/197 (3%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           M+++ + +  ++ A +G + +  +   +  G   F +   LV Q G   + ++   +PS+
Sbjct: 2   MRSILVGILVLMAAGIGWLTFDWYRGHY--GGEPFGAPFTLVDQKGAPITEAAFRGQPSV 59

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  L   LK +   G  L+AYF++VDP+RDTP VM  +V  FSDR
Sbjct: 60  VFFGFTHCPEVCPTTLFELAGWLKTLGDDGKNLHAYFVSVDPERDTPAVMNAYVSNFSDR 119

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IIGISGDP  V  +AK+F IY   V          Y +DHT ++LL +  G   G I Y 
Sbjct: 120 IIGISGDPDKVHAMAKSFGIYWKKVDTGD----GDYTMDHTASVLLLNGKGDFAGTIAYG 175

Query: 181 DDSDSAIEKINRLITYG 197
           + + +A+EK+ RL   G
Sbjct: 176 ESASTAVEKLKRLAAKG 192


>gi|164427251|ref|XP_964583.2| protein sco1 [Neurospora crassa OR74A]
 gi|157071669|gb|EAA35347.2| protein sco1 [Neurospora crassa OR74A]
          Length = 290

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/199 (24%), Positives = 87/199 (43%), Gaps = 14/199 (7%)

Query: 9   GTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYIK 57
              +L   G + Y     + +            G  +      L+ Q+G   +   L  +
Sbjct: 75  LLFVLTGAGLLWYFEHEKQRMQRKRIADATKGVGRPKVGGPFELIDQNGKPVTEKDLKGR 134

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
            S+V+FGF++C  +CP  L ++  + ++V+      L   F+T DP RDTP+V+K+++  
Sbjct: 135 YSLVYFGFSHCPDICPEELDKMAAMFEKVEAERPGALKPVFVTCDPARDTPQVLKEYLAE 194

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F    IG++G    +  + K +R+Y +     K    + Y VDH+    L D  G  V  
Sbjct: 195 FHPLFIGLTGTYDQIKAMCKAYRVYFST--PSKVEPGQDYLVDHSIYFYLMDPEGDFVEA 252

Query: 177 IPYKDDSDSAIEKINRLIT 195
           +  +   D A + I   + 
Sbjct: 253 LGRQHSPDQAAKVILDHMK 271


>gi|124268356|ref|YP_001022360.1| putative lipoprotein [Methylibium petroleiphilum PM1]
 gi|124261131|gb|ABM96125.1| putative lipoprotein [Methylibium petroleiphilum PM1]
          Length = 198

 Score =  135 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 54/199 (27%), Positives = 95/199 (47%), Gaps = 7/199 (3%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDG----NRRFNSDVHLVAQDGTDFSLSSLYI 56
           M+ L ++     L +L +       ++   G       +  D  L   +G   +L+    
Sbjct: 3   MRRLAVLTVCAALGLLAACDPADKPAEPFKGIDITGADYARDFALSDVEGHPRTLADFKG 62

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           K ++VFFG+T C  VCPTT++ L  + KQ+   G  L A FITVDP+RDTPE++K ++  
Sbjct: 63  KATVVFFGYTQCPDVCPTTMAELAAVKKQLGADGDKLQAVFITVDPERDTPEILKAYMSS 122

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F    + +   P     VAK+F+ +   V  +     + Y +DHT    ++D  G +   
Sbjct: 123 FDPSFVALRSTPEQTQAVAKSFKAFFRKVPGK---AADSYTMDHTAGAYVYDPQGRLRLF 179

Query: 177 IPYKDDSDSAIEKINRLIT 195
           + Y    ++ +  + +L+ 
Sbjct: 180 VRYGQPIEAWVADLKQLLA 198


>gi|16127733|ref|NP_422297.1| SCO1/2 family protein [Caulobacter crescentus CB15]
 gi|221236554|ref|YP_002518991.1| SCO1/SenC family protein [Caulobacter crescentus NA1000]
 gi|13425229|gb|AAK25465.1| SCO1/2 family protein [Caulobacter crescentus CB15]
 gi|220965727|gb|ACL97083.1| SCO1/SenC family protein [Caulobacter crescentus NA1000]
          Length = 190

 Score =  135 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 57/162 (35%), Positives = 85/162 (52%), Gaps = 4/162 (2%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
           +      L   +G   +  SL  KP+ VFFGFT C  VCPTTL+ +   LK +      L
Sbjct: 33  KIGGPFQLTDMNGKPVTEKSLLGKPTAVFFGFTYCPEVCPTTLTEMTAWLKALGKDADKL 92

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
           N   ITVDP+RDTP  +K+++  F  RI G +G P  + + A+ +R+Y   V  +     
Sbjct: 93  NVVLITVDPERDTPAQLKEYLSNFDPRIQGFTGTPDAIAKTARAYRVYYQKVPLD----G 148

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
             Y +DH++A+ LFD  G  V  I Y+   D A+ ++  L+ 
Sbjct: 149 GGYTIDHSSAIYLFDAKGRFVSPIAYQAPQDRALGQLRDLLK 190


>gi|56477834|ref|YP_159423.1| SCO1/SenC family protein [Aromatoleum aromaticum EbN1]
 gi|56313877|emb|CAI08522.1| putative SCO1/SenC family protein,probably involved in biogenesis
           of respiratory cytochrome aa3 oxidase [Aromatoleum
           aromaticum EbN1]
          Length = 195

 Score =  135 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 52/174 (29%), Positives = 84/174 (48%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            SF +  + G   + S   L    GT  +L+    K   +FFG+T C  VCPTTLS +  
Sbjct: 24  PSFHATDITG-AEYGSTFALTDHHGTPRTLADFRGKVVTMFFGYTQCPDVCPTTLSTMSE 82

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           +++ + P    +   F+TVDP+RDT  ++  +V +F  R IG+ GD      VAK+FRI+
Sbjct: 83  VMRLLGPDAERVQVLFVTVDPERDTQALLANYVPQFDARFIGLYGDAAQTQAVAKDFRIF 142

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                  +      Y VDH     +FD  G +   + + + +++    I  L+ 
Sbjct: 143 YQKSGDTE---GANYTVDHVAGTYIFDPTGRLRLYVRHGESAENIAADIRALLA 193


>gi|119899582|ref|YP_934795.1| SCO1/SenC family protein [Azoarcus sp. BH72]
 gi|119671995|emb|CAL95909.1| SCO1/SenC family protein [Azoarcus sp. BH72]
          Length = 200

 Score =  135 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 82/175 (46%), Gaps = 4/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F S  + G   +     L    G    L+    K   +FFG+T C  VCP+ L+ +  
Sbjct: 25  PAFHSTDITG-ADYGKQFALTDHSGQPRGLTDFRGKVVTLFFGYTQCPDVCPSNLTSMAE 83

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           ++K++   G  +   F+TVDP+RDT E++ ++V  F  R +G+ G P     VA+ FRI+
Sbjct: 84  VVKRLGADGERVQVLFVTVDPERDTRELLAQYVPAFDPRFVGLYGTPEQTADVAREFRIF 143

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
                         Y +DH+    +FD  G +   + + +  D+ +  + +L+  
Sbjct: 144 YRKSGD---TAGGAYTIDHSAGTYVFDPQGRLRLYVRHGESVDNIVADLKQLLAE 195


>gi|94309216|ref|YP_582426.1| electron transport protein SCO1/SenC [Cupriavidus metallidurans
           CH34]
 gi|93353068|gb|ABF07157.1| cytochrome oxidase assembly protein, Sco1/SenC family [Cupriavidus
           metallidurans CH34]
          Length = 204

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 49/175 (28%), Positives = 86/175 (49%), Gaps = 4/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            SF +  + G   F  D  L+   G   +L+    K  ++FFG+T+C  VCPTT+  L +
Sbjct: 33  PSFRNVDISGATEFGKDFALLDPTGKTRTLADFKGKVVLMFFGYTHCPDVCPTTMVELKQ 92

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           +++Q+ P    +   F+TVDP RDT  +M ++V  F  R +G    D   + +V K+F++
Sbjct: 93  VMEQMGPDADKVQVLFVTVDPDRDTAALMAQYVPAFDSRFLGLRPADEAALKKVTKDFKV 152

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           Y   V        + Y +DH+    +FD  G +   I +    +     + +L++
Sbjct: 153 YYAKVPG---SSPDNYTMDHSAGSYVFDQNGQLRLFIRHGQGPEPIAHDLKQLMS 204


>gi|154246321|ref|YP_001417279.1| electron transport protein SCO1/SenC [Xanthobacter autotrophicus
           Py2]
 gi|154160406|gb|ABS67622.1| electron transport protein SCO1/SenC [Xanthobacter autotrophicus
           Py2]
          Length = 204

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 54/186 (29%), Positives = 88/186 (47%), Gaps = 4/186 (2%)

Query: 9   GTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNC 68
             +++  +  +           G         LV Q G   + ++L  KPS++FFGFT+C
Sbjct: 23  ALVMVTAVTMLVGSPAPRVTSTGTAAVGGPFKLVDQTGAPVTEAALKGKPSLIFFGFTHC 82

Query: 69  SAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDP 128
             VCPT L  +  +L  + P       +F+TVDP+RDTPE +K ++  F+ +I G++G P
Sbjct: 83  PDVCPTALFEMSEILTALGPDAGKAQVFFVTVDPERDTPEALKSYLSSFAPQIRGLTGTP 142

Query: 129 IDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIE 188
             V  + K +R+Y   V          Y +DHT  + L D +G+ V     K     A  
Sbjct: 143 EAVDAIKKEYRVYSKKVPL----TGGDYTMDHTAVVYLMDKSGTFVAPFNSKRPPADAAA 198

Query: 189 KINRLI 194
           ++ R +
Sbjct: 199 ELKRYL 204


>gi|83309616|ref|YP_419880.1| hypothetical protein amb0517 [Magnetospirillum magneticum AMB-1]
 gi|82944457|dbj|BAE49321.1| Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of
           respiratory and photosynthetic systems [Magnetospirillum
           magneticum AMB-1]
          Length = 200

 Score =  134 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 54/202 (26%), Positives = 91/202 (45%), Gaps = 11/202 (5%)

Query: 1   MKALGIILGTILLAVLGSIA-------YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
           MK    +L  + + V+  +        +   +S+             L   +G   S   
Sbjct: 1   MKFSRSLLALMAVIVIAFVVIGVRLVIWSGNNSEGAKAIPAIGGPFQLTDHNGKQVSDRD 60

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTPEVMKK 112
              +  ++FFG+T C  VCPTTLS +   ++++           F+T+DP+RDT  VMK+
Sbjct: 61  FRNRYMLIFFGYTFCPDVCPTTLSTVTAAMEKLGTGYGKKVVPIFVTIDPERDTVAVMKE 120

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V  FS  I+G++G P ++ +VAK F++Y   V   K    E Y VDH+  L L    G 
Sbjct: 121 YVGAFSPDIVGLTGTPDEIAKVAKEFKVYAAKV---KGDRPEHYTVDHSAILYLMGPDGK 177

Query: 173 IVGVIPYKDDSDSAIEKINRLI 194
            V    +   +D     + + +
Sbjct: 178 FVAHFTHGISADDLAAGLKKHV 199


>gi|207742219|ref|YP_002258611.1| lipoprotein [Ralstonia solanacearum IPO1609]
 gi|206593607|emb|CAQ60534.1| lipoprotein [Ralstonia solanacearum IPO1609]
          Length = 200

 Score =  134 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 89/174 (51%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G + F +D  L    G   +L+    K  ++FFG+T+C  VCPTTL+ L  
Sbjct: 29  PAFQNLDITGAKSFGADFSLTDHTGKRRTLADFRGKVVVMFFGYTHCPDVCPTTLAELRG 88

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           +++ +      +   F+TVDP+RDT +++ K+V  F  R IG    +  ++ +VAK+F++
Sbjct: 89  VMEGLGKDADRVQVLFVTVDPQRDTQDLLAKYVPAFDPRFIGLRPANDQELQKVAKDFKV 148

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           + + V        + Y +DHT    +FD  G++   I +       +  +  L+
Sbjct: 149 FYSKVPG---SSPDNYTMDHTAGSYMFDPQGNLRLFIKHGQGPAPIVHDVKLLL 199


>gi|212275264|ref|NP_001130056.1| hypothetical protein LOC100191148 [Zea mays]
 gi|194688186|gb|ACF78177.1| unknown [Zea mays]
 gi|223972835|gb|ACN30605.1| unknown [Zea mays]
 gi|223974569|gb|ACN31472.1| unknown [Zea mays]
          Length = 307

 Score =  134 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 51/209 (24%), Positives = 86/209 (41%), Gaps = 21/209 (10%)

Query: 5   GIILGTILLAVLGSIAYVSFSSK----------------FVDGNRRFNSDVHLVAQDGTD 48
            +    +L+   G I Y     K                   G         L+  DG  
Sbjct: 101 WLSFLLLLVTGGGIIVYYDKEKKRHIEELKNRTSAVKPGQSVGTAAIGGPFKLLNHDGKP 160

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTP 107
            +      K ++++FGFT+C  +CP  L ++   + ++     L     FITVDP+RDT 
Sbjct: 161 VTEKDFLGKWTLLYFGFTHCPDICPDELQKMAAAIDKIKEKAKLDVVPVFITVDPERDTV 220

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E ++ +V+ F   ++G++G   +V +VA+ +R+Y      E       Y VDH+  + L 
Sbjct: 221 EQVRDYVKEFHPDLVGLTGTTDEVRQVARAYRVYYMKTEEE----GSDYLVDHSIVMYLM 276

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           D     V       D+DS  + I + I  
Sbjct: 277 DPEMKFVKFYGKNYDTDSLADGIVKEIKE 305


>gi|125580889|gb|EAZ21820.1| hypothetical protein OsJ_05461 [Oryza sativa Japonica Group]
          Length = 341

 Score =  134 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 48/208 (23%), Positives = 87/208 (41%), Gaps = 21/208 (10%)

Query: 5   GIILGTILLAVLGSIAYVSFSSK----------------FVDGNRRFNSDVHLVAQDGTD 48
            +    +L+   G I Y     K                   G        +L+  DG  
Sbjct: 135 WLSFLLLLVTGGGIIVYYDKEKKRHIEELKNRTSAVKQEPSVGTAAIGGPFNLLNHDGKP 194

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTP 107
            +    + K ++++FGFT+C  +CP  L ++   + ++     +     FITVDP+RDT 
Sbjct: 195 VTQKDFFGKWTLLYFGFTHCPDICPDELQKMALAIDKIKEKAKMEVVPVFITVDPERDTV 254

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E ++ +V  F   +IG++G   ++ +VA+ +R+Y      E       Y VDH+  + L 
Sbjct: 255 EQVRDYVNEFHPNLIGLTGTTDEIRKVARAYRVYYMKTEEE----GSDYLVDHSIVMYLM 310

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           +     V       D+DS  + I + + 
Sbjct: 311 NPKMEFVKFYGKNYDADSLADGIIKELK 338


>gi|289617955|emb|CBI55532.1| unnamed protein product [Sordaria macrospora]
          Length = 281

 Score =  134 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 47/199 (23%), Positives = 87/199 (43%), Gaps = 14/199 (7%)

Query: 9   GTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYIK 57
              +L   G + Y     + +            G  +      L+  +G   +   L  +
Sbjct: 76  LLFVLTGAGLLWYFEHEKQRMQRKRIADATKGVGRPKVGGPFELIDHNGKPMTEKDLKGR 135

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
            S+V+FGF++C  +CP  L ++  + ++V+      L   F+T DP RDTP+V+K+++  
Sbjct: 136 YSLVYFGFSHCPDICPEELDKMAAMFEKVEAERPGALKPVFVTCDPARDTPQVLKEYLAE 195

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F  + IG++G    +  + K +R+Y +     K    + Y VDH+    L D  G  V  
Sbjct: 196 FHPKFIGLTGTYDQIKAMCKAYRVYFST--PSKVEPGQDYLVDHSIYFYLMDPEGDFVEA 253

Query: 177 IPYKDDSDSAIEKINRLIT 195
           +  +   D A + I   + 
Sbjct: 254 LGRQHSPDQAAKVILDHMK 272


>gi|207727815|ref|YP_002256209.1| lipoprotein [Ralstonia solanacearum MolK2]
 gi|206591056|emb|CAQ56668.1| lipoprotein [Ralstonia solanacearum MolK2]
          Length = 200

 Score =  134 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 89/174 (51%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G + F +D  L    G   +L+    K  ++FFG+T+C  VCPTTL+ L  
Sbjct: 29  PAFQNLDITGAKSFGADFSLTDHTGKRRTLADFRGKVVVMFFGYTHCPDVCPTTLAELRG 88

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           +++ +      +   F+TVDP+RDT +++ K+V  F  R IG    +  ++ +VAK+F++
Sbjct: 89  VMEGLGKDADRVQVLFVTVDPQRDTQDLLAKYVPAFDPRFIGLRPANDQELQKVAKDFKV 148

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           + + V        + Y +DHT    +FD  G++   I +       +  +  L+
Sbjct: 149 FYSKVPG---SSPDNYTMDHTAGSYMFDPQGNLRLFIKHGQGPAPIVHDVKLLL 199


>gi|312215006|emb|CBX94959.1| hypothetical protein [Leptosphaeria maculans]
          Length = 349

 Score =  134 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 54/201 (26%), Positives = 88/201 (43%), Gaps = 14/201 (6%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLY 55
                + A  G  AY ++  + +            G  +      L+ QDG  FS   + 
Sbjct: 138 AAILFVAAGAGLWAYFTYEKERMARKRIAEQTKGIGKPKVGGPFQLMDQDGKPFSNEDML 197

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL-NAYFITVDPKRDTPEVMKKFV 114
            K S+V+FGF++C  +CP  L ++  +  +V      +     IT DP RDTP+V+K+++
Sbjct: 198 GKYSLVYFGFSHCPDICPDELDKMALMYDKVTAECGKVLLPIMITCDPARDTPKVLKEYL 257

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F    IG++G    +  V K +R+Y +   + K    E Y VDH+    L D  G  V
Sbjct: 258 AEFHPNFIGLTGKYEQIKDVCKAYRVYFSTPQSVK--PGEDYLVDHSIYFYLMDPEGDFV 315

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             I     ++ A   I+  I 
Sbjct: 316 EAIGRNFTAEQAARVISDHIK 336


>gi|83594689|ref|YP_428441.1| electron transport protein SCO1/SenC [Rhodospirillum rubrum ATCC
           11170]
 gi|83577603|gb|ABC24154.1| Electron transport protein SCO1/SenC [Rhodospirillum rubrum ATCC
           11170]
          Length = 210

 Score =  134 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 46/196 (23%), Positives = 88/196 (44%), Gaps = 4/196 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           +K  G +L  +++A++   A  +                 LV   G   +  +   +  +
Sbjct: 14  LKVFGPLLAVLVIAIVAIGARFALMPTGTGRAAAIGGPFALVDDRGETLTNDTFAGRFML 73

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           ++FG+T C  VCPT+L  +   L Q  +     +   FI+VDP+RDTP ++  + + F  
Sbjct: 74  IYFGYTYCPDVCPTSLGEMAAALDQLPEDQLARIAPIFISVDPERDTPALIGDYARAFHP 133

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
            +IG++G P  +  V K +++Y   V  E       Y VDH++   L    G  +    +
Sbjct: 134 LLIGLTGSPAQIATVTKAYKVYFKKVEQEAGAP---YLVDHSSVTYLMGPDGRFITHFSH 190

Query: 180 KDDSDSAIEKINRLIT 195
              SD    ++++++ 
Sbjct: 191 GTPSDEMAARLSKILA 206


>gi|92115841|ref|YP_575570.1| electron transport protein SCO1/SenC [Nitrobacter hamburgensis X14]
 gi|91798735|gb|ABE61110.1| electron transport protein SCO1/SenC [Nitrobacter hamburgensis X14]
          Length = 197

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 53/192 (27%), Positives = 91/192 (47%), Gaps = 7/192 (3%)

Query: 6   IILGTI---LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
           I+       L+  L  + ++                  L  Q G   +  SL  +P+IVF
Sbjct: 10  IVFAAFAGSLVVGLTVVLWLLGGLTSKPAVASIGGPFQLTDQTGQTVTEKSLVGRPTIVF 69

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  VCPT+L  +  +L+ +      +NAYF+TVDP+RDT   MK+++  F   + 
Sbjct: 70  FGYTHCPDVCPTSLFEMSEVLRAMGKDADRVNAYFVTVDPERDTQATMKEYLSSFDPHLK 129

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
           G++GD   V ++A  +R+++  +  +       Y +DHT  + L D  G  V     K  
Sbjct: 130 GLTGDTAAVTKMASEYRVFIKKIPLQD----GGYSMDHTALIYLMDRDGRFVSPFDLKRT 185

Query: 183 SDSAIEKINRLI 194
            ++A   + R +
Sbjct: 186 PEAAAADLKRYL 197


>gi|15889357|ref|NP_355038.1| membrane protein [Agrobacterium tumefaciens str. C58]
 gi|15157203|gb|AAK87823.1| membrane protein [Agrobacterium tumefaciens str. C58]
          Length = 202

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 66/198 (33%), Positives = 112/198 (56%), Gaps = 3/198 (1%)

Query: 1   MKALGIILGTILLAVLGSIAYVSF---SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           M+ + I+L  +++ + G +++++     ++       +     L AQ+G   +  +   K
Sbjct: 1   MRNIRIVLWAVVVVLAGVVSWLTIEMTKTREEMVETAYGVPFALTAQNGQPITEKAFQGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  +++VDP G  L AYF++VDP+RDTPE+M+++V   
Sbjct: 61  PTALFFGFTHCPEVCPTTLFELNGWMEKVDPAGDKLQAYFVSVDPERDTPEIMQQYVSNV 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RI GI+G    +    K +RIY   V  ++      Y +DHT +++L D  G   G I
Sbjct: 121 SKRITGITGPADKIAETLKGYRIYAKKVPVDEKDPNGDYTMDHTASVILLDANGRFAGTI 180

Query: 178 PYKDDSDSAIEKINRLIT 195
            Y ++ D A +K+  L+ 
Sbjct: 181 AYGENPDVAEQKLQNLLK 198


>gi|118488619|gb|ABK96122.1| unknown [Populus trichocarpa]
          Length = 317

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/204 (23%), Positives = 87/204 (42%), Gaps = 11/204 (5%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD------GNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
            +    +     G I Y     K         G        +L+  DG   S      K 
Sbjct: 115 WLSFLFLAATGAGLIWYYDRMKKQRIEVGPSVGKPEIGGPFNLIDHDGKPVSEKDFMGKW 174

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTPEVMKKFVQRF 117
           ++++FGFT+C  +CP  L +L   + ++           FITVDP+RD  E ++++V+ F
Sbjct: 175 TMIYFGFTHCPDICPDELQKLAAAIDKIKEKAGFDIVPVFITVDPERDNVEQVREYVKEF 234

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
             ++IG++G   ++ + A+ +RIY      E       Y VDH+    L D    +V   
Sbjct: 235 HPKLIGLTGSLEEIKKTARAYRIYYMKTSEED----SDYLVDHSIITYLMDPNMELVKFF 290

Query: 178 PYKDDSDSAIEKINRLITYGNVVK 201
              +D+D+  + + + +     +K
Sbjct: 291 GKNNDADALADGVIKEMKQYKSIK 314


>gi|325293442|ref|YP_004279306.1| sco1 membrane protein [Agrobacterium sp. H13-3]
 gi|325061295|gb|ADY64986.1| sco1 membrane protein [Agrobacterium sp. H13-3]
          Length = 210

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 66/198 (33%), Positives = 112/198 (56%), Gaps = 3/198 (1%)

Query: 1   MKALGIILGTILLAVLGSIAYVSF---SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           M+ + I+L  +++ ++G +++++     ++       +     L AQ+G   +  +   K
Sbjct: 12  MRNIRIVLWAVVVVLVGVVSWLTLEMTKTREEMVETAYGVPFELTAQNGQPITEKAFQGK 71

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P+ +FFGFT+C  VCPTTL  L+  +++VDP G  L AYF++VDP+RDTPE+M+++V   
Sbjct: 72  PTALFFGFTHCPEVCPTTLFELNGWMEKVDPAGDKLQAYFVSVDPERDTPELMQQYVSNV 131

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           S RI GI+G    +    K +RIY   V  +       Y +DHT +++L D  G   G I
Sbjct: 132 SKRITGITGPADKIAETLKGYRIYAKKVPVDDKDPNGDYTMDHTASVILLDANGRFSGTI 191

Query: 178 PYKDDSDSAIEKINRLIT 195
            Y ++ D A +K+  L+ 
Sbjct: 192 AYGENPDVAEQKLQNLLK 209


>gi|320585940|gb|EFW98619.1| mitochondrial metallochaperone [Grosmannia clavigera kw1407]
          Length = 299

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/201 (24%), Positives = 88/201 (43%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLSSLY 55
            G + +A  G + +     K               G  +      L+ Q+G   + + L 
Sbjct: 95  AGVLFVATGGGLLWYFEHEKERMQRKRVAEANKGVGRPKVGGPFELLDQNGRTVTDADLK 154

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDP-TGTLLNAYFITVDPKRDTPEVMKKFV 114
            + S+V+FGF++C  +CP  L ++ R+   V+      L   F+T DP RDTPEV+K+++
Sbjct: 155 GRHSLVYFGFSHCPDICPEELDKMARMFDLVEAGQPGELTPVFVTCDPARDTPEVLKEYL 214

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F    IG++G    +  + K +R+Y +     +    + Y VDH+    L D  G  V
Sbjct: 215 VEFHPGFIGLTGTYDQIKAMCKAYRVYFST--PSQVQPGQDYLVDHSIYFYLMDPEGDFV 272

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             +  +   + A + I   I 
Sbjct: 273 EALGRQHSPEEAAKVILEHIQ 293


>gi|121595819|ref|YP_987715.1| electron transport protein SCO1/SenC [Acidovorax sp. JS42]
 gi|120607899|gb|ABM43639.1| electron transport protein SCO1/SenC [Acidovorax sp. JS42]
          Length = 203

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 57/196 (29%), Positives = 91/196 (46%), Gaps = 7/196 (3%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDG----NRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
            I  G + + V G+ A  S  +    G       +  D+ L   +G   SL     K  +
Sbjct: 9   KIAAGALWMGVAGTFAACSPKAPKFQGVDLTGAEYARDLQLTDHNGQPRSLKDFAGKVVV 68

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFG+T C  VCPT++S L  + + +   G  L   F++VDP+RDTPEV+K ++  F   
Sbjct: 69  VFFGYTQCPDVCPTSMSELADVKRALGADGDKLQGIFVSVDPERDTPEVLKAYMANFDPS 128

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
            + + G P  +  VAK+F+IY   V  +       Y +DH+    ++D AG +     Y 
Sbjct: 129 FLALRGTPEQLAAVAKDFKIYYKRVEGQ---TPTSYTMDHSAGSYVYDPAGRLRVYHRYG 185

Query: 181 DDSDSAIEKINRLITY 196
             + S    +  L+  
Sbjct: 186 SGAQSLAADVRALLDE 201


>gi|90418174|ref|ZP_01226086.1| SCO1/SenC family protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90337846|gb|EAS51497.1| SCO1/SenC family protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 197

 Score =  133 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 68/196 (34%), Positives = 101/196 (51%), Gaps = 8/196 (4%)

Query: 2   KALGIILGTILLAVLGS---IAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           K     L TI+  + G+   +A +            + SD  L+ + G  F+ + L  KP
Sbjct: 5   KMFRAALWTIVALIAGAAVALALIYAQGGPGRSGEPYGSDFSLIDETGQPFTQADLRAKP 64

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS 118
           + VFFGFT+C  VCPTTL  L    KQ+   G  L   F+TVDP+RDTPEVMK +V+  S
Sbjct: 65  TAVFFGFTHCPEVCPTTLYELAGYQKQLAEKGGDLQVVFVTVDPERDTPEVMKNYVEAVS 124

Query: 119 DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
             I  +SG P  +  + K + +Y   +     G  + Y +DHT    L D  G + G + 
Sbjct: 125 PDITALSGSPEKIAAMLKGWGVYSAKI-----GEGDDYNMDHTATTFLIDETGELAGTLA 179

Query: 179 YKDDSDSAIEKINRLI 194
           Y ++ D+A+ K+ RL+
Sbjct: 180 YGENPDTALAKLERLV 195


>gi|242064104|ref|XP_002453341.1| hypothetical protein SORBIDRAFT_04g004150 [Sorghum bicolor]
 gi|241933172|gb|EES06317.1| hypothetical protein SORBIDRAFT_04g004150 [Sorghum bicolor]
          Length = 329

 Score =  133 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/209 (24%), Positives = 86/209 (41%), Gaps = 21/209 (10%)

Query: 5   GIILGTILLAVLGSIAYVSFSSK----------------FVDGNRRFNSDVHLVAQDGTD 48
            +    +L+   G I Y     K                   G         L+  DG  
Sbjct: 121 WLSFLLLLVTGGGIIVYYDKEKKRHIEELKSRTSAVKPGQSVGTAAVGGPFKLLNHDGKP 180

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTP 107
            +      K ++++FGFT+C  +CP  L ++   + ++     L     FITVDP+RDT 
Sbjct: 181 VTEKDFMGKWTLLYFGFTHCPDICPDELQKMAAAIDKIKEKAKLDVVPVFITVDPERDTV 240

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E ++ +V+ F   +IG++G   +V +VA+ +R+Y      E       Y VDH+  + L 
Sbjct: 241 EQVRDYVKEFHPDLIGLTGTTDEVRQVARAYRVYYMKTEEE----GSDYLVDHSIVMYLM 296

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           +     V       D+DS  + I + I  
Sbjct: 297 NPEMKFVKFYGKNYDTDSLADGIIKEIKE 325


>gi|39971079|ref|XP_366930.1| hypothetical protein MGG_03006 [Magnaporthe oryzae 70-15]
 gi|149210629|ref|XP_001522689.1| hypothetical protein MGCH7_ch7g787 [Magnaporthe oryzae 70-15]
 gi|86196742|gb|EAQ71380.1| hypothetical protein MGCH7_ch7g787 [Magnaporthe oryzae 70-15]
 gi|145017152|gb|EDK01515.1| hypothetical protein MGG_03006 [Magnaporthe oryzae 70-15]
          Length = 294

 Score =  133 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/202 (25%), Positives = 84/202 (41%), Gaps = 15/202 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLSSLY 55
            G I +     + +     K               G  R      L+ QDG  FS  SL 
Sbjct: 87  AGVIFVMTAAGLVWYMDHEKERMHKKRIADASKGVGKPRIGGAFELIDQDGRPFSSDSLK 146

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            + S+V+FGF++C  +CP  L ++  +  +        L   F+T DP+RDTPEV+K+++
Sbjct: 147 GRYSLVYFGFSHCPDICPEELDKMALMFDEVQKERPGALAPVFVTCDPERDTPEVLKEYL 206

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F    IG++G    +  + K +R+Y +     K    + Y VDH+    L D  G  V
Sbjct: 207 AEFHPDFIGLTGTYEQIKAMCKAYRVYFSTPRDVK--PGQDYLVDHSIYFYLMDPEGDFV 264

Query: 175 GVIPYKDDSDSAIEKINRLITY 196
             +  +    +    I   +  
Sbjct: 265 EALGRQHSPKAGANIILDHMKE 286


>gi|125538169|gb|EAY84564.1| hypothetical protein OsI_05935 [Oryza sativa Indica Group]
          Length = 339

 Score =  133 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/208 (23%), Positives = 87/208 (41%), Gaps = 21/208 (10%)

Query: 5   GIILGTILLAVLGSIAYVSFSSK----------------FVDGNRRFNSDVHLVAQDGTD 48
            +    +L+   G I Y     K                   G        +L+  DG  
Sbjct: 133 WLSFLLLLVTGGGIIVYYDKEKKRHIEELKNRTSAVKQEPSVGTAAIGGPFNLLNHDGKP 192

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTP 107
            +    + K ++++FGFT+C  +CP  L ++   + ++     +     FITVDP+RDT 
Sbjct: 193 VTQKDFFGKWTLLYFGFTHCPDICPDELQKMALAIDKIKEKAKMEVVPVFITVDPERDTV 252

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E ++ +V  F   +IG++G   ++ +VA+ +R+Y      E       Y VDH+  + L 
Sbjct: 253 EQVRDYVNEFHPSLIGLTGTTDEIRKVARAYRVYYMKTEEE----GSDYLVDHSIVMYLM 308

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           +     V       D+DS  + I + + 
Sbjct: 309 NPKMEFVKFYGKNYDADSLADGIIKELK 336


>gi|148657025|ref|YP_001277230.1| electron transport protein SCO1/SenC [Roseiflexus sp. RS-1]
 gi|148569135|gb|ABQ91280.1| electron transport protein SCO1/SenC [Roseiflexus sp. RS-1]
          Length = 197

 Score =  133 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/197 (25%), Positives = 89/197 (45%), Gaps = 3/197 (1%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           ++   + +   L+ V+ +     F    +D   +   D  L   DG  F LS    K  I
Sbjct: 2   LRGFRVFVLLALVTVVSACGRYEFRGVTLDP-PKEAPDFTLTDFDGKPFRLSEQRGKIVI 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFGFTNC  +CP  LS +    +++      +   F+++DP RDTPE +K++V  F   
Sbjct: 61  LFFGFTNCPDMCPAALSDMAAARRKLGADAEKVQGVFVSLDPDRDTPERLKRYVTAFDPT 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
            IG+ G   ++  V +++ +    +  E      KY +DH+T + + D  G    +  + 
Sbjct: 121 FIGLRGSEAELSPVMQDYGVTS--IRRELPDSALKYTIDHSTFIYVIDATGRWRLLFTHG 178

Query: 181 DDSDSAIEKINRLITYG 197
              D  +  +  L+  G
Sbjct: 179 MPVDDIVSDLRYLVRQG 195


>gi|91975477|ref|YP_568136.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           BisB5]
 gi|91681933|gb|ABE38235.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           BisB5]
          Length = 199

 Score =  133 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/168 (30%), Positives = 83/168 (49%), Gaps = 4/168 (2%)

Query: 27  KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQV 86
           + V           L  Q+G   +  SL  KP+++FFGFT+C  +CPT L  + ++L+ +
Sbjct: 36  EKVAAPATIGGPFQLTDQNGQVVTEQSLKGKPTLIFFGFTHCPDICPTALFEISQVLQAL 95

Query: 87  DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVL 146
                 +NAYF++VDP+RDTP  MK ++  F   + G+SG      ++ K +R+Y   V 
Sbjct: 96  GKDADRINAYFVSVDPERDTPAAMKDYLSSFDPHLKGLSGTREATDQIEKAYRVYAKKVP 155

Query: 147 AEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            +       Y +DHT  + L D +G  V     K   + A   + R +
Sbjct: 156 TKD----ADYTMDHTALVYLMDKSGRFVSPFNMKRKPEEAAADLKRYL 199


>gi|300705272|ref|YP_003746875.1| cytochrome c oxidase assembly factor, scoc [Ralstonia solanacearum
           CFBP2957]
 gi|299072936|emb|CBJ44292.1| putative cytochrome c oxidase assembly factor, scoC [Ralstonia
           solanacearum CFBP2957]
          Length = 200

 Score =  133 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 88/174 (50%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G + F +D  L    G   +L+    K  ++FFG+T+C  VCPTTL+ L  
Sbjct: 29  PAFQNLDITGAKSFGNDFSLTDHTGKRRTLADFRGKVVVMFFGYTHCPDVCPTTLAELRG 88

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           ++  +      +   F+TVDP+RDT +++ K+V  F  R IG    +  ++ +VAK+F++
Sbjct: 89  VMDGLGKDADRVQVLFVTVDPQRDTQDLLAKYVPAFDPRFIGLRPANDQELQKVAKDFKV 148

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           + + V        + Y +DHT    +FD  G++   I +       +  +  L+
Sbjct: 149 FYSKVPG---SSPDNYTMDHTAGSYMFDPQGNLRLFIKHGQGPAPIVHDVKLLL 199


>gi|309378524|emb|CBX22877.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 224

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/217 (25%), Positives = 91/217 (41%), Gaps = 28/217 (12%)

Query: 4   LGIILGTILLAVLGSI---------------AYVSFSSKFVDGNRR----------FNSD 38
              +LG + LA L +                +    S        +             D
Sbjct: 10  FSFLLGIVALAALSACKPQKNNGVQAAAPAASLTPASPAENTPKPQTRVTDMRTEDIGGD 69

Query: 39  VHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFI 98
             L   DG  FSLS L  K  I+ FG+T+C  VCPT L      LKQ+      +   F+
Sbjct: 70  FTLTDGDGKPFSLSDLKGKVVILSFGYTHCPDVCPTELLTYSDTLKQLGDQAKDVKVVFV 129

Query: 99  TVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKSGVEEKYF 157
           ++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    V  ++    E Y 
Sbjct: 130 SIDPERDTPEIIGKYAKQFNPDFIGLTATGDQSLPVIKQQYRVVSAKVNQKE--DGENYL 187

Query: 158 VDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 188 VDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 224


>gi|319639161|ref|ZP_07993913.1| lipoprotein [Neisseria mucosa C102]
 gi|317399572|gb|EFV80241.1| lipoprotein [Neisseria mucosa C102]
          Length = 220

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/164 (31%), Positives = 80/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   DG  FSLS L  K  I+ FG+T+C  VCPT L      LKQ+     
Sbjct: 59  KEDIGGDFTLTDGDGKPFSLSDLKGKVVILSFGYTHCPDVCPTELLTYSDTLKQLGDQAK 118

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPEV+ K+ ++F+   IG++      + V K  +R+    V  ++ 
Sbjct: 119 DVKVVFVSIDPERDTPEVIGKYAKQFNPDFIGLTATGDQSLPVIKQQYRVVSAKVNQKE- 177

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 178 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVKTLL 220


>gi|225075941|ref|ZP_03719140.1| hypothetical protein NEIFLAOT_00965 [Neisseria flavescens
           NRL30031/H210]
 gi|241760175|ref|ZP_04758272.1| lipoprotein [Neisseria flavescens SK114]
 gi|261381338|ref|ZP_05985911.1| antioxidant, AhpC/TSA family [Neisseria subflava NJ9703]
 gi|224952656|gb|EEG33865.1| hypothetical protein NEIFLAOT_00965 [Neisseria flavescens
           NRL30031/H210]
 gi|241319372|gb|EER55830.1| lipoprotein [Neisseria flavescens SK114]
 gi|284795698|gb|EFC51045.1| antioxidant, AhpC/TSA family [Neisseria subflava NJ9703]
          Length = 220

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/164 (31%), Positives = 80/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   DG  FSLS L  K  I+ FG+T+C  VCPT L      LKQ+     
Sbjct: 59  KEDIGGDFTLTDGDGKPFSLSDLKGKVVILSFGYTHCPDVCPTELLTYSDTLKQLGDQAK 118

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPEV+ K+ ++F+   IG++      + V K  +R+    V  ++ 
Sbjct: 119 DVKVVFVSIDPERDTPEVIGKYAKQFNPDFIGLTATGDQSLPVIKQQYRVVSAKVNQKE- 177

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 178 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVKTLL 220


>gi|316936156|ref|YP_004111138.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           DX-1]
 gi|315603870|gb|ADU46405.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           DX-1]
          Length = 199

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 53/198 (26%), Positives = 93/198 (46%), Gaps = 9/198 (4%)

Query: 2   KALGIILGTILLAV-----LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           K++  ++     A      L  + ++    + +           L   +G   +  S+  
Sbjct: 6   KSIRPLVIVAAFAGSLIVGLVVVLWLLGGLQKISAPATIGGPFRLTDHNGQIVTEQSMKG 65

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           KP+++FFGFT C  VCPT+L  L ++L  +      +NAYF++VDP+RDTP+ MK ++  
Sbjct: 66  KPTLIFFGFTRCPDVCPTSLFELSQVLAAMGSDADRINAYFVSVDPERDTPQSMKDYLSS 125

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F   + G+ G P    ++ K +R+Y   V  +       Y +DHT  + L D +G+ V  
Sbjct: 126 FDPHLKGLVGTPEATEKIEKGYRVYAKKVPLKD----GDYTMDHTALIYLMDKSGNFVAP 181

Query: 177 IPYKDDSDSAIEKINRLI 194
              K   + A   + R +
Sbjct: 182 FNIKRKPEEAAADLKRYL 199


>gi|33594593|ref|NP_882237.1| SCO1/SenC family protein [Bordetella pertussis Tohama I]
 gi|33598719|ref|NP_886362.1| SCO1/SenC family protein [Bordetella parapertussis 12822]
 gi|33603794|ref|NP_891354.1| SCO1/SenC family protein [Bordetella bronchiseptica RB50]
 gi|33564669|emb|CAE43991.1| SCO1/SenC family protein [Bordetella pertussis Tohama I]
 gi|33574849|emb|CAE39512.1| SCO1/SenC family protein [Bordetella parapertussis]
 gi|33577919|emb|CAE35184.1| SCO1/SenC family protein [Bordetella bronchiseptica RB50]
          Length = 200

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 92/188 (48%), Gaps = 4/188 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
            +G   L      +  +F    + G  +    + LV  +G   +L     K  +VFFGFT
Sbjct: 17  AMGVAALLAACGESAPAFKGSDITGT-QLGKKLALVDHNGKPRTLQDFAGKAVVVFFGFT 75

Query: 67  NCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISG 126
            C  VCPT+L+ L +++KQ+ P    +    +TVDP+RDTPE++K++V  F  R +G++G
Sbjct: 76  QCPDVCPTSLAELSQVMKQLGPDADRVQVLLVTVDPERDTPEILKQYVTTFDPRFLGLTG 135

Query: 127 DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSA 186
            P  + + A +F+ Y   V  +       Y +DHT A  LFD  G    +      +++ 
Sbjct: 136 TPEQIKQAAASFKAYYAKVPTQD---GANYTMDHTAAFYLFDGKGESRVLATNTAGAEAL 192

Query: 187 IEKINRLI 194
              I  L+
Sbjct: 193 AHDIKALL 200


>gi|261400992|ref|ZP_05987117.1| antioxidant, AhpC/TSA family [Neisseria lactamica ATCC 23970]
 gi|313668043|ref|YP_004048327.1| lipoprotein [Neisseria lactamica ST-640]
 gi|269209107|gb|EEZ75562.1| antioxidant, AhpC/TSA family [Neisseria lactamica ATCC 23970]
 gi|313005505|emb|CBN86941.1| putative lipoprotein [Neisseria lactamica 020-06]
          Length = 220

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 80/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   DG  FSLS L  K  I+ FG+T+C  VCPT L      LKQ+     
Sbjct: 59  KEDIGGDFTLTDGDGKPFSLSDLKGKVVILSFGYTHCPDVCPTELLTYSDTLKQLGDQAK 118

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    V  ++ 
Sbjct: 119 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGDQSLPVIKQQYRVVSAKVNQKE- 177

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 178 -DGENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 220


>gi|255067043|ref|ZP_05318898.1| antioxidant, AhpC/TSA family [Neisseria sicca ATCC 29256]
 gi|255048639|gb|EET44103.1| antioxidant, AhpC/TSA family [Neisseria sicca ATCC 29256]
          Length = 237

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 83/164 (50%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   DG  FSLS L  K  I+ FG+T+C  VCPT L      LKQ+     
Sbjct: 76  KEDIGGDFTLTDGDGKPFSLSDLKGKVVILSFGYTHCPDVCPTELLTYSDTLKQLGDQAK 135

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPEV+ K+V++F+   IG++      + V K  +R+  + V+ ++ 
Sbjct: 136 DVKVVFVSIDPERDTPEVISKYVKQFNPEFIGLTATGDQSLPVIKQQYRVVSSKVVQKE- 194

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  +  +    I +L+
Sbjct: 195 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPATIAADIKKLL 237


>gi|261379003|ref|ZP_05983576.1| antioxidant, AhpC/TSA family [Neisseria cinerea ATCC 14685]
 gi|269144532|gb|EEZ70950.1| antioxidant, AhpC/TSA family [Neisseria cinerea ATCC 14685]
          Length = 215

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 55/210 (26%), Positives = 89/210 (42%), Gaps = 23/210 (10%)

Query: 6   IILGTILLAVLGSI----------AYVSFSSKFVDGNRR----------FNSDVHLVAQD 45
            +L    LA L +              + S+       +             D  L   D
Sbjct: 8   FLLSIFALASLAACKPQENNAAQATASAVSAAENSPKPQTRGTDMRQEDIGGDFTLTDGD 67

Query: 46  GTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRD 105
           G  FSLS L  K  I+ FG+T+C  VCPT L      LKQ+      +   F+++DP+RD
Sbjct: 68  GKPFSLSDLKGKVVILSFGYTHCPDVCPTELLTYSDTLKQLGDQAKDVKVVFVSIDPERD 127

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKSGVEEKYFVDHTTAL 164
           TPE++ K+ ++F+   IG++      + V K  +R+    V  +     E Y VDH++  
Sbjct: 128 TPEIIGKYAKQFNPDFIGLTATGDQSLPVIKQQYRVVSAKVNQKD--DSENYLVDHSSGA 185

Query: 165 LLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            L D  G +    PY  + ++    +  L+
Sbjct: 186 YLIDKNGEVAIFSPYGSEPETIAADVRTLL 215


>gi|222087058|ref|YP_002545593.1| cytochrome-c oxidase assembly factor protein [Agrobacterium
           radiobacter K84]
 gi|221724506|gb|ACM27662.1| cytochrome-c oxidase assembly factor protein [Agrobacterium
           radiobacter K84]
          Length = 197

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 65/195 (33%), Positives = 106/195 (54%), Gaps = 6/195 (3%)

Query: 3   ALGIILGTILLAVLGSIAYVSFS--SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
            +  ILG +LL V G++ Y ++S   +         +   L    G   +  +L   PS+
Sbjct: 7   TIPAILGIVLLIVCGALGYFTWSLMPRADAAETNIGAAFTLTDDRGQPITEQALKGHPSL 66

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           ++FG+T+C  VCPTTL  +    K +   G  L AYF +VDP+RDTP++M  +   F+DR
Sbjct: 67  IYFGYTHCPEVCPTTLYEMAGWFKALGDQGDALKAYFFSVDPERDTPQIMHNYTGNFTDR 126

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I GI+GDP ++ +  K +RIY   +       +  Y +DHT ++LL    G++  +I Y 
Sbjct: 127 ITGITGDPNEMQKAIKGWRIYAKRMPT----PDGDYTMDHTASVLLVGADGNLRSMIAYG 182

Query: 181 DDSDSAIEKINRLIT 195
           +D + A++KI  L+ 
Sbjct: 183 EDPNIALQKIRNLLQ 197


>gi|50306505|ref|XP_453226.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49642360|emb|CAH00322.1| KLLA0D03630p [Kluyveromyces lactis]
          Length = 312

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 54/200 (27%), Positives = 86/200 (43%), Gaps = 15/200 (7%)

Query: 9   GTILLAVLGSIAYVSFSSKFV-------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              L  ++G   Y  F ++                G         L+  +G  F+   L 
Sbjct: 95  AAALFILIGGGVYYFFKNEKQRLETEKEAEANRGYGRPLVGGPFSLIDFNGNPFTEKDLL 154

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
            K SI++FGF++C  +CP  L +L   L ++      L   FIT DP RD PEV+K+++ 
Sbjct: 155 GKFSIIYFGFSHCPDICPDELDKLGAWLTELKKRDINLQPVFITCDPARDPPEVLKEYLS 214

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F   IIG++GD   V    K +R+Y +          + Y VDH+    L D  G  + 
Sbjct: 215 EFHPDIIGLTGDYDAVKNACKKYRVYFSTPP--NVKPGQDYLVDHSIFFYLMDPEGQFID 272

Query: 176 VIPYKDDSDSAIEKINRLIT 195
            +    D  + +EKI   ++
Sbjct: 273 ALGRNYDEQTGVEKIVEHVS 292


>gi|71000357|ref|XP_754873.1| mitochondrial metallochaperone Sco1 [Aspergillus fumigatus Af293]
 gi|66852510|gb|EAL92835.1| mitochondrial metallochaperone Sco1, putative [Aspergillus
           fumigatus Af293]
 gi|159127886|gb|EDP53001.1| mitochondrial metallochaperone Sco1, putative [Aspergillus
           fumigatus A1163]
          Length = 303

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 59/215 (27%), Positives = 93/215 (43%), Gaps = 20/215 (9%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G I Y     + ++           G  +      L   DG +F+   
Sbjct: 89  WKAALLFVLTGAGMIVYFRVEKERLERKRIAEMSKGVGRPKVGGPFTLTDLDGKEFTAED 148

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++ +V       N     FIT DP RDTP+V+
Sbjct: 149 LKGKYSFVYFGFTHCPDICPDELDKMAEIIDRVKEATKGENIFLPVFITCDPARDTPQVL 208

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +++++ F   IIG++G    V  V K +R+Y +    +     E Y VDH+    L D  
Sbjct: 209 REYLKEFHPDIIGLTGTYEQVKHVCKQYRVYFST--PKDVKPGEDYLVDHSIYFYLMDPD 266

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT----YGNVVK 201
              V  I  +D  +SA + I + I      G  +K
Sbjct: 267 NDFVECIGRQDTPESASKVILQHINDWKREGKPLK 301


>gi|297539326|ref|YP_003675095.1| electron transport protein SCO1/SenC [Methylotenera sp. 301]
 gi|297258673|gb|ADI30518.1| electron transport protein SCO1/SenC [Methylotenera sp. 301]
          Length = 211

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 53/194 (27%), Positives = 87/194 (44%), Gaps = 3/194 (1%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           +KA+ +++    L+        S           F     L    G   +L+    K   
Sbjct: 21  LKAICLVVFLSFLSACKPAGEASQLVATDITGADFGQSFSLTDHTGKTRTLADFKGKAVA 80

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFG+T+C  VCPTT+  L + +K + P    +   F+T+DP RD+ EV+ +FV  F  R
Sbjct: 81  LFFGYTHCPDVCPTTMLDLKQTMKLLGPRADEVQVLFVTLDPARDSQEVLAQFVPSFDKR 140

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
            IG+ GD   +   A  F+IY   V A+       Y +DH+  + +FD  G I   + Y 
Sbjct: 141 FIGLRGDEPTIAATAATFKIYAKKVEAQGK---GGYTLDHSAGMYIFDKTGKIRLYVDYG 197

Query: 181 DDSDSAIEKINRLI 194
           +        I +++
Sbjct: 198 EKPADIANDIKQIL 211


>gi|39937746|ref|NP_950022.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           CGA009]
 gi|39651606|emb|CAE30128.1| possible inner mitochondrial membrane protein Sco1p
           [Rhodopseudomonas palustris CGA009]
          Length = 199

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 55/198 (27%), Positives = 95/198 (47%), Gaps = 9/198 (4%)

Query: 2   KALGIILGTILLAV-----LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           K++  ++     A      L  + ++    + +           L  Q+G   +  S+  
Sbjct: 6   KSIRPLVVIAAFAGSLIVGLVVVLWLLGGLQKISAPATIGGAFRLTDQNGQVITEQSMKG 65

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           KP+++FFGFT C  VCPT+L  L ++L  + P    +NAYF++VDP+RDTP+ MK ++  
Sbjct: 66  KPTLIFFGFTRCPDVCPTSLFELSQVLGAMGPDADRINAYFVSVDPERDTPQSMKDYLSS 125

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F   + G+ G P    ++ K +R+Y   V  +       Y +DHT  + L D +G+ V  
Sbjct: 126 FDPHLKGLVGTPEATEKIEKAYRVYAKKVPLKD----GDYTMDHTALIYLMDKSGNFVSP 181

Query: 177 IPYKDDSDSAIEKINRLI 194
              K   + A   + R +
Sbjct: 182 FNIKRKPEEAAADLKRYL 199


>gi|170751020|ref|YP_001757280.1| electron transport protein SCO1/SenC [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657542|gb|ACB26597.1| electron transport protein SCO1/SenC [Methylobacterium
           radiotolerans JCM 2831]
          Length = 193

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 56/197 (28%), Positives = 88/197 (44%), Gaps = 7/197 (3%)

Query: 1   MKALGIILGTI---LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           M+   + L      L+ + G+  +     K   G         LV QDG   +       
Sbjct: 1   MRRALVPLVAFCLGLVGLTGAAVFAFLPDKAPVGVPSVGGPFTLVNQDGRTVTERDFAGA 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             +VFFGFT+C  VCPTTL ++  +L  + P G  +   F+TVDP+RD P  +K ++  F
Sbjct: 61  THLVFFGFTHCPDVCPTTLQQISDVLAALGPKGKTMRVAFVTVDPERDDPASLKTYLSSF 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
             RI G++G P  V    K +R Y   V A+       Y ++HT  + + D     VG +
Sbjct: 121 DPRITGLTGTPEQVTATEKAYRAYARKVPAKD----GDYTMEHTALVYVMDAQNRFVGAL 176

Query: 178 PYKDDSDSAIEKINRLI 194
                +D    ++ + I
Sbjct: 177 DLTRPADEVAAQLAKKI 193


>gi|121603797|ref|YP_981126.1| electron transport protein SCO1/SenC [Polaromonas naphthalenivorans
           CJ2]
 gi|120592766|gb|ABM36205.1| electron transport protein SCO1/SenC [Polaromonas naphthalenivorans
           CJ2]
          Length = 210

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 54/195 (27%), Positives = 87/195 (44%), Gaps = 7/195 (3%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSD----VHLVAQDGTDFSLSSLYIKPSI 60
            +     L    G +   +             +D      L   +G   +L     K  +
Sbjct: 17  TLAALMALSMSAGVLTGCAPDKPQFKSIDLTGADYAQGFSLADHNGQLRTLKDFAGKVVV 76

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT C  VCPT+++ L  + KQ+   G  L A FITVDP+RDTPE++K ++  F   
Sbjct: 77  VFFGFTQCPDVCPTSMAELAEIKKQLGADGDKLQAIFITVDPERDTPEMLKAYMGNFDPT 136

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
            + +   P  + +VA++F+IY   V  +    +  Y +DH+    +FD  G +     Y 
Sbjct: 137 FVALRPTPEQLAQVARDFKIYYKKVDGK---TQGSYTMDHSAGSYIFDPQGRVRLYSRYG 193

Query: 181 DDSDSAIEKINRLIT 195
             +++    I  LI 
Sbjct: 194 SGAEALASDIRLLIK 208


>gi|209519823|ref|ZP_03268608.1| electron transport protein SCO1/SenC [Burkholderia sp. H160]
 gi|209499766|gb|EDZ99836.1| electron transport protein SCO1/SenC [Burkholderia sp. H160]
          Length = 209

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 60/194 (30%), Positives = 96/194 (49%), Gaps = 5/194 (2%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
           A G  LG  LL         +FS+  + GN +F SD  L    G   +L+    K  ++F
Sbjct: 18  AFGAALGGSLLMAGCGKQPPAFSNLDITGNTQFASDFSLPDTSGKIRTLADYKGKVVVLF 77

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FG+T+C  VCPTT++ L + L+Q        +   F+TVDP+RDTP+++ ++V  F+   
Sbjct: 78  FGYTHCPDVCPTTMAELSQALQQFGPEDAKRVQVLFVTVDPERDTPQLLAQYVPAFNPSF 137

Query: 122 IG-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           +G        + +VAK+FR+Y   V  +     + Y +DHT A  +FDT G +       
Sbjct: 138 VGLRPASEEQLAKVAKDFRVYYAKVPGK---TPDSYTMDHTAASYVFDTDGKLRLFARDG 194

Query: 181 DDSDSAIEKINRLI 194
             +   +  I  L+
Sbjct: 195 QGATPWVHDIKLLL 208


>gi|90422242|ref|YP_530612.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           BisB18]
 gi|90104256|gb|ABD86293.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           BisB18]
          Length = 196

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 56/193 (29%), Positives = 86/193 (44%), Gaps = 15/193 (7%)

Query: 13  LAVLGSIAYVSFSS-----------KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           L ++G+ A                 + V           L  Q G   +  SL  KP+++
Sbjct: 8   LVIIGAFAGSLVVGLVVVLWLAGGLRNVTAPSTVGGPFQLTDQGGESVTEQSLKGKPTLI 67

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFGFT+C  VCPT L  +  +L+ +      +NAYF++VDP+RDT   MK ++  F   +
Sbjct: 68  FFGFTHCPDVCPTALFEISEVLRAMGKDADRVNAYFVSVDPERDTQAAMKDYLASFDPHL 127

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
            G++GD   V +V   FR+Y   V  +       Y +DHT  + L D  G  V     K 
Sbjct: 128 KGLTGDAAAVAKVISGFRVYARKVPLKD----GDYTMDHTALIYLMDRDGKFVAPFNLKR 183

Query: 182 DSDSAIEKINRLI 194
             + A   + R +
Sbjct: 184 KPEEAAADLKRYL 196


>gi|288576072|ref|ZP_05978136.2| antioxidant, AhpC/TSA family [Neisseria mucosa ATCC 25996]
 gi|288566341|gb|EFC87901.1| antioxidant, AhpC/TSA family [Neisseria mucosa ATCC 25996]
          Length = 237

 Score =  131 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 52/164 (31%), Positives = 82/164 (50%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   DG  FSLS L  K  I+ FG+T+C  VCPT L      LKQ+     
Sbjct: 76  KEDIGGDFTLTDGDGKPFSLSDLKGKVVILSFGYTHCPDVCPTELLTYSDTLKQLGDQAK 135

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPEV+ K+V++F+   IG++      + + K  +R+    V+ ++ 
Sbjct: 136 DVKVVFVSIDPERDTPEVIGKYVKQFNPEFIGLTPTGDQSLPIIKQQYRVVSAKVVQKE- 194

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  +  +    I +L+
Sbjct: 195 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPATIAADIKKLL 237


>gi|86139684|ref|ZP_01058251.1| probable lipoprotein [Roseobacter sp. MED193]
 gi|85823575|gb|EAQ43783.1| probable lipoprotein [Roseobacter sp. MED193]
          Length = 200

 Score =  131 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 52/195 (26%), Positives = 91/195 (46%), Gaps = 4/195 (2%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFV--DGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           K L ++ G   LA +  + +  + +     D +  F +   L    G   +      +  
Sbjct: 8   KFLWVLAGAAALAFVWLLLWSDYRADRARTDTDPAFLAAFELTDHQGMVRTEEDFSGRWM 67

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +VFFGF+NC  VCP+TLS +  ++  +      +   FIT+DP+RDTP  + +FV  F  
Sbjct: 68  LVFFGFSNCPDVCPSTLSEVAAVMDGLGDNAARVQPIFITIDPERDTPMALAEFVPLFDA 127

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
            IIG++G P  +   ++ F I+   +  E++   + Y + HT+ L LFD         PY
Sbjct: 128 NIIGLTGTPEQIAATSETFPIFFERI--EEATAPDGYTIGHTSHLFLFDPEAGFADSWPY 185

Query: 180 KDDSDSAIEKINRLI 194
              ++  +  +   I
Sbjct: 186 GTSAEEILADLEERI 200


>gi|17545092|ref|NP_518494.1| lipoprotein [Ralstonia solanacearum GMI1000]
 gi|17427382|emb|CAD13901.1| probable lipoprotein [Ralstonia solanacearum GMI1000]
          Length = 200

 Score =  131 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 48/174 (27%), Positives = 86/174 (49%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G + F +   L    G   +L     K  ++FFG+T+C  VCPTTL+ L  
Sbjct: 29  PAFQNLDITGAKSFGAGFSLTDHTGKRRTLEDFRGKVVVMFFGYTHCPDVCPTTLAELRG 88

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           ++  +      +   F+TVDP+RDT +++ K+V  F  R IG    +  ++ +VAK+F++
Sbjct: 89  VMDGLGKDADRVQVLFVTVDPQRDTQDLLAKYVPAFDPRFIGLRPANDQELQKVAKDFKV 148

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           + + V        + Y +DHT    +FD  G++   I +       +  I  L+
Sbjct: 149 FYSKVPG---STPDNYTMDHTAGSYMFDPKGNLRLFIKHGQGPAPIVHDIKLLL 199


>gi|224823482|ref|ZP_03696591.1| electron transport protein SCO1/SenC [Lutiella nitroferrum 2002]
 gi|224603937|gb|EEG10111.1| electron transport protein SCO1/SenC [Lutiella nitroferrum 2002]
          Length = 195

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 75/162 (46%), Gaps = 4/162 (2%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
           +F  D  L    G   SLS    K   +FFG+T+C  VCPTT+      +K +      +
Sbjct: 38  KFGGDFTLTDHTGKPRSLSEFKGKVVALFFGYTHCPDVCPTTMLEFASAMKLLGSQADQV 97

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              FITVDP+RDTP ++  +V  F  R IG+SG P  V  V   F+I        ++   
Sbjct: 98  QVLFITVDPERDTPALLAGYVPHFDPRFIGLSGSPEAVREVEARFKIVAQK----RAEPG 153

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
             Y VDH+    LFD +G +   +PY   +      I  LI 
Sbjct: 154 GGYSVDHSAGAYLFDRSGQLRVYLPYGLPAADLAHDIKELIR 195


>gi|167835325|ref|ZP_02462208.1| SCO1/SenC family protein [Burkholderia thailandensis MSMB43]
          Length = 205

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 54/193 (27%), Positives = 93/193 (48%), Gaps = 6/193 (3%)

Query: 5   GIILGTIL--LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            +    +   L + G     +F +  + GN +F  D  L    G   +L     K  +VF
Sbjct: 15  WLFACALAGALLIAGCNQQPAFQNLDITGNSQFTGDFALPDTTGKIRTLGEFKGKAVVVF 74

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  VCPTT++ L + L+Q+ P G  +   F+TVDP+RDT  ++ ++V  F+   +
Sbjct: 75  FGYTHCPDVCPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAAILGQYVPAFNPAFV 134

Query: 123 G-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           G    D   + +V K+FR+Y   V  +     + Y +DHT A  +FD +G +   +    
Sbjct: 135 GLRPADEAQLKKVTKDFRVYYAKVPGK---TPDSYTMDHTAASYVFDPSGKLRLFVRDGQ 191

Query: 182 DSDSAIEKINRLI 194
                +  +  L+
Sbjct: 192 GPGPWVHDLKLLL 204


>gi|169865504|ref|XP_001839351.1| h-sco1 [Coprinopsis cinerea okayama7#130]
 gi|116499572|gb|EAU82467.1| h-sco1 [Coprinopsis cinerea okayama7#130]
          Length = 223

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 82/202 (40%), Gaps = 15/202 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
               L A +G   Y       +             G         L   +G  F+   + 
Sbjct: 15  AALFLAAGVGLWFYFRHEKARLLEEREKERQSRQYGRPNLGGPFTLTTHEGKPFTEKEME 74

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K S+V+FGFTNC  +CP  L ++  +L       G +    FITVDP RD P  + +++
Sbjct: 75  GKWSLVYFGFTNCPDICPAELDKMTEVLNAVQKEHGDIFLPLFITVDPARDLPHRIARYL 134

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           + F    +G+ GD  D   + K +R+Y +      +     Y VDH+  + L D AG  V
Sbjct: 135 EDFHPSFVGLYGDYADTKAICKKYRVYFSTPP--NADPNGDYLVDHSIFVYLMDPAGKFV 192

Query: 175 GVIPYKDDSDSAIEKINRLITY 196
                    +  +EKI + I+ 
Sbjct: 193 EAFGQSVTGEEVVEKIQKAISE 214


>gi|50290053|ref|XP_447458.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526768|emb|CAG60395.1| unnamed protein product [Candida glabrata]
          Length = 294

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 57/196 (29%), Positives = 89/196 (45%), Gaps = 16/196 (8%)

Query: 9   GTILLAVLGSIAYVSFSSKFV-------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              L  V+G ++Y  F+++                G         LV  +G +F+  +L 
Sbjct: 75  AIALFLVVGGVSYYVFTNEKKKLEARKEAEANRGYGKPSLGGPFTLVDTEGKEFTEKNLR 134

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K SIV+FGF++C  +CP  L +L   L          L   FIT DP RD+PEV+K+++
Sbjct: 135 GKFSIVYFGFSHCPDICPDELDKLGEWLDVLDKKHDIHLQPIFITCDPARDSPEVLKQYL 194

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F D IIG++G    V    K +R+Y +          + Y VDH+    L D  G+ V
Sbjct: 195 SDFHDGIIGLTGTYDQVKHACKQYRVYFSTPP--NVKPGQDYLVDHSIFFYLMDPEGNFV 252

Query: 175 GVIPYKDDSDSAIEKI 190
             +    D  + ++KI
Sbjct: 253 EALGRNYDETTGVDKI 268


>gi|192293527|ref|YP_001994132.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           TIE-1]
 gi|192287276|gb|ACF03657.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           TIE-1]
          Length = 199

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 54/198 (27%), Positives = 95/198 (47%), Gaps = 9/198 (4%)

Query: 2   KALGIILGTILLAV-----LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           K++  ++     A      L  + ++    + +           L  Q+G   +  S+  
Sbjct: 6   KSIRPLVVIAAFAGSLIVGLVVVLWLLGGLQKISAPATIGGAFRLTDQNGQVITEQSMKG 65

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           KP+++FFGFT C  VCPT+L  L ++L  + P    +NAYF++VDP+RDTP+ MK ++  
Sbjct: 66  KPTLIFFGFTRCPDVCPTSLFELSQVLGAMGPDADRINAYFVSVDPERDTPQSMKDYLSS 125

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F   + G+ G P    ++ K +R+Y   V  +       Y +DHT  + L D +G+ +  
Sbjct: 126 FDPHLKGLVGTPEATEKIEKAYRVYAKKVPLKD----GDYTMDHTALIYLMDKSGNFISP 181

Query: 177 IPYKDDSDSAIEKINRLI 194
              K   + A   + R +
Sbjct: 182 FNIKRKPEEAAADLKRYL 199


>gi|161870433|ref|YP_001599605.1| lipoprotein [Neisseria meningitidis 053442]
 gi|304387010|ref|ZP_07369266.1| AhpC/TSA family antioxidant [Neisseria meningitidis ATCC 13091]
 gi|161595986|gb|ABX73646.1| lipoprotein [Neisseria meningitidis 053442]
 gi|304338919|gb|EFM05017.1| AhpC/TSA family antioxidant [Neisseria meningitidis ATCC 13091]
 gi|319410795|emb|CBY91180.1| putative SCO1-like lipoprotein [Neisseria meningitidis WUE 2594]
 gi|325142758|gb|EGC65132.1| antioxidant, AhpC/TSA family [Neisseria meningitidis 961-5945]
 gi|325201746|gb|ADY97200.1| antioxidant, AhpC/TSA family [Neisseria meningitidis M01-240149]
 gi|325208510|gb|ADZ03962.1| antioxidant, AhpC/TSA family [Neisseria meningitidis NZ-05/33]
          Length = 217

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 79/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   +G  FSLS L  K  I+ FGFT+C  VCPT L      LKQ+     
Sbjct: 56  KEDIGGDFTLTDGEGKPFSLSDLKGKVVILSFGFTHCPDVCPTELLTYSDTLKQLGGQAK 115

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    V  +  
Sbjct: 116 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGDQNLPVIKQQYRVVSAKVNQKD- 174

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 175 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 217


>gi|121635235|ref|YP_975480.1| putative lipoprotein [Neisseria meningitidis FAM18]
 gi|120866941|emb|CAM10701.1| putative lipoprotein [Neisseria meningitidis FAM18]
 gi|254669678|emb|CBA03777.1| SCO1/SenC family protein [Neisseria meningitidis alpha153]
 gi|254672367|emb|CBA05602.1| SCO1/SenC family protein [Neisseria meningitidis alpha275]
 gi|325132737|gb|EGC55420.1| antioxidant, AhpC/TSA family [Neisseria meningitidis M6190]
 gi|325138622|gb|EGC61181.1| antioxidant, AhpC/TSA family [Neisseria meningitidis ES14902]
 gi|325198688|gb|ADY94144.1| antioxidant, AhpC/TSA family [Neisseria meningitidis G2136]
          Length = 217

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 79/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   +G  FSLS L  K  I+ FGFT+C  VCPT L      LKQ+     
Sbjct: 56  KEDIGGDFTLTDGEGKPFSLSDLKGKVVILSFGFTHCPDVCPTELLTYSDTLKQLGGQAK 115

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    V  +  
Sbjct: 116 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGDQNLPVIKQQYRVVSAKVNQKD- 174

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 175 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 217


>gi|50553760|ref|XP_504291.1| YALI0E23045p [Yarrowia lipolytica]
 gi|49650160|emb|CAG79890.1| YALI0E23045p [Yarrowia lipolytica]
          Length = 305

 Score =  130 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 85/201 (42%), Gaps = 14/201 (6%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLY 55
           +    + + +G   +       V            G         L    G  FS   L 
Sbjct: 86  VFALFVASGVGIYWFFQSEKAKVTQRREAEANRGYGKPLVGGPFVLQDHKGGIFSSEDLK 145

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K S+++FGF+ C  +CP  L ++  ++ +        L   FIT DP RD+PEV+++++
Sbjct: 146 GKFSLLYFGFSMCPDICPDELDKMAIMIDEVNKSNPGQLQPLFITCDPARDSPEVLEEYL 205

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  +I+G++G   ++ +  K +R+Y +          + Y VDH+    L D  G  +
Sbjct: 206 SEFHPQILGLTGTYDEIKQTCKAYRVYFSTPP--NVKPGQDYLVDHSIFFYLMDPEGQFL 263

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
            V+     ++ A+ KI   I 
Sbjct: 264 DVLGRNLTAEEAVAKIREDIK 284


>gi|119492837|ref|XP_001263716.1| mitochondrial metallochaperone Sco1, putative [Neosartorya fischeri
           NRRL 181]
 gi|119411876|gb|EAW21819.1| mitochondrial metallochaperone Sco1, putative [Neosartorya fischeri
           NRRL 181]
          Length = 303

 Score =  130 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 59/215 (27%), Positives = 94/215 (43%), Gaps = 20/215 (9%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G I Y     + ++           G  +      L+  DG +F+   
Sbjct: 89  WKAALLFVLTGAGMIVYFRVEKERLERKRIAEMSKGVGRPKVGGPFTLMDLDGKEFTAED 148

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++ +V       N     FIT DP RDTP+V+
Sbjct: 149 LKGKYSFVYFGFTHCPDICPDELDKMAEIIDRVKEATKGENIFLPVFITCDPARDTPQVL 208

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +++++ F   IIG++G    V  V K +R+Y +    +     E Y VDH+    L D  
Sbjct: 209 REYLKEFHPDIIGLTGTYEQVKHVCKQYRVYFST--PKDVKPGEDYLVDHSIYFYLMDPD 266

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT----YGNVVK 201
              V  I  +D  +SA + I + I      G  +K
Sbjct: 267 NDFVECIGRQDTPESASKLILQHINDWKREGKPLK 301


>gi|328771922|gb|EGF81961.1| hypothetical protein BATDEDRAFT_10044 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 220

 Score =  130 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/214 (22%), Positives = 83/214 (38%), Gaps = 13/214 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD---------GNRRFNSDVHLVAQDGTDFSL 51
           M    ++   I   VL +  Y        +         G  +      LV Q G   + 
Sbjct: 1   MTKKSVVFFLISGVVLLAYFYYEQQQAKAEQEAKKSEGVGKPKVGGPFSLVDQTGRPVTD 60

Query: 52  SSLYIKPSIVFFGFTNCSAVCPT----TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTP 107
                K  +++FG+T C  VCP         +D L      +   +   F++ DPKRD+ 
Sbjct: 61  LDYRGKYMLLYFGYTFCPDVCPEELEKMAEIVDFLNGMEGYSQETIVPIFVSCDPKRDSV 120

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E +++++Q F  + IG++G    + R+AK +R+Y +         E  Y VDH+    L 
Sbjct: 121 ESIREYLQDFHPKFIGLTGTYNQIRRIAKAYRLYFSAPPQAVDEDETDYLVDHSIFFYLV 180

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK 201
              G  +      + ++    KI   I  G   +
Sbjct: 181 GPDGVYISHFGKNETAEEVTLKIIDHIKQGRTTR 214


>gi|224140443|ref|XP_002323592.1| predicted protein [Populus trichocarpa]
 gi|222868222|gb|EEF05353.1| predicted protein [Populus trichocarpa]
          Length = 327

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/214 (22%), Positives = 87/214 (40%), Gaps = 21/214 (9%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD----------------GNRRFNSDVHLVAQDGTD 48
            +    +     G I Y     K                   G        +L+  DG  
Sbjct: 115 WLSFLFLAATGAGLIWYYDRMKKQRIEAINKTSAIVKVGPSVGKPEIGGPFNLIDHDGKP 174

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTP 107
            S      K ++++FGFT+C  +CP  L +L   + ++           FITVDP+RD  
Sbjct: 175 VSEKDFMGKWTMIYFGFTHCPDICPDELQKLAAAIDKIKEKAGFDIVPVFITVDPERDNV 234

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E ++++V+ F  ++IG++G   ++ + A+ +RIY      E       Y VDH+    L 
Sbjct: 235 EQVREYVKEFHPKLIGLTGSLEEIKKTARAYRIYYMKTSEED----SDYLVDHSIITYLM 290

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK 201
           D    +V      +D+D+  + + + +     +K
Sbjct: 291 DPNMELVKFFGKNNDADALADGVIKEMKQYKSIK 324


>gi|255710509|ref|XP_002551538.1| KLTH0A01804p [Lachancea thermotolerans]
 gi|238932915|emb|CAR21096.1| KLTH0A01804p [Lachancea thermotolerans]
          Length = 331

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/200 (27%), Positives = 90/200 (45%), Gaps = 15/200 (7%)

Query: 9   GTILLAVLGSIAYVSFSSKFV-------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              L+  LG   Y  FS +                G         LV  +G +F+  +L 
Sbjct: 113 AAALVLTLGGTLYYFFSKEKRRLEIEKEAEANRGYGKPLVGGPFKLVDFNGNEFTEKNLL 172

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
            K SI++FGF++C  +CP  L +L   L  +   G  L   FIT DP RD P V+K+++ 
Sbjct: 173 GKFSIIYFGFSHCPDICPDELDKLSEWLDGLKKKGIELQPIFITCDPARDPPHVLKEYLS 232

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F   +IG++G+  D+    K +R+Y +   +      + Y VDH+    L D  G  + 
Sbjct: 233 EFHPDLIGLTGEYNDIKNACKQYRVYFSTPPS--LKPGQDYLVDHSIFFYLMDPEGQFID 290

Query: 176 VIPYKDDSDSAIEKINRLIT 195
            +  + D+++ + KI   + 
Sbjct: 291 ALGRQYDAETGVAKIEEHVK 310


>gi|321264866|ref|XP_003197150.1| mitochondrial inner membrane protein; Sco2p [Cryptococcus gattii
           WM276]
 gi|317463628|gb|ADV25363.1| Mitochondrial inner membrane protein, putative; Sco2p [Cryptococcus
           gattii WM276]
          Length = 286

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 52/200 (26%), Positives = 80/200 (40%), Gaps = 16/200 (8%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLS 52
                  LL  +G   Y       V             G         L    G  F+  
Sbjct: 71  WKAASLFLLTGVGLYMYFESEKTKVQDRRRQELAAKSVGRPSIGGPFTLTTHKGETFTEQ 130

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVM 110
            L  K S+++FGFT+C  +CP  L ++   ++ VD      +    FITVDP RDT   +
Sbjct: 131 DLKGKWSLIYFGFTHCPDICPEELDKMGEAVEMVDKATGKADVTPIFITVDPARDTLPQV 190

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            K+++ F  R+IG+ GD   V +  K +R+Y +      +   + Y VDH+    L D  
Sbjct: 191 NKYIREFHPRMIGLLGDYEAVKKTCKMYRVYFSTPP--DATAADDYLVDHSIFFYLMDPL 248

Query: 171 GSIVGVIPYKDDSDSAIEKI 190
           G  V        ++   EK+
Sbjct: 249 GQFVDAFGKATSAEQVAEKV 268


>gi|299068069|emb|CBJ39283.1| putative cytochrome c oxidase assembly factor, scoC [Ralstonia
           solanacearum CMR15]
          Length = 200

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 47/174 (27%), Positives = 86/174 (49%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G + F +   L    G   +L     K  ++FFG+T+C  VCPTTL+ L  
Sbjct: 29  PAFQNLDITGAKSFGTGFSLTDHTGKRRTLEDFRGKVVVMFFGYTHCPDVCPTTLAELRG 88

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFRI 140
           ++  +      +   F+TVDP+RDT +++ K+V  F  R IG    +  ++ +VAK+F++
Sbjct: 89  VMDGLGKDADRVQVLFVTVDPQRDTQDLLAKYVPAFDPRFIGLRPANDQELQKVAKDFKV 148

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           + + V        + Y +DHT    +FD  G++   I +       +  +  L+
Sbjct: 149 FYSKVPG---STPDNYTMDHTAGSYMFDPKGNLRLFIKHGQGPAPIVHDVKLLL 199


>gi|218768546|ref|YP_002343058.1| putative lipoprotein [Neisseria meningitidis Z2491]
 gi|121052554|emb|CAM08894.1| putative lipoprotein [Neisseria meningitidis Z2491]
          Length = 217

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 79/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   +G  F+LS L  K  I+ FGFT+C  VCPT L      LKQ+     
Sbjct: 56  KEDIGGDFTLTDGEGKPFNLSDLKGKVVILSFGFTHCPDVCPTELLTYSDTLKQLGGQAK 115

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    V  +  
Sbjct: 116 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGDQNLPVIKQQYRVVSAKVNQKD- 174

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 175 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 217


>gi|167736951|ref|ZP_02409725.1| SCO1/SenC family protein [Burkholderia pseudomallei 14]
 gi|167822576|ref|ZP_02454047.1| SCO1/SenC family protein [Burkholderia pseudomallei 9]
 gi|167909377|ref|ZP_02496468.1| SCO1/SenC family protein [Burkholderia pseudomallei 112]
 gi|226193680|ref|ZP_03789283.1| SCO1/SenC family protein [Burkholderia pseudomallei Pakistan 9]
 gi|225934258|gb|EEH30242.1| SCO1/SenC family protein [Burkholderia pseudomallei Pakistan 9]
          Length = 205

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 92/193 (47%), Gaps = 6/193 (3%)

Query: 5   GIILGTIL--LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            +    +   + + G     +F +  + GN +F SD  L    G   +L     K  +VF
Sbjct: 15  WLFACALAGAMLIAGCNRQPAFQNLDITGNSQFASDFALPDTAGKIRTLGEFKGKAVVVF 74

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  VCPTT++ L + L+Q+ P G  +   F+TVDP+RDT  ++ ++V  F+   I
Sbjct: 75  FGYTHCPDVCPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAALLGQYVPAFNPTFI 134

Query: 123 G-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           G    D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +    
Sbjct: 135 GLRPADEAQLKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDPNGKLRLFVRDGQ 191

Query: 182 DSDSAIEKINRLI 194
                +  +  L+
Sbjct: 192 GPGPWVHDLKLLL 204


>gi|167579712|ref|ZP_02372586.1| SCO1/SenC family protein [Burkholderia thailandensis TXDOH]
 gi|167617788|ref|ZP_02386419.1| SCO1/SenC family protein [Burkholderia thailandensis Bt4]
 gi|257140351|ref|ZP_05588613.1| SCO1/SenC family protein [Burkholderia thailandensis E264]
          Length = 205

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/193 (27%), Positives = 93/193 (48%), Gaps = 6/193 (3%)

Query: 5   GIILGTIL--LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            +    +   + + G     +F +  + GN +F SD  L    G   +L     K  +VF
Sbjct: 15  WLFACALAGAMLIAGCNRQPAFQNLDITGNSQFASDFALPDTTGKIRTLGEFKGKAVVVF 74

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  VCPTT++ L + L+Q+ P G  +   F+TVDP+RDT  ++ ++V  F+   +
Sbjct: 75  FGYTHCPDVCPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAAILGQYVPAFNPTFV 134

Query: 123 G-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           G    D   + +V K+FR+Y   V  +       Y +DHT A  +FD +G +   +    
Sbjct: 135 GLRPADEAQLKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDPSGKLRLFVRDGQ 191

Query: 182 DSDSAIEKINRLI 194
                +  +  L+
Sbjct: 192 GPGPWVHDLKLLL 204


>gi|186475056|ref|YP_001856526.1| electron transport protein SCO1/SenC [Burkholderia phymatum STM815]
 gi|184191515|gb|ACC69480.1| electron transport protein SCO1/SenC [Burkholderia phymatum STM815]
          Length = 205

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 56/190 (29%), Positives = 95/190 (50%), Gaps = 5/190 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
            LG   L         +F++  + GN++F +D  L    G   +L+    K  ++FFG+T
Sbjct: 18  ALGGAALVSGCGKEQPAFTNVDITGNKQFGTDFSLPDSSGKTRTLADYKGKVVVLFFGYT 77

Query: 67  NCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-I 124
           +C  VCPTT++ L + L+Q+       +   F+TVDP+RDTPE+M ++V  F+   +G  
Sbjct: 78  HCPDVCPTTMAELSQALQQLGPEDAKRVQVLFVTVDPERDTPELMAQYVPAFNPTFVGLR 137

Query: 125 SGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSD 184
             D   + +V K+FR+Y   V  +     + Y +DHT A  +FDT G +         + 
Sbjct: 138 PADQAQLTKVTKDFRVYYAKVPGK---SPDSYTMDHTAASYVFDTDGKLRLFARDGQGAS 194

Query: 185 SAIEKINRLI 194
             +  +  L+
Sbjct: 195 PWVHDLKLLL 204


>gi|58270570|ref|XP_572441.1| h-sco1 [Cryptococcus neoformans var. neoformans JEC21]
 gi|134118050|ref|XP_772406.1| hypothetical protein CNBL2720 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255019|gb|EAL17759.1| hypothetical protein CNBL2720 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228699|gb|AAW45134.1| h-sco1, putative [Cryptococcus neoformans var. neoformans JEC21]
          Length = 286

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 53/200 (26%), Positives = 80/200 (40%), Gaps = 16/200 (8%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLS 52
                  LL  +G   Y       V             G         L    G  F+  
Sbjct: 71  WKAASLFLLTGVGLYMYFESEKAKVQDRRRQENASKSVGRPSIGGPFTLTTHKGETFTEQ 130

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVM 110
            L  K S+++FGFT+C  +CP  L ++   ++ VD      +    FITVDP RDT   +
Sbjct: 131 DLRGKWSLIYFGFTHCPDICPEELDKMGEAVEMVDKATGKADVTPIFITVDPARDTLPQV 190

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            K++Q F  R+IG+ GD   V +  K +R+Y +      +   + Y VDH+    L D  
Sbjct: 191 NKYIQEFHPRMIGLLGDYEAVKKTCKMYRVYFSTPP--NATAADDYLVDHSIFFYLMDPL 248

Query: 171 GSIVGVIPYKDDSDSAIEKI 190
           G  V        ++   EK+
Sbjct: 249 GQFVDAFGKATSAEQVAEKV 268


>gi|313201018|ref|YP_004039676.1| electron transport protein sco1/senc [Methylovorus sp. MP688]
 gi|312440334|gb|ADQ84440.1| electron transport protein SCO1/SenC [Methylovorus sp. MP688]
          Length = 191

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 49/191 (25%), Positives = 83/191 (43%), Gaps = 8/191 (4%)

Query: 9   GTILLAVLGSIAYVSFSSKFVDGNRRF-NSDV----HLVAQDGTDFSLSSLYIKPSIVFF 63
             +L  +L  ++      K          +D     HL    G   SL     K  ++FF
Sbjct: 4   ALMLCLILTCLSACKPQPKEAFEATNITGADFASGLHLTDHHGKPASLQDFKGKVIVLFF 63

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           G+T+C  VCPTT+S + + +K +      +   F+T+DP RDTP+V+ K+V  F  R IG
Sbjct: 64  GYTHCPDVCPTTMSDMAQTMKLLGKDANQVQVLFVTLDPARDTPDVLAKYVPYFDPRFIG 123

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           + G   ++   A +F+I  +    ++      Y +DH+    ++D  G I     Y    
Sbjct: 124 LYGTEAEIAGTAHHFKISASKQPPDER---GNYSIDHSAGTYVYDKQGKIRLYFNYGASP 180

Query: 184 DSAIEKINRLI 194
                 +  L+
Sbjct: 181 AMMAHDLRLLM 191


>gi|300021549|ref|YP_003754160.1| electron transporter SCO1/SenC [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523370|gb|ADJ21839.1| electron transport protein SCO1/SenC [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 202

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/182 (29%), Positives = 87/182 (47%), Gaps = 2/182 (1%)

Query: 13  LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           LA+  + +  S  +  V G         L+ Q G   +      K  +VFFGFTNC  +C
Sbjct: 22  LALRSTDSQDSARTAAVSGKPLVGGPFSLIDQTGKRVTDQDFRGKEMLVFFGFTNCPDIC 81

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVM 132
           P  L  +   L Q+      +   FIT+DP+RDTPE M ++++ FS R++G++G   ++ 
Sbjct: 82  PAGLQVMAAALDQLGKKADDVVPLFITLDPERDTPEKMGEYIKNFSPRLVGLTGSASEIA 141

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
             AK +R++   V  EK+     Y VDH+    L    G+ +  IP  +D       I +
Sbjct: 142 ATAKAYRVFYQKVPDEKN--PNNYSVDHSAFFYLMGKDGAFLAPIPITNDPAQLASSIGK 199

Query: 193 LI 194
            +
Sbjct: 200 AL 201


>gi|302307879|ref|NP_984670.2| AEL191Cp [Ashbya gossypii ATCC 10895]
 gi|299789213|gb|AAS52494.2| AEL191Cp [Ashbya gossypii ATCC 10895]
          Length = 294

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/200 (27%), Positives = 90/200 (45%), Gaps = 14/200 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              +LL + G + YV    K               G         LV  +G +F+  +L 
Sbjct: 77  AAAVLLVLGGGLFYVFSREKRRLEVQREAEANRGYGRPAVGGPFQLVDFNGNEFTEKNLL 136

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
            + S+V+FGFT+C  +CP  L +L   L+ +   G  +   F+T DP RD P V+K+++ 
Sbjct: 137 GRFSLVYFGFTHCPDICPAELDKLAAWLRGLKQRGIDVQPIFVTCDPARDPPAVLKEYLA 196

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F   I+G++G   +V +  K +R+Y +          + Y VDH+    L D  G+ V 
Sbjct: 197 EFHPDIVGLTGSYEEVKKACKQYRVYFSTPP--NVKPGQDYLVDHSIFFYLMDPEGAFVD 254

Query: 176 VIPYKDDSDSAIEKINRLIT 195
           V+  + D  +   KI   + 
Sbjct: 255 VLGRQYDEQTGQAKIEEHVK 274


>gi|167901157|ref|ZP_02488362.1| SCO1/SenC family protein [Burkholderia pseudomallei NCTC 13177]
          Length = 205

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 92/193 (47%), Gaps = 6/193 (3%)

Query: 5   GIILGTIL--LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            +    +   + + G     +F +  + GN +F SD  L    G   +L     K  +VF
Sbjct: 15  WLFACALAGAMLIAGCNRQPAFQNLDITGNSQFASDFALPDTAGKIRTLGEFKGKAVVVF 74

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  VCPTT++ L + L+Q+ P G  +   F+TVDP+RDT  ++ ++V  F+   I
Sbjct: 75  FGYTHCPDVCPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAALLGQYVPAFNPAFI 134

Query: 123 G-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           G    D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +    
Sbjct: 135 GLRPADEAQLKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDPNGKLRLFVRDGQ 191

Query: 182 DSDSAIEKINRLI 194
                +  +  L+
Sbjct: 192 GPGPWVHDLKLLL 204


>gi|126439603|ref|YP_001057553.1| SCO1/SenC family protein [Burkholderia pseudomallei 668]
 gi|126219096|gb|ABN82602.1| SCO1/SenC family protein [Burkholderia pseudomallei 668]
          Length = 205

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 92/193 (47%), Gaps = 6/193 (3%)

Query: 5   GIILGTIL--LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            +    +   + + G     +F +  + GN +F SD  L    G   +L     K  +VF
Sbjct: 15  WLFACALAGAMLIAGCNRQPAFQNLDITGNSQFASDFALPDTAGKIRTLGEFKGKAVVVF 74

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  VCPTT++ L + L+Q+ P G  +   F+TVDP+RDT  ++ ++V  F+   I
Sbjct: 75  FGYTHCPDVCPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAALLGQYVPAFNPAFI 134

Query: 123 G-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           G    D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +    
Sbjct: 135 GLRPADEAQLKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDPNGKLRLFVRDGQ 191

Query: 182 DSDSAIEKINRLI 194
                +  +  L+
Sbjct: 192 GPGPWVHDLKLLL 204


>gi|53718103|ref|YP_107089.1| lipoprotein [Burkholderia pseudomallei K96243]
 gi|67640716|ref|ZP_00439512.1| SCO1/SenC family protein [Burkholderia mallei GB8 horse 4]
 gi|121599986|ref|YP_991510.1| SCO1/SenC family protein [Burkholderia mallei SAVP1]
 gi|124385576|ref|YP_001027416.1| SCO1/SenC family protein [Burkholderia mallei NCTC 10229]
 gi|126451281|ref|YP_001082381.1| SCO1/SenC family protein [Burkholderia mallei NCTC 10247]
 gi|126454294|ref|YP_001064801.1| SCO1/SenC family protein [Burkholderia pseudomallei 1106a]
 gi|134280000|ref|ZP_01766712.1| SCO1/SenC family protein [Burkholderia pseudomallei 305]
 gi|167001948|ref|ZP_02267738.1| SCO1/SenC family protein [Burkholderia mallei PRL-20]
 gi|167717933|ref|ZP_02401169.1| SCO1/SenC family protein [Burkholderia pseudomallei DM98]
 gi|167814056|ref|ZP_02445736.1| SCO1/SenC family protein [Burkholderia pseudomallei 91]
 gi|167844158|ref|ZP_02469666.1| SCO1/SenC family protein [Burkholderia pseudomallei B7210]
 gi|167892664|ref|ZP_02480066.1| SCO1/SenC family protein [Burkholderia pseudomallei 7894]
 gi|167917407|ref|ZP_02504498.1| SCO1/SenC family protein [Burkholderia pseudomallei BCC215]
 gi|217419737|ref|ZP_03451243.1| SCO1/SenC family protein [Burkholderia pseudomallei 576]
 gi|237810704|ref|YP_002895155.1| SCO1/SenC family protein [Burkholderia pseudomallei MSHR346]
 gi|242316644|ref|ZP_04815660.1| SCO1/SenC family protein [Burkholderia pseudomallei 1106b]
 gi|254258634|ref|ZP_04949688.1| SCO1/SenC family protein [Burkholderia pseudomallei 1710a]
 gi|254357573|ref|ZP_04973847.1| SCO1/SenC family protein [Burkholderia mallei 2002721280]
 gi|52208517|emb|CAH34452.1| probable lipoprotein [Burkholderia pseudomallei K96243]
 gi|121228796|gb|ABM51314.1| SCO1/SenC family protein [Burkholderia mallei SAVP1]
 gi|124293596|gb|ABN02865.1| SCO1/SenC family protein [Burkholderia mallei NCTC 10229]
 gi|126227936|gb|ABN91476.1| SCO1/SenC family protein [Burkholderia pseudomallei 1106a]
 gi|126244151|gb|ABO07244.1| SCO1/SenC family protein [Burkholderia mallei NCTC 10247]
 gi|134249200|gb|EBA49282.1| SCO1/SenC family protein [Burkholderia pseudomallei 305]
 gi|148026637|gb|EDK84722.1| SCO1/SenC family protein [Burkholderia mallei 2002721280]
 gi|217397041|gb|EEC37057.1| SCO1/SenC family protein [Burkholderia pseudomallei 576]
 gi|237503137|gb|ACQ95455.1| SCO1/SenC family protein [Burkholderia pseudomallei MSHR346]
 gi|238521486|gb|EEP84937.1| SCO1/SenC family protein [Burkholderia mallei GB8 horse 4]
 gi|242139883|gb|EES26285.1| SCO1/SenC family protein [Burkholderia pseudomallei 1106b]
 gi|243062275|gb|EES44461.1| SCO1/SenC family protein [Burkholderia mallei PRL-20]
 gi|254217323|gb|EET06707.1| SCO1/SenC family protein [Burkholderia pseudomallei 1710a]
          Length = 205

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 92/193 (47%), Gaps = 6/193 (3%)

Query: 5   GIILGTIL--LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            +    +   + + G     +F +  + GN +F SD  L    G   +L     K  +VF
Sbjct: 15  WLFACALAGAMLIAGCNRQPAFQNLDITGNSQFASDFALPDTAGKIRTLGEFKGKAVVVF 74

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  VCPTT++ L + L+Q+ P G  +   F+TVDP+RDT  ++ ++V  F+   I
Sbjct: 75  FGYTHCPDVCPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAALLGQYVPAFNPAFI 134

Query: 123 G-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           G    D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +    
Sbjct: 135 GLRPADEAQLKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDPNGKLRLFVRDGQ 191

Query: 182 DSDSAIEKINRLI 194
                +  +  L+
Sbjct: 192 GPGPWVHDLKLLL 204


>gi|67537344|ref|XP_662446.1| hypothetical protein AN4842.2 [Aspergillus nidulans FGSC A4]
 gi|40740887|gb|EAA60077.1| hypothetical protein AN4842.2 [Aspergillus nidulans FGSC A4]
 gi|259482302|tpe|CBF76654.1| TPA: copper-binding protein of the mitochondrial inner membrane
           (Eurofung) [Aspergillus nidulans FGSC A4]
          Length = 287

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 61/215 (28%), Positives = 93/215 (43%), Gaps = 20/215 (9%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G I Y     + ++           G  +      L   +G  F+  +
Sbjct: 73  WKAALLFVLTGAGMIIYFRVEKERLERKRIAEMSKGVGRPKVGGPFVLKDLNGDVFTEEN 132

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++ +V       N     FIT DP RDTPEV+
Sbjct: 133 LKGKYSFVYFGFTHCPDICPDELDKMAEIIDKVKEANKGENIFVPVFITCDPARDTPEVL 192

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           + ++Q F   IIG++G    V +V K +R+Y +     K    E Y VDH+    L D  
Sbjct: 193 RNYLQEFHKDIIGLTGTYEQVKQVCKAYRVYFSTPRDVK--PGEDYLVDHSIYFYLMDPE 250

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT----YGNVVK 201
           G  V  I  +D  ++A + I   I      G  +K
Sbjct: 251 GDFVECIGRQDTPETATKTIMEHINDWKREGKPLK 285


>gi|157827230|ref|YP_001496294.1| Sco2 protein precursor [Rickettsia bellii OSU 85-389]
 gi|157802534|gb|ABV79257.1| Sco2 protein precursor [Rickettsia bellii OSU 85-389]
          Length = 204

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 52/199 (26%), Positives = 95/199 (47%), Gaps = 11/199 (5%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDG----------NRRFNSDVHLVAQDGTDFSLSS 53
           + II+G  LL  +G++  +                   N     D  L+ Q+G  F+   
Sbjct: 6   IKIIIGASLLIGVGALYLLLSLKTPDKPLAGQVNIYEDNAEIGGDFELIDQNGELFNSDE 65

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K S+++FGFT+C  +CPT+L+++ + ++ +      +   FIT+DP RDTP V K++
Sbjct: 66  LKGKLSLIYFGFTSCPDICPTSLNKITKAVEILSENKIDIVPVFITIDPSRDTPAVFKEY 125

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++ F  + IG++GD   +  VA  F++Y     +E    ++ Y +DH++   L D  G  
Sbjct: 126 LKHFHPKFIGLTGDEKQIREVADKFKVYYAKAASEN-DNDQDYMLDHSSFTYLMDKNGKY 184

Query: 174 VGVIPYKDDSDSAIEKINR 192
           +            +E +  
Sbjct: 185 LKHFYLDSAPSEIMEFLKS 203


>gi|83720830|ref|YP_440994.1| SCO1/SenC family protein [Burkholderia thailandensis E264]
 gi|83654655|gb|ABC38718.1| SCO1/SenC family protein [Burkholderia thailandensis E264]
          Length = 181

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 54/183 (29%), Positives = 91/183 (49%), Gaps = 4/183 (2%)

Query: 13  LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           + + G     +F +  + GN +F SD  L    G   +L     K  +VFFG+T+C  VC
Sbjct: 1   MLIAGCNRQPAFQNLDITGNSQFASDFALPDTTGKIRTLGEFKGKAVVVFFGYTHCPDVC 60

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDV 131
           PTT++ L + L+Q+ P G  +   F+TVDP+RDT  ++ ++V  F+   +G    D   +
Sbjct: 61  PTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAAILGQYVPAFNPTFVGLRPADEAQL 120

Query: 132 MRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKIN 191
            +V K+FR+Y   V  +       Y +DHT A  +FD +G +   +         +  + 
Sbjct: 121 KKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDPSGKLRLFVRDGQGPGPWVHDLK 177

Query: 192 RLI 194
            L+
Sbjct: 178 LLL 180


>gi|326498207|dbj|BAJ98531.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 326

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 50/209 (23%), Positives = 84/209 (40%), Gaps = 21/209 (10%)

Query: 5   GIILGTILLAVLGSIAYVSFSSK----------------FVDGNRRFNSDVHLVAQDGTD 48
            +    +L+   G I Y     K                   G         L+  DG  
Sbjct: 119 WLSFLLLLVTGGGIIVYYDKEKKRHIEELKNNTNSVKPAQSVGTAAIGGPFSLLNHDGKA 178

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTP 107
            +      K ++++FGFT+C  +CP  L ++   + ++     L     FI+VDP+RDT 
Sbjct: 179 VTEKDFLGKWTLLYFGFTHCPDICPDELQKMAAAINKIKEKAKLEIVPVFISVDPERDTV 238

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E +  +V+ F   +IG++G   +V +VA+ +R+Y      E       Y VDH+  + L 
Sbjct: 239 EQVHDYVKEFHQDLIGLTGTSDEVRKVARAYRVYYMKTEEE----GSDYLVDHSIVMYLM 294

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           +     V       D D+  E I + I  
Sbjct: 295 NPKMEFVKFFGKNYDEDTLAEGIIKEIRE 323


>gi|206559157|ref|YP_002229917.1| putative lipoprotein [Burkholderia cenocepacia J2315]
 gi|198035194|emb|CAR51068.1| probable lipoprotein [Burkholderia cenocepacia J2315]
          Length = 205

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 57/189 (30%), Positives = 89/189 (47%), Gaps = 5/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
             T  L + G      F +  + GN +F SD  L    G   +L+    K  ++FFG+T+
Sbjct: 19  AFTAALLLAGCDNAPKFQNLDITGNTQFGSDFALPDTSGKVRTLADFKGKAVVMFFGYTH 78

Query: 68  CSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-IS 125
           C  VCPTT++ L   LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG   
Sbjct: 79  CPDVCPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRP 138

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
            D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +        
Sbjct: 139 ADEAALKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPAP 195

Query: 186 AIEKINRLI 194
            +  +  L+
Sbjct: 196 WVHDLKLLV 204


>gi|319795674|ref|YP_004157314.1| electron transport protein sco1/senc [Variovorax paradoxus EPS]
 gi|315598137|gb|ADU39203.1| electron transport protein SCO1/SenC [Variovorax paradoxus EPS]
          Length = 201

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 54/197 (27%), Positives = 91/197 (46%), Gaps = 8/197 (4%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDG-----NRRFNSDVHLVAQDGTDFSLSSLYIK 57
           AL +I G++ +A LG         K            +  D  L   DG   +++    K
Sbjct: 6   ALQLIAGSMAMAALGMGLSACSEPKQSFNAVDITGADYAKDFSLKDADGKVRTMADFKGK 65

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             ++FFG+  C  VCPTT++ + ++ +Q+   G  L   F+TVDP RDTPEVMK ++  F
Sbjct: 66  AVVLFFGYAQCPDVCPTTMTEMAQVKQQLGKDGDKLQVLFVTVDPARDTPEVMKAYMGAF 125

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
               + +   P ++   AK+F++Y   V  +       Y +DH+ A  ++D  G +    
Sbjct: 126 DPNFVALIPTPDELAATAKDFKVYYKKVDGK---TPTSYSMDHSAASFIYDPQGRLRLYA 182

Query: 178 PYKDDSDSAIEKINRLI 194
            Y     S +  +  L+
Sbjct: 183 RYGAGVPSMVSDLKTLL 199


>gi|110834794|ref|YP_693653.1| Sco1/SenC family protein [Alcanivorax borkumensis SK2]
 gi|110647905|emb|CAL17381.1| Sco1/SenC family protein, putative [Alcanivorax borkumensis SK2]
          Length = 207

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 87/196 (44%), Gaps = 8/196 (4%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           M  L  +L  ++  +L            +  N R   D  L  Q+G  F    L  K SI
Sbjct: 18  MGKLLYVLPLLVALMLAGCG---KQESDLPVNTRLGGDFTLTDQNGAPFQAEKLKGKVSI 74

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVMKKFVQRFS 118
           +FFG+T+C  +CP  L+++ ++ + ++  G        FIT DP+RDT   +K+++  F 
Sbjct: 75  LFFGYTHCPDICPAVLAQVAQVYRHLEEDGVADQVQPVFITFDPERDTVAHLKEYLPWFK 134

Query: 119 DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
             +IG++G    +  VAK + +       ++   E+ Y   H+  + L D    +  + P
Sbjct: 135 ADMIGLTGSLEQIREVAKQYGVVFIK---DQEAGEQGYLFTHSDYIYLLDEQARVRKLYP 191

Query: 179 YKDDSDSAIEKINRLI 194
                D  +  +  L+
Sbjct: 192 ADFKIDEVVTDVESLL 207


>gi|241120674|ref|XP_002402970.1| cytochrome C oxidase assembly protein, putative [Ixodes scapularis]
 gi|215493370|gb|EEC03011.1| cytochrome C oxidase assembly protein, putative [Ixodes scapularis]
          Length = 266

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 14/200 (7%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSS--------KFVDGNRRFNSDVHLVAQDGTDFSLSS 53
           K+LGI  G I  A+LG + Y+            K   G         LV   G   S   
Sbjct: 56  KSLGITFG-IGGALLGWMFYIKKEKQREMDRERKRSLGKAAIGGSFELVDHHGQPKSSKD 114

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL--NAYFITVDPKRDTPEVMK 111
              K  +++FGFT+C  +CP  L +L +++  VD     +     FI++DP+RD  + + 
Sbjct: 115 FLGKWLLIYFGFTHCPDICPDELDKLGKVIDIVDNEIKDVALQPLFISIDPERDDVKAVA 174

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            +V+ F  RI+G++G    V R ++ FR+Y +    ++   E+ Y VDHT  + L D  G
Sbjct: 175 AYVKEFHPRILGLTGSKEQVERASRAFRVYFSAGPRDE---EQDYIVDHTVIMYLVDPDG 231

Query: 172 SIVGVIPYKDDSDSAIEKIN 191
             V        +      I 
Sbjct: 232 EFVDYYGQNRTARQVATAIQ 251


>gi|53724508|ref|YP_104665.1| SCO1/SenC family protein [Burkholderia mallei ATCC 23344]
 gi|76811294|ref|YP_332097.1| SCO1/SenC family protein [Burkholderia pseudomallei 1710b]
 gi|52427931|gb|AAU48524.1| SCO1/SenC family protein [Burkholderia mallei ATCC 23344]
 gi|76580747|gb|ABA50222.1| SCO1/SenC family protein [Burkholderia pseudomallei 1710b]
          Length = 181

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/183 (30%), Positives = 90/183 (49%), Gaps = 4/183 (2%)

Query: 13  LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           + + G     +F +  + GN +F SD  L    G   +L     K  +VFFG+T+C  VC
Sbjct: 1   MLIAGCNRQPAFQNLDITGNSQFASDFALPDTAGKIRTLGEFKGKAVVVFFGYTHCPDVC 60

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDV 131
           PTT++ L + L+Q+ P G  +   F+TVDP+RDT  ++ ++V  F+   IG    D   +
Sbjct: 61  PTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAALLGQYVPAFNPAFIGLRPADEAQL 120

Query: 132 MRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKIN 191
            +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +         +  + 
Sbjct: 121 KKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDPNGKLRLFVRDGQGPGPWVHDLK 177

Query: 192 RLI 194
            L+
Sbjct: 178 LLL 180


>gi|222112019|ref|YP_002554283.1| electron transport protein sco1/senc [Acidovorax ebreus TPSY]
 gi|221731463|gb|ACM34283.1| electron transport protein SCO1/SenC [Acidovorax ebreus TPSY]
          Length = 187

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 54/189 (28%), Positives = 86/189 (45%), Gaps = 4/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           +G        S     F    + G   +  D+ L   +G   SL     K  +VFFG+T 
Sbjct: 1   MGVAGTFAACSPKAPKFQGVDLTG-AEYARDLQLTDHNGQPRSLKDFAGKVVVVFFGYTQ 59

Query: 68  CSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGD 127
           C  VCPT++S L  + + +   G  L   F++VDP+RDTPEV+K ++  F    + + G 
Sbjct: 60  CPDVCPTSMSELADVKRALGADGDKLQGIFVSVDPERDTPEVLKAYMANFDPSFLALRGT 119

Query: 128 PIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAI 187
           P  +  VAK+F+IY   V  +       Y +DH+    ++D AG +     Y   + S  
Sbjct: 120 PEQLAAVAKDFKIYYKRVEGQ---TPTSYTMDHSAGSYVYDPAGRLRVYHRYGSGAQSLA 176

Query: 188 EKINRLITY 196
             +  L+  
Sbjct: 177 ADVRALLDE 185


>gi|169595104|ref|XP_001790976.1| hypothetical protein SNOG_00285 [Phaeosphaeria nodorum SN15]
 gi|111070660|gb|EAT91780.1| hypothetical protein SNOG_00285 [Phaeosphaeria nodorum SN15]
          Length = 294

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 54/201 (26%), Positives = 87/201 (43%), Gaps = 14/201 (6%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLY 55
                + +  G  AY ++  + +            G  +      LV QDG  F+   + 
Sbjct: 83  AAILFVASGAGLWAYFTYEKERMARKRIADQTKGIGKPKVGGPFQLVDQDGNAFTSDDML 142

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPEVMKKFV 114
            K S+V+FGFT+C  +CP  L ++  +  +V      +L    IT DP RD P+V+K ++
Sbjct: 143 GKYSLVYFGFTHCPDICPDELDKMALMYDKVVEQCGRVLLPIMITCDPARDEPKVLKDYL 202

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F    IG++G    +  V K +R+Y +   + K    E Y VDH+    L D  G  V
Sbjct: 203 HEFHPDFIGLTGAYEQIKNVCKAYRVYFSTPSSVK--PGEDYLVDHSIYFYLMDPEGDFV 260

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             I     +D A + +   I 
Sbjct: 261 EAIGRNFTADQAAKIMIDHIK 281


>gi|107023770|ref|YP_622097.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia AU
           1054]
 gi|116690856|ref|YP_836479.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia
           HI2424]
 gi|254247137|ref|ZP_04940458.1| hypothetical protein BCPG_01917 [Burkholderia cenocepacia PC184]
 gi|105893959|gb|ABF77124.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia AU
           1054]
 gi|116648945|gb|ABK09586.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia
           HI2424]
 gi|124871913|gb|EAY63629.1| hypothetical protein BCPG_01917 [Burkholderia cenocepacia PC184]
          Length = 205

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 89/189 (47%), Gaps = 5/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
             T  L + G      F +  + GN +F SD  L    G   +L+    +  ++FFG+T+
Sbjct: 19  AFTAALLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTTGKVRTLADFKGRAVVMFFGYTH 78

Query: 68  CSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-IS 125
           C  VCPTT++ L   LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG   
Sbjct: 79  CPDVCPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRP 138

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
            D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +        
Sbjct: 139 ADEAALKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPAP 195

Query: 186 AIEKINRLI 194
            +  +  L+
Sbjct: 196 WVHDLKLLV 204


>gi|121705034|ref|XP_001270780.1| mitochondrial metallochaperone Sco1, putative [Aspergillus clavatus
           NRRL 1]
 gi|119398926|gb|EAW09354.1| mitochondrial metallochaperone Sco1, putative [Aspergillus clavatus
           NRRL 1]
          Length = 306

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 61/215 (28%), Positives = 91/215 (42%), Gaps = 20/215 (9%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G I Y     + ++           G  +      L   DG +F+   
Sbjct: 92  WKAALLFVLTGAGMIVYFRVEKERLERKRIAEMSKGVGRPKVGGPFTLKDLDGKEFTAED 151

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++ +V       N     FIT DP RDTPEV+
Sbjct: 152 LKGKYSFVYFGFTHCPDICPDELDKMAEIIDKVKEATKGENIFLPVFITCDPVRDTPEVL 211

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           + ++Q F   IIG++G    V  V K +R+Y +    +     E Y VDH+    L D  
Sbjct: 212 RAYLQEFHPDIIGLTGTYDQVKNVCKQYRVYFST--PKDVKPGEDYLVDHSIYFYLMDPE 269

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT----YGNVVK 201
              V  I  +D  +SA + I   I      G  +K
Sbjct: 270 NDFVECIGRQDTPESASKVILEHINDWKREGKPLK 304


>gi|255603338|ref|XP_002538031.1| sco1/senc, putative [Ricinus communis]
 gi|223514116|gb|EEF24353.1| sco1/senc, putative [Ricinus communis]
          Length = 196

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 55/191 (28%), Positives = 89/191 (46%), Gaps = 4/191 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           L  IL T LL      +  SF    + G  +F   + L    G   S++    K  ++FF
Sbjct: 10  LAFILLTSLLVACQQGSSASFIGTDLTGT-QFGKPLSLTDHTGKLRSMNDFKGKVVVLFF 68

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           G+T+C  VCPTT+S L + ++ +      +   F+TVDP RDT EV+ +FV  F  R IG
Sbjct: 69  GYTHCPDVCPTTMSDLKKTMQLLGEKSNEVQVLFVTVDPARDTQEVLAQFVPGFDPRFIG 128

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           + G   +V      +++Y   V          Y +DH+  L +FD  G+    + Y +  
Sbjct: 129 LRGTEAEVAANLSEYKVYAAKVSEPGKS---GYTMDHSAGLYVFDKTGAPRIYLGYGEKP 185

Query: 184 DSAIEKINRLI 194
           ++    +  L+
Sbjct: 186 ENIAHDLQLLL 196


>gi|170734181|ref|YP_001766128.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia
           MC0-3]
 gi|169817423|gb|ACA92006.1| electron transport protein SCO1/SenC [Burkholderia cenocepacia
           MC0-3]
          Length = 191

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 89/189 (47%), Gaps = 5/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
             T  L + G      F +  + GN +F SD  L    G   +L+    +  ++FFG+T+
Sbjct: 5   AFTAALLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTTGKVRTLADFKGRAVVMFFGYTH 64

Query: 68  CSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-IS 125
           C  VCPTT++ L   LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG   
Sbjct: 65  CPDVCPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRP 124

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
            D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +        
Sbjct: 125 ADEAALRKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPAP 181

Query: 186 AIEKINRLI 194
            +  +  L+
Sbjct: 182 WVHDLKLLV 190


>gi|23015654|ref|ZP_00055424.1| COG1999: Uncharacterized protein SCO1/SenC/PrrC, involved in
           biogenesis of respiratory and photosynthetic systems
           [Magnetospirillum magnetotacticum MS-1]
          Length = 200

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 51/178 (28%), Positives = 83/178 (46%), Gaps = 4/178 (2%)

Query: 18  SIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLS 77
            + +   SS+             L    G   S      +  ++FFG+T C  VCPTTLS
Sbjct: 25  LVIWSGQSSEGAKAIPSIGGPFQLTDHTGKQVSDRDYRNRYMLIFFGYTFCPDVCPTTLS 84

Query: 78  RLDRLLKQVDPTGTLLNA-YFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK 136
            +   ++++ P         F+T+DP+RD+  VMK++V  FS  I+G++G P ++ +VAK
Sbjct: 85  TVTAAMEKLGPGYAKKVVPIFVTIDPERDSVAVMKEYVNAFSPDIVGLTGTPEEIAKVAK 144

Query: 137 NFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            F++Y   V   K    E Y VDH+  L L    G  V    +   +D     + + +
Sbjct: 145 EFKVYAAKV---KGDRPENYTVDHSAILYLMGPDGKFVAHFTHGISADDLATGLKKHV 199


>gi|325144862|gb|EGC67150.1| antioxidant, AhpC/TSA family [Neisseria meningitidis M01-240013]
          Length = 209

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 79/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   +G  FSLS L  K  I+ FGFT+C  VCPT L      LKQ+     
Sbjct: 48  KEDIGGDFTLTDGEGKPFSLSDLKGKVVILSFGFTHCPDVCPTELLTYSDTLKQLGGQAK 107

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    V  +  
Sbjct: 108 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIKQQYRVVSAKVNQKD- 166

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 167 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 209


>gi|254805347|ref|YP_003083568.1| putative SCO1/SenC family protein [Neisseria meningitidis alpha14]
 gi|254668889|emb|CBA07034.1| putative SCO1/SenC family protein [Neisseria meningitidis alpha14]
 gi|261392179|emb|CAX49691.1| putative SCO1-like lipoprotein [Neisseria meningitidis 8013]
 gi|325128623|gb|EGC51492.1| antioxidant, AhpC/TSA family [Neisseria meningitidis N1568]
 gi|325134619|gb|EGC57259.1| antioxidant, AhpC/TSA family [Neisseria meningitidis M13399]
 gi|325204554|gb|ADZ00008.1| antioxidant, AhpC/TSA family [Neisseria meningitidis M01-240355]
 gi|325205687|gb|ADZ01140.1| antioxidant, AhpC/TSA family [Neisseria meningitidis M04-240196]
          Length = 217

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 79/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   +G  FSLS L  K  I+ FGFT+C  VCPT L      LKQ+     
Sbjct: 56  KEDIGGDFTLTDGEGKPFSLSDLKGKVVILSFGFTHCPDVCPTELLTYSDTLKQLGGQAK 115

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    V  +  
Sbjct: 116 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIKQQYRVVSAKVNQKD- 174

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 175 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 217


>gi|167561418|ref|ZP_02354334.1| SCO1/SenC family protein [Burkholderia oklahomensis EO147]
 gi|167568645|ref|ZP_02361519.1| SCO1/SenC family protein [Burkholderia oklahomensis C6786]
          Length = 205

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 57/193 (29%), Positives = 94/193 (48%), Gaps = 4/193 (2%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            L   +    L + G     +F +  + GN +F SD  L    G   +L     K  +VF
Sbjct: 15  WLFACMLAGALTIAGCNKQPAFQNLDITGNTQFASDFALPDTTGKIRTLGEFKGKAVVVF 74

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  VCPTT++ L + L+Q+ P G  +   F+TVDP+RDT  ++ ++V  F+   I
Sbjct: 75  FGYTHCPDVCPTTMAELSQALQQLGPDGKRVQVLFVTVDPERDTAALLGQYVPAFNPAFI 134

Query: 123 G-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           G    D   + +V K+FR+Y   V  +     + Y +DHT A  +FD +G +   +    
Sbjct: 135 GLRPADEAQLKKVTKDFRVYYAKVPGK---TPDSYTMDHTAASYVFDPSGKLRLFVRDGQ 191

Query: 182 DSDSAIEKINRLI 194
                +  +  L+
Sbjct: 192 GPGPWVHDLKLLL 204


>gi|322704533|gb|EFY96127.1| protein sco1 [Metarhizium anisopliae ARSEF 23]
          Length = 287

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 50/201 (24%), Positives = 86/201 (42%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLSSLY 55
            G + +A  G++ +     K               G  +      L+ Q+G  F+   + 
Sbjct: 85  AGILFVATCGALVWYFEFEKGRMQRKRIADASKGVGRPKVGGSFELLDQNGKPFTSEMMK 144

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL-NAYFITVDPKRDTPEVMKKFV 114
            K S+V+FGFT C  +CP  L ++ R+L  V+          FIT DP+RD P  +K ++
Sbjct: 145 GKYSLVYFGFTRCPDICPEELDKMARMLDVVEEKAPGALLPIFITCDPERDDPAALKSYL 204

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F D+ IG++G    +  + K +R+Y +    +     + Y VDH+    L D  G  V
Sbjct: 205 AEFHDKFIGLTGTYDQIKDLCKKYRVYFST--PQNVKPGQDYLVDHSIYFYLMDPEGDFV 262

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             +  +   D   + I   + 
Sbjct: 263 EALGRQHSPDQGAQLILDHMK 283


>gi|325525368|gb|EGD03203.1| electron transport protein SCO1/SenC [Burkholderia sp. TJI49]
          Length = 205

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 55/194 (28%), Positives = 89/194 (45%), Gaps = 5/194 (2%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            L      ++  +        F +  + GN +F +D  L    G   +L+    K  ++F
Sbjct: 14  WLLACAFALVSLLSACDNAPKFQNLDITGNTQFGTDFALPDTTGKVRTLADFKGKAVVMF 73

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FG+T+C  VCPTT++ L   LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    
Sbjct: 74  FGYTHCPDVCPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSF 133

Query: 122 IG-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IG    D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +   
Sbjct: 134 IGLRPADEAALKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDPDGKLRLFVRDG 190

Query: 181 DDSDSAIEKINRLI 194
                 +  +  LI
Sbjct: 191 QGPGPWVHDLKLLI 204


>gi|291234821|ref|XP_002737337.1| PREDICTED: cytochrome oxidase deficient homolog 1-like
           [Saccoglossus kowalevskii]
          Length = 305

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 50/205 (24%), Positives = 92/205 (44%), Gaps = 14/205 (6%)

Query: 2   KALGIILGTILLAVLGS--------IAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
           K+L +  G     +LG         IA     +K + G         L+  DG   S   
Sbjct: 101 KSLLVTFGVGAALLLGMKYVKKEKEIAAEKERTKTL-GKAAIGGPFDLIDHDGKPTSNKD 159

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVMK 111
              K  +++FGFT+C  +CP  L ++   + ++    T+ +    FIT+DP+RD+P+ MK
Sbjct: 160 FLGKWVLLYFGFTHCPDICPDELEKMCLAVDKISNIKTIPDITPIFITIDPERDSPQAMK 219

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
           ++ + F   +IG++G    V   A+++R+Y +    ++   +  Y VDHT  + L +  G
Sbjct: 220 EYCKEFHPNLIGLTGAKEKVEEAARSYRVYYSAGPKDE---DNDYIVDHTIIMYLINPEG 276

Query: 172 SIVGVIPYKDDSDSAIEKINRLITY 196
           + +       + D     I   +  
Sbjct: 277 AFLDYYGQNKNDDEIAGSIASHMRK 301


>gi|254505075|ref|ZP_05117226.1| SCO1/SenC superfamily [Labrenzia alexandrii DFL-11]
 gi|222441146|gb|EEE47825.1| SCO1/SenC superfamily [Labrenzia alexandrii DFL-11]
          Length = 208

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 58/175 (33%), Positives = 94/175 (53%), Gaps = 4/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            + S   ++          LV  +G   +  +L  KP+++FFGFT C  VCPTTLS L  
Sbjct: 33  SNNSGALIEPLAAIGGPFELVGGNGETVTDQTLAGKPTVMFFGFTYCPDVCPTTLSELQG 92

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
            ++ + P    LN  F++VDP+RDTP+VM+ +V  F DRI+ ++G   ++  + K +R+Y
Sbjct: 93  WIEALGPDADKLNYAFVSVDPERDTPDVMRDYVGAFDDRILALTGSRENIDSMLKAYRVY 152

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
              V  +       Y +DH+ A+ L +     VG I Y +  ++A+ K+ RLI  
Sbjct: 153 AKRVPLDD----GDYTMDHSAAVYLMNADNKFVGTIAYGEVEETALAKLKRLIQN 203


>gi|295701429|ref|YP_003610430.1| electron transporter SCO1/SenC [Burkholderia sp. CCGE1002]
 gi|295441752|gb|ADG20919.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1002]
          Length = 209

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 52/205 (25%), Positives = 98/205 (47%), Gaps = 13/205 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF----------NSDVHLVAQDGTDFSL 51
           + L I+ G + + +  ++      +        F            D HL+  +G   SL
Sbjct: 8   RRLSIVRGVLSVVLALALVACDDHAGSPSTPPGFVSGDITGVGWGRDFHLIDHNGKPRSL 67

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
           +    K  ++FFG+T+C   CPTT++ +  +  ++   G  +   F+TVDP RDTP+V+ 
Sbjct: 68  ADFRGKVVMLFFGYTHCPDQCPTTMAEIAEVRGKLGENGRQVQGLFVTVDPARDTPQVLA 127

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
           ++V  F+   +G+ GD      +A+ F+ Y +   A+K+     Y VDH +A+ +FD  G
Sbjct: 128 QYVSAFAPTFLGLYGDERTTSALAREFKFYYS---AQKADAHGNYSVDHGSAIYVFDPTG 184

Query: 172 SIVGVIPYKDDSDSAIEKINRLITY 196
            +  ++  +   D+    + RL+  
Sbjct: 185 RLRLLMNPEMSIDAMAADVGRLLKE 209


>gi|159046164|ref|YP_001541836.1| electron transport protein SCO1/SenC [Dinoroseobacter shibae DFL
           12]
 gi|159046499|ref|YP_001542169.1| electron transport protein SCO1/SenC [Dinoroseobacter shibae DFL
           12]
 gi|157913923|gb|ABV95355.1| electron transport protein SCO1/SenC [Dinoroseobacter shibae DFL
           12]
 gi|157914258|gb|ABV95688.1| electron transport protein SCO1/SenC [Dinoroseobacter shibae DFL
           12]
          Length = 200

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 52/195 (26%), Positives = 92/195 (47%), Gaps = 4/195 (2%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFV--DGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           K L ++ G      +  + +  + +     +    F +D  L    G   +      +  
Sbjct: 8   KVLWVLAGAAAFVFIWLLLWSDYRADLARTESEPPFLADFELTDHRGMVQTDEDFAGRWM 67

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +VFFGFTNC  VCPTTLS +  +++ +     ++   FIT+DP+RDTP  + ++V  F  
Sbjct: 68  LVFFGFTNCPDVCPTTLSEVAAVMEGLGDEAAMVQPIFITIDPERDTPTALAEYVPLFDA 127

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
            IIG++G P  +   ++ F I+   +  E++     Y + HT+ L LFDT        PY
Sbjct: 128 GIIGLTGTPEQIAATSETFPIFFERI--EQATAPGGYTMGHTSHLFLFDTQAGFADSWPY 185

Query: 180 KDDSDSAIEKINRLI 194
              ++  +  + + I
Sbjct: 186 GTPAEEILADLRQRI 200


>gi|91205514|ref|YP_537869.1| Sco2 protein precursor [Rickettsia bellii RML369-C]
 gi|122990916|sp|Q1RIN4|SCO22_RICBR RecName: Full=SCO2-like protein RBE_0699
 gi|91069058|gb|ABE04780.1| Sco2 protein precursor [Rickettsia bellii RML369-C]
          Length = 204

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 52/199 (26%), Positives = 96/199 (48%), Gaps = 11/199 (5%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDG----------NRRFNSDVHLVAQDGTDFSLSS 53
           + II+G  LL  +G++  +                   N     D  L+ Q+G  F+   
Sbjct: 6   IKIIIGASLLIGVGALYLLLSLKTPDKPLAGQVNIYEDNAEIGGDFELIDQNGELFNSDE 65

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K S+++FGFT+C  +CPT+L+++ + ++ +      +   FIT+DP RDTP V+K++
Sbjct: 66  LKGKLSLIYFGFTSCPDICPTSLNKITKAVEILSENKIDIVPVFITIDPSRDTPAVLKEY 125

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++ F  + IG++GD   +  VA  F++Y     +E    ++ Y +DH++   L D  G  
Sbjct: 126 LKHFHPKFIGLTGDEKQIREVADKFKVYYAKAASEN-DNDQDYMLDHSSFTYLMDKNGKY 184

Query: 174 VGVIPYKDDSDSAIEKINR 192
           +            +E +  
Sbjct: 185 LKHFYLDSAPSKIMEFLKS 203


>gi|91787152|ref|YP_548104.1| electron transport protein SCO1/SenC [Polaromonas sp. JS666]
 gi|91696377|gb|ABE43206.1| electron transport protein SCO1/SenC [Polaromonas sp. JS666]
          Length = 209

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 56/211 (26%), Positives = 94/211 (44%), Gaps = 18/211 (8%)

Query: 1   MKALGI----------ILGTILLAVLGSIAYVSFSSKFVDGN-----RRFNSDVHLVAQD 45
           MK+L +          I GT LLA+   +       K    +       +     L   +
Sbjct: 1   MKSLTLPPSRRLALQTIAGTGLLAITAGLLTACAPDKPQFKSIDLTGADYAQGFTLADHN 60

Query: 46  GTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRD 105
           G   +L     K  +VFFG+T C  VCPT+++ L ++ +Q+ P G  L A FIT+DP+RD
Sbjct: 61  GQVRTLKDFAGKVVVVFFGYTQCPDVCPTSMAELAQVKQQLGPDGDKLQAIFITMDPERD 120

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALL 165
           T E++K ++  F    + +      +  VA++F++Y   V  +       Y +DH+    
Sbjct: 121 TAELLKAYMANFDPTFLALRPTMAQLPEVARDFKVYYKKVDGK---TPGSYTLDHSAGSY 177

Query: 166 LFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           +FD+ G I     Y    ++    I  L+  
Sbjct: 178 VFDSKGRIRLYNRYGGGPEALASDIRLLLKN 208


>gi|194097850|ref|YP_002000895.1| Lipoprotein [Neisseria gonorrhoeae NCCP11945]
 gi|239998334|ref|ZP_04718258.1| Lipoprotein [Neisseria gonorrhoeae 35/02]
 gi|240014495|ref|ZP_04721408.1| Lipoprotein [Neisseria gonorrhoeae DGI18]
 gi|240016941|ref|ZP_04723481.1| Lipoprotein [Neisseria gonorrhoeae FA6140]
 gi|240113711|ref|ZP_04728201.1| Lipoprotein [Neisseria gonorrhoeae MS11]
 gi|240117135|ref|ZP_04731197.1| Lipoprotein [Neisseria gonorrhoeae PID1]
 gi|240121017|ref|ZP_04733979.1| Lipoprotein [Neisseria gonorrhoeae PID24-1]
 gi|240122352|ref|ZP_04735308.1| Lipoprotein [Neisseria gonorrhoeae PID332]
 gi|240125085|ref|ZP_04737971.1| Lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|254494465|ref|ZP_05107636.1| lipoprotein [Neisseria gonorrhoeae 1291]
 gi|268594195|ref|ZP_06128362.1| lipoprotein [Neisseria gonorrhoeae 35/02]
 gi|268599779|ref|ZP_06133946.1| lipoprotein [Neisseria gonorrhoeae MS11]
 gi|268602823|ref|ZP_06136990.1| lipoprotein [Neisseria gonorrhoeae PID1]
 gi|268680938|ref|ZP_06147800.1| lipoprotein [Neisseria gonorrhoeae PID332]
 gi|268683680|ref|ZP_06150542.1| lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|293399682|ref|ZP_06643834.1| lipoprotein [Neisseria gonorrhoeae F62]
 gi|193933140|gb|ACF28964.1| Lipoprotein [Neisseria gonorrhoeae NCCP11945]
 gi|226513505|gb|EEH62850.1| lipoprotein [Neisseria gonorrhoeae 1291]
 gi|268547584|gb|EEZ43002.1| lipoprotein [Neisseria gonorrhoeae 35/02]
 gi|268583910|gb|EEZ48586.1| lipoprotein [Neisseria gonorrhoeae MS11]
 gi|268586954|gb|EEZ51630.1| lipoprotein [Neisseria gonorrhoeae PID1]
 gi|268621222|gb|EEZ53622.1| lipoprotein [Neisseria gonorrhoeae PID332]
 gi|268623964|gb|EEZ56364.1| lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|291609933|gb|EFF39056.1| lipoprotein [Neisseria gonorrhoeae F62]
 gi|317163622|gb|ADV07163.1| Lipoprotein [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 217

 Score =  128 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 79/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   +G  FSLS L  K  I+ FGFT+C  VCPT L      LKQ+     
Sbjct: 56  KEDIGGDFTLTDGEGKPFSLSDLKGKVVILSFGFTHCPDVCPTELLTYSDTLKQLGGQAK 115

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    +  +  
Sbjct: 116 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIKQQYRVVSAKINQKD- 174

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 175 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 217


>gi|296534426|ref|ZP_06896869.1| Sco2 protein [Roseomonas cervicalis ATCC 49957]
 gi|296265248|gb|EFH11430.1| Sco2 protein [Roseomonas cervicalis ATCC 49957]
          Length = 206

 Score =  128 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 86/193 (44%), Gaps = 9/193 (4%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFV-----DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           +LG +LLA  G                            L    G   +      +P  V
Sbjct: 15  VLGALLLATTGGWLVSDGPLAPPRVATGPQTLAIGGPFSLTDHRGRAVTERDFRGRPMAV 74

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFGFT C  VCPTTL+ +   ++ + P    +   F++VD +RDTP+ M  +++ F  RI
Sbjct: 75  FFGFTYCPDVCPTTLTEMTGFIEALGPDADRIQWVFVSVDSERDTPQAMAAYLEAFDRRI 134

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           IG++G    +   A  FR++   V  E       Y +DH+ ++ L D  G   G + YK+
Sbjct: 135 IGLTGTEAQIAAAANGFRVFYRRVPLE----GGGYTMDHSASVFLLDAEGRFAGTVDYKE 190

Query: 182 DSDSAIEKINRLI 194
               A+EK+  L+
Sbjct: 191 SERVALEKLRMLV 203


>gi|71030332|ref|XP_764808.1| hypothetical protein [Theileria parva strain Muguga]
 gi|68351764|gb|EAN32525.1| SCO1-like, putative [Theileria parva]
          Length = 232

 Score =  128 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 89/201 (44%), Gaps = 14/201 (6%)

Query: 7   ILGTILLAVLGSIAYVSFSSK----------FVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           ++   +   +G+  Y +F+ K             G  +      L+ QDG + S      
Sbjct: 35  LINIAVCGAVGAGVYYAFNKKRSQQLAIVTEERYGTPQLGGTFKLIDQDGVERSSEEFKG 94

Query: 57  KPSIVFFGFTNCSAVCPT-TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
           K  +++FGF NC  +CP     +   +       G L+   F++VDPKRD P+V+KK+++
Sbjct: 95  KYVLIYFGFCNCPDICPEEMDKQTQVVKTLDKEFGPLVQPIFVSVDPKRDVPKVLKKYIK 154

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            +  R++ ++G P  +  V + FR+Y N         ++ Y +DH+    L D  G  + 
Sbjct: 155 DYHPRLVALTGTPEMIKEVTRKFRVYYN---EGIKATDQDYLIDHSIIHYLMDKDGKFLE 211

Query: 176 VIPYKDDSDSAIEKINRLITY 196
                 ++    + I+ +I  
Sbjct: 212 FYGKNTNAQEMAKAISNIIKK 232


>gi|158422000|ref|YP_001523292.1| putative inner mitochondrial membrane protein Sco1p precursor
           [Azorhizobium caulinodans ORS 571]
 gi|158328889|dbj|BAF86374.1| putative inner mitochondrial membrane protein Sco1p precursor
           [Azorhizobium caulinodans ORS 571]
          Length = 199

 Score =  128 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 56/195 (28%), Positives = 89/195 (45%), Gaps = 6/195 (3%)

Query: 2   KALGII--LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           K + +        L ++  +  +         +        LV       + + L  KPS
Sbjct: 9   KIIALFCAFAAGALVLVAGVTLLMPGRAGPALSSAVGGPFKLVDDGAQPVTEAVLKGKPS 68

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +VFFGFT+C  VCPT L  +  + + + P      A+FITVDP+RDTPE+MK +V  F  
Sbjct: 69  LVFFGFTHCPDVCPTALFEMSEIFRALGPDADKAQAFFITVDPERDTPEIMKSYVSSFVP 128

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
           +I G++G P  +  V K +R++   V  +       Y +DHT  + L D AG+ +     
Sbjct: 129 QIHGLTGTPEQIEVVKKEYRVFSRKVPLKD----GDYTMDHTAVVYLMDKAGNFIAPFNT 184

Query: 180 KDDSDSAIEKINRLI 194
           K     A   + R +
Sbjct: 185 KRPPAEAAADLKRYL 199


>gi|74316355|ref|YP_314095.1| putative SCO1/SenC family protein [Thiobacillus denitrificans ATCC
           25259]
 gi|74055850|gb|AAZ96290.1| putative SCO1/SenC family protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 197

 Score =  128 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 54/174 (31%), Positives = 87/174 (50%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G   F  D  L   +G   SL     K   VFFG+T+C  VCPTTLS    
Sbjct: 26  PAFQATDITG-AEFARDFTLTDHNGQVRSLGDFRGKAVAVFFGYTHCPDVCPTTLSDFAA 84

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
            L Q+ P    +   F+TVDP RDTP+++K+FV  F    +G+  D   + R+AK ++I 
Sbjct: 85  ALSQLGPQAERVQVIFVTVDPLRDTPDLLKQFVPAFHPSFLGMYADGPTLERLAKEYKIV 144

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                 +     + Y +DH+    ++D AG +  ++PY    D+  + +  L++
Sbjct: 145 YQKTAEK---AADDYLIDHSAGTYVYDPAGKLRLLVPYGSSPDAIAQDLKTLLS 195


>gi|83944844|ref|ZP_00957210.1| SCO1/2 family protein [Oceanicaulis alexandrii HTCC2633]
 gi|83851626|gb|EAP89481.1| SCO1/2 family protein [Oceanicaulis alexandrii HTCC2633]
          Length = 218

 Score =  128 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 87/200 (43%), Gaps = 12/200 (6%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKF-------VDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
            I+ G   +A+L         +         + G         LV   G   +  +   +
Sbjct: 16  AILAGVAAVAILTLSPGAGTGANTTGAAPVRMSGQADIGGPFTLVDHTGRTVTEETFAGR 75

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFV-- 114
           P++++FGFT C  +CPT+L  +   L +             ITVDP+RDTPE +  +V  
Sbjct: 76  PTLIYFGFTYCPDICPTSLQVMAAALDRLTPEQRAQFQPLLITVDPERDTPEALAAYVQS 135

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F D ++G++G    +   A+ +R+Y   V  E  G   +Y +DH++ + L    G  V
Sbjct: 136 PAFPDNLLGLTGSEEQIREAARAYRVYYARV--EDDGTLAEYTMDHSSLIYLMGRNGEFV 193

Query: 175 GVIPYKDDSDSAIEKINRLI 194
            V P++   D    ++ + +
Sbjct: 194 EVFPHQATPDQIASRLQQFL 213


>gi|85714004|ref|ZP_01044993.1| Electron transport protein [Nitrobacter sp. Nb-311A]
 gi|85699130|gb|EAQ36998.1| Electron transport protein [Nitrobacter sp. Nb-311A]
          Length = 198

 Score =  128 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 93/193 (48%), Gaps = 8/193 (4%)

Query: 6   IILGTI---LLAVLGSIAYVSFSSKFVDGNRRFN-SDVHLVAQDGTDFSLSSLYIKPSIV 61
           I+       L+  L ++ ++                   L+ Q G   +  ++  +P+IV
Sbjct: 10  ILFAAFAGSLVVGLTAVMWLLGGLASKPPAASIGSGSFKLIDQTGQTVTEKNMVGRPTIV 69

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFG+T+C  VCPT+L  +  +L+ + P    +NAYF+TVDP+RDT E MK ++  F   +
Sbjct: 70  FFGYTHCPDVCPTSLFEMSEVLRAMGPDAGRINAYFVTVDPERDTQETMKSYLSSFDPHL 129

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
            G++GDP  + +    FR+Y   V  +       Y +DHT  + L D  G  V     K 
Sbjct: 130 KGLTGDPAAIQKALSVFRVYAKKVPLKD----GDYSMDHTALIYLMDRNGHFVSPFDLKR 185

Query: 182 DSDSAIEKINRLI 194
            +++A   + R +
Sbjct: 186 SAEAAAADLKRYL 198


>gi|295687645|ref|YP_003591338.1| electron transport protein SCO1/SenC [Caulobacter segnis ATCC
           21756]
 gi|295429548|gb|ADG08720.1| electron transport protein SCO1/SenC [Caulobacter segnis ATCC
           21756]
          Length = 194

 Score =  128 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 59/191 (30%), Positives = 84/191 (43%), Gaps = 7/191 (3%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            L +I+  +L  ++      S S+              LV Q+G   +   L  K S VF
Sbjct: 5   RLVLIVACLLGLLVVGGLAWSASALKEQPAAAVGGPFQLVDQNGAPTTEKVLKGKWSAVF 64

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS--DR 120
           FGFT C  VCP TL  L    + + P G  L   FI++DP+RDTP  MK ++        
Sbjct: 65  FGFTYCPDVCPGTLQGLAAATELLGPQGKDLQIVFISIDPERDTPAQMKTYLSADYVPKS 124

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
            IG++G    V   AK +++Y   V     G    Y +DH+TA+ L D  G    V+PY 
Sbjct: 125 TIGLTGTQAQVDAAAKAYKVYYAKV-----GAGPGYTMDHSTAIYLMDPKGRFKTVVPYN 179

Query: 181 DDSDSAIEKIN 191
                   +I 
Sbjct: 180 QPPADIAARIK 190


>gi|296314617|ref|ZP_06864558.1| antioxidant, AhpC/TSA family [Neisseria polysaccharea ATCC 43768]
 gi|296838616|gb|EFH22554.1| antioxidant, AhpC/TSA family [Neisseria polysaccharea ATCC 43768]
          Length = 217

 Score =  128 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 80/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   +G  FSLS L  K  I+ FG+T+C  VCPT L      LKQ+     
Sbjct: 56  KEDIGGDFTLTNGEGKPFSLSDLKGKVVILSFGYTHCPDVCPTELLTYSDTLKQLGGQAK 115

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    V  ++ 
Sbjct: 116 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQSLPVIKQQYRVVSAKVNQKE- 174

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 175 -DGENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 217


>gi|187922562|ref|YP_001894204.1| electron transporter SCO1/SenC [Burkholderia phytofirmans PsJN]
 gi|187713756|gb|ACD14980.1| electron transport protein SCO1/SenC [Burkholderia phytofirmans
           PsJN]
          Length = 205

 Score =  128 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 56/193 (29%), Positives = 93/193 (48%), Gaps = 5/193 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           +   LG  LL         +F +  + GN +F SD  L    G   +L+    K  ++FF
Sbjct: 15  IACALGGALLIAGCGKQPPAFQNLDITGNTQFGSDFSLPDTAGHVRTLADYKGKVVVLFF 74

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           G+T+C  VCPTT++ L + L+Q+       +   F+TVDP RDTP ++ ++V  F+   +
Sbjct: 75  GYTHCPDVCPTTMAELSQALQQLGPEDAKRVQVLFVTVDPDRDTPALLAQYVPAFNPTFV 134

Query: 123 G-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           G    D   + ++ K+FR+Y   V  +     + Y +DHT A  +FDT G +        
Sbjct: 135 GLRPADQAQLTKITKDFRVYYAKVPGK---TPDSYTMDHTAASYVFDTDGKLRLFARDGQ 191

Query: 182 DSDSAIEKINRLI 194
            +   +  I  L+
Sbjct: 192 GATPWVHDIKLLL 204


>gi|6319498|ref|NP_009580.1| Sco2p [Saccharomyces cerevisiae S288c]
 gi|585972|sp|P38072|SCO2_YEAST RecName: Full=Protein SCO2, mitochondrial; Flags: Precursor
 gi|498753|emb|CAA53681.1| YBR0308 [Saccharomyces cerevisiae]
 gi|536232|emb|CAA84966.1| SCO2 [Saccharomyces cerevisiae]
 gi|151946417|gb|EDN64639.1| suppressor of cytochrome oxidase deficiency [Saccharomyces
           cerevisiae YJM789]
 gi|207347782|gb|EDZ73851.1| YBR024Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256273186|gb|EEU08135.1| Sco2p [Saccharomyces cerevisiae JAY291]
 gi|259144868|emb|CAY77807.1| Sco2p [Saccharomyces cerevisiae EC1118]
 gi|285810361|tpg|DAA07146.1| TPA: Sco2p [Saccharomyces cerevisiae S288c]
 gi|323310198|gb|EGA63390.1| Sco2p [Saccharomyces cerevisiae FostersO]
 gi|323338833|gb|EGA80048.1| Sco2p [Saccharomyces cerevisiae Vin13]
 gi|323349831|gb|EGA84045.1| Sco2p [Saccharomyces cerevisiae Lalvin QA23]
 gi|1587582|prf||2206497E ORF YBR0308
          Length = 301

 Score =  128 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 57/203 (28%), Positives = 91/203 (44%), Gaps = 14/203 (6%)

Query: 5   GIILGTILLAVLGSIAYVS-----------FSSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
                 +LL   G+ AY+S             +    G+       +L   +G  F+  +
Sbjct: 80  WKATIALLLLSGGTYAYLSRKRRLLETEKEADANRAYGSVALGGPFNLTDFNGKPFTEEN 139

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKK 112
           L  K SI++FGF++C  +CP  L RL   + +  D     +   FI+ DP RDTP+V+K+
Sbjct: 140 LKGKFSILYFGFSHCPDICPEELDRLTYWISELDDKDHIKIQPLFISCDPARDTPDVLKE 199

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           ++  F   IIG++G    V  V K +++Y +     K    + Y VDH+    L D  G 
Sbjct: 200 YLSDFHPAIIGLTGTYDQVKSVCKKYKVYFSTPRDVK--PNQDYLVDHSIFFYLIDPEGQ 257

Query: 173 IVGVIPYKDDSDSAIEKINRLIT 195
            +  +    D  S +EKI   I 
Sbjct: 258 FIDALGRNYDEQSGLEKIREQIQ 280


>gi|308389712|gb|ADO32032.1| putative lipoprotein [Neisseria meningitidis alpha710]
 gi|325130681|gb|EGC53422.1| antioxidant, AhpC/TSA family [Neisseria meningitidis OX99.30304]
 gi|325136755|gb|EGC59355.1| antioxidant, AhpC/TSA family [Neisseria meningitidis M0579]
          Length = 217

 Score =  128 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 79/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   +G  F+LS L  K  I+ FGFT+C  VCPT L      LKQ+     
Sbjct: 56  KEDIGGDFTLTDGEGKPFNLSDLKGKVVILSFGFTHCPDVCPTELLTYSDTLKQLGGQAK 115

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    V  +  
Sbjct: 116 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIKQQYRVVSAKVNQKD- 174

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 175 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 217


>gi|15677428|ref|NP_274584.1| hypothetical protein NMB1578 [Neisseria meningitidis MC58]
 gi|7226826|gb|AAF41931.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|316983826|gb|EFV62806.1| ahpC/TSA family protein [Neisseria meningitidis H44/76]
 gi|325140772|gb|EGC63286.1| antioxidant, AhpC/TSA family [Neisseria meningitidis CU385]
 gi|325199823|gb|ADY95278.1| antioxidant, AhpC/TSA family [Neisseria meningitidis H44/76]
          Length = 217

 Score =  128 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 79/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   +G  F+LS L  K  I+ FGFT+C  VCPT L      LKQ+     
Sbjct: 56  KEDIGGDFTLTDGEGKPFNLSDLKGKVVILSFGFTHCPDVCPTELLTYSDTLKQLGGQAK 115

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    V  +  
Sbjct: 116 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIKQQYRVVSAKVNQKD- 174

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 175 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 217


>gi|317151252|ref|XP_001824537.2| protein SCO1 [Aspergillus oryzae RIB40]
          Length = 304

 Score =  128 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 58/202 (28%), Positives = 87/202 (43%), Gaps = 16/202 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
               ++   G I Y     + +            G  +      L   DG  F+   L  
Sbjct: 93  ALLFVITGAGMIVYFRVEKERLARKRIAEMSKGVGRPKVGGPFVLKDLDGKQFTDEDLKG 152

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVMKKF 113
           K S V+FGFT+C  +CP  L ++  ++ +V       N     F+T DP RDTPEV++ +
Sbjct: 153 KYSFVYFGFTHCPDICPDELDKMAEIIDKVKEATKGENIFLPVFVTCDPARDTPEVLRSY 212

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           +Q F   IIG++G    V  + K +R+Y +    +     E Y VDH+    L D  G  
Sbjct: 213 LQEFHGDIIGLTGTYEQVKNMCKQYRVYFST--PQNVNPGEDYLVDHSIYFYLMDPEGDF 270

Query: 174 VGVIPYKDDSDSAIEKINRLIT 195
           V  I  +D  DSA + I   I 
Sbjct: 271 VECIGRQDTPDSATKVIMEHIN 292


>gi|59801596|ref|YP_208308.1| hypothetical protein NGO1237 [Neisseria gonorrhoeae FA 1090]
 gi|240079718|ref|ZP_04724261.1| hypothetical protein NgonF_00154 [Neisseria gonorrhoeae FA19]
 gi|240116453|ref|ZP_04730515.1| hypothetical protein NgonPID1_09508 [Neisseria gonorrhoeae PID18]
 gi|240127066|ref|ZP_04739727.1| hypothetical protein NgonS_00153 [Neisseria gonorrhoeae SK-93-1035]
 gi|260441674|ref|ZP_05795490.1| hypothetical protein NgonDG_11422 [Neisseria gonorrhoeae DGI2]
 gi|268595864|ref|ZP_06130031.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268602124|ref|ZP_06136291.1| lipoprotein [Neisseria gonorrhoeae PID18]
 gi|268685421|ref|ZP_06152283.1| lipoprotein [Neisseria gonorrhoeae SK-93-1035]
 gi|291045055|ref|ZP_06570763.1| lipoprotein [Neisseria gonorrhoeae DGI2]
 gi|59718491|gb|AAW89896.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|268549652|gb|EEZ44671.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268586255|gb|EEZ50931.1| lipoprotein [Neisseria gonorrhoeae PID18]
 gi|268625705|gb|EEZ58105.1| lipoprotein [Neisseria gonorrhoeae SK-93-1035]
 gi|291011058|gb|EFE03055.1| lipoprotein [Neisseria gonorrhoeae DGI2]
          Length = 217

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 79/164 (48%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   +G  FSLS L  K  I+ FGFT+C  VCPT L      LKQ+     
Sbjct: 56  KEDIGGDFTLTDGEGKPFSLSDLKGKVVILSFGFTHCPDVCPTGLLTYSDTLKQLGGQAK 115

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F+++DP+RDTPE++ K+ ++F+   IG++      + V K  +R+    +  +  
Sbjct: 116 DVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIKQQYRVVSAKINQKD- 174

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E Y VDH++   L D  G +    PY  + ++    +  L+
Sbjct: 175 -DSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL 217


>gi|83773277|dbj|BAE63404.1| unnamed protein product [Aspergillus oryzae]
          Length = 322

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 58/202 (28%), Positives = 87/202 (43%), Gaps = 16/202 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
               ++   G I Y     + +            G  +      L   DG  F+   L  
Sbjct: 93  ALLFVITGAGMIVYFRVEKERLARKRIAEMSKGVGRPKVGGPFVLKDLDGKQFTDEDLKG 152

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVMKKF 113
           K S V+FGFT+C  +CP  L ++  ++ +V       N     F+T DP RDTPEV++ +
Sbjct: 153 KYSFVYFGFTHCPDICPDELDKMAEIIDKVKEATKGENIFLPVFVTCDPARDTPEVLRSY 212

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           +Q F   IIG++G    V  + K +R+Y +    +     E Y VDH+    L D  G  
Sbjct: 213 LQEFHGDIIGLTGTYEQVKNMCKQYRVYFST--PQNVNPGEDYLVDHSIYFYLMDPEGDF 270

Query: 174 VGVIPYKDDSDSAIEKINRLIT 195
           V  I  +D  DSA + I   I 
Sbjct: 271 VECIGRQDTPDSATKVIMEHIN 292


>gi|306843237|ref|ZP_07475847.1| electron transport protein SCO1/SenC [Brucella sp. BO2]
 gi|306286560|gb|EFM58139.1| electron transport protein SCO1/SenC [Brucella sp. BO2]
          Length = 196

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 72/193 (37%), Positives = 105/193 (54%), Gaps = 4/193 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    I   + + V+   A  +F          F    +L+  DG  FS   L   P++
Sbjct: 1   MKKFLPIFIVVFIVVIIGAAGFNFVRDKQAAKEPFGGSFNLITMDGKPFSEKDLRATPAV 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  LD  LKQ+ P    + AYF+TVDP+RDT +VM  +V   +DR
Sbjct: 61  VFFGFTHCPDVCPTTLYELDGWLKQLGPEAGDIKAYFVTVDPERDTQDVMNTYVSNVTDR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+GI+G P ++  + K++ +Y   V  E       Y +DHT ++ L D  G   G I Y+
Sbjct: 121 IMGITGTPDNIAEMVKSYHVYARKVPIED----GDYTMDHTASIFLLDKGGRFRGTIAYQ 176

Query: 181 DDSDSAIEKINRL 193
           ++ D+A+EK+  L
Sbjct: 177 ENPDTALEKLKNL 189


>gi|296445446|ref|ZP_06887403.1| electron transport protein SCO1/SenC [Methylosinus trichosporium
           OB3b]
 gi|296257012|gb|EFH04082.1| electron transport protein SCO1/SenC [Methylosinus trichosporium
           OB3b]
          Length = 208

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 54/189 (28%), Positives = 84/189 (44%), Gaps = 5/189 (2%)

Query: 6   IILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGF 65
           + +G   L    ++  V+                 LVAQ+G + +      +P +VFFG+
Sbjct: 25  LAIGGACLVAFAALVVVTSLKPPPPPASAIGGPFRLVAQNGQEVTEKDFLGRPFLVFFGY 84

Query: 66  TNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGIS 125
           T+C  +C  TL  +  +L+ + P        F+TVDP+RDTP +MK ++  F  RI+G+S
Sbjct: 85  THCPDICHATLFEISEVLRALGPDANAGA-LFVTVDPERDTPAIMKDYLSNFDPRIVGVS 143

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
           GD   +  V + +RIY              Y VDHTT + L D  G  V           
Sbjct: 144 GDRAAIDPVLQEYRIYSKK----AGESGGDYAVDHTTVVYLMDKNGRFVSSFNLSRKPAD 199

Query: 186 AIEKINRLI 194
           A   + R +
Sbjct: 200 AARDLQRYL 208


>gi|134297027|ref|YP_001120762.1| electron transport protein SCO1/SenC [Burkholderia vietnamiensis
           G4]
 gi|134140184|gb|ABO55927.1| electron transport protein SCO1/SenC [Burkholderia vietnamiensis
           G4]
          Length = 205

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 54/194 (27%), Positives = 88/194 (45%), Gaps = 5/194 (2%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            L          + G      F +  + GN +F +D  L    G   +L+    +  ++F
Sbjct: 14  WLLACAFAAATLLAGCDNAPKFQNLDITGNTQFGTDFSLPDTTGKVRTLADFKGRAVVMF 73

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FG+T+C  VCPTT++ L   LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    
Sbjct: 74  FGYTHCPDVCPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSF 133

Query: 122 IG-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IG    D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +   
Sbjct: 134 IGLRPADEAQLKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDRDGKLRLFVRDG 190

Query: 181 DDSDSAIEKINRLI 194
                 +  +  L+
Sbjct: 191 QGPGPWVHDLKLLV 204


>gi|306844315|ref|ZP_07476907.1| electron transport protein SCO1/SenC [Brucella sp. BO1]
 gi|306275387|gb|EFM57128.1| electron transport protein SCO1/SenC [Brucella sp. BO1]
          Length = 196

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 72/193 (37%), Positives = 105/193 (54%), Gaps = 4/193 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    I   + + V+   A  +F          F    +L+  DG  FS   L   P++
Sbjct: 1   MKKFLPIFIVVFIVVIIGAAGFNFVRDKQAAKEPFGGSFNLITMDGKPFSEKDLRATPAV 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  LD  LKQ+ P    + AYF+TVDP+RDT +VM  +V   +DR
Sbjct: 61  VFFGFTHCPDVCPTTLYELDGWLKQLGPEAGDIKAYFVTVDPERDTQDVMNTYVSNVTDR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+GI+G P ++  + K++ +Y   V  E       Y +DHT ++ L D  G   G I Y+
Sbjct: 121 IMGITGTPDNIAEMVKSYHVYARKVPIED----GDYTMDHTASIFLLDKGGRFRGTIAYQ 176

Query: 181 DDSDSAIEKINRL 193
           ++ D+A+EK+  L
Sbjct: 177 ENPDTALEKLKNL 189


>gi|254719448|ref|ZP_05181259.1| electron transport protein SCO1/SenC [Brucella sp. 83/13]
 gi|265984453|ref|ZP_06097188.1| electron transporter SCO1/SenC [Brucella sp. 83/13]
 gi|306839225|ref|ZP_07472042.1| electron transport protein SCO1/SenC [Brucella sp. NF 2653]
 gi|264663045|gb|EEZ33306.1| electron transporter SCO1/SenC [Brucella sp. 83/13]
 gi|306405772|gb|EFM62034.1| electron transport protein SCO1/SenC [Brucella sp. NF 2653]
          Length = 196

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 72/193 (37%), Positives = 105/193 (54%), Gaps = 4/193 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    I   + + V+   A  +F          F    +L+  DG  FS   L   P++
Sbjct: 1   MKKFLPIFIVVFIVVIIGAAGFNFVRDKQAAKEPFGGSFNLITMDGKPFSEKDLRATPAV 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  LD  LKQ+ P    + AYF+TVDP+RDT +VM  +V   +DR
Sbjct: 61  VFFGFTHCPDVCPTTLYELDGWLKQLGPEAGDIKAYFVTVDPERDTQDVMSTYVSNVTDR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+GI+G P ++  + K++ +Y   V  E       Y +DHT ++ L D  G   G I Y+
Sbjct: 121 IMGITGTPDNIAEMVKSYHVYARKVPIED----GDYTMDHTASIFLLDKGGRFRGTIAYQ 176

Query: 181 DDSDSAIEKINRL 193
           ++ D+A+EK+  L
Sbjct: 177 ENPDTALEKLKNL 189


>gi|188582660|ref|YP_001926105.1| electron transport protein SCO1/SenC [Methylobacterium populi
           BJ001]
 gi|179346158|gb|ACB81570.1| electron transport protein SCO1/SenC [Methylobacterium populi
           BJ001]
          Length = 196

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 10/200 (5%)

Query: 1   MKALGIILGTILLAVLGSIAYVS------FSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
           M+    +L  +   V G +                 G         LV QDG   +    
Sbjct: 1   MRPSRSVLLPLAAFVAGLVVISVALVMTLVPQHPQSGPSSIGGPFTLVNQDGATVTERDF 60

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
             KP ++FFGFT+C  VCPTTL ++  +L  + P    L   F++VDP+RDTP+ +K ++
Sbjct: 61  AGKPYLMFFGFTHCPDVCPTTLQQISDVLAALGPKADALKVAFVSVDPERDTPDSLKTYL 120

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  RI+G++G P  V    K FR Y   V ++       Y ++HT  + L D     V
Sbjct: 121 SSFDPRIVGLTGSPEQVAAAVKTFRAYAKKVPSQ----GGDYTMEHTALVYLMDARNGFV 176

Query: 175 GVIPYKDDSDSAIEKINRLI 194
           G +     +     ++++ I
Sbjct: 177 GAVNLNRPAAETAAELSKRI 196


>gi|17986876|ref|NP_539510.1| SCO2 protein [Brucella melitensis bv. 1 str. 16M]
 gi|23502287|ref|NP_698414.1| SCO1/SenC family protein [Brucella suis 1330]
 gi|148560641|ref|YP_001259309.1| SCO1/SenC family protein [Brucella ovis ATCC 25840]
 gi|161619364|ref|YP_001593251.1| electron transport protein SCO1/SenC [Brucella canis ATCC 23365]
 gi|163843671|ref|YP_001628075.1| electron transport protein SCO1/SenC [Brucella suis ATCC 23445]
 gi|225627868|ref|ZP_03785905.1| SCO2 protein [Brucella ceti str. Cudo]
 gi|225852898|ref|YP_002733131.1| electron transport protein SCO1/SenC [Brucella melitensis ATCC
           23457]
 gi|254702138|ref|ZP_05163966.1| electron transport protein SCO1/SenC [Brucella suis bv. 5 str. 513]
 gi|254704674|ref|ZP_05166502.1| electron transport protein SCO1/SenC [Brucella suis bv. 3 str. 686]
 gi|254708089|ref|ZP_05169917.1| electron transport protein SCO1/SenC [Brucella pinnipedialis
           M163/99/10]
 gi|254710458|ref|ZP_05172269.1| electron transport protein SCO1/SenC [Brucella pinnipedialis B2/94]
 gi|256031952|ref|ZP_05445566.1| electron transport protein SCO1/SenC [Brucella pinnipedialis
           M292/94/1]
 gi|256045047|ref|ZP_05447948.1| electron transport protein SCO1/SenC [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256061474|ref|ZP_05451618.1| electron transport protein SCO1/SenC [Brucella neotomae 5K33]
 gi|256113970|ref|ZP_05454753.1| electron transport protein SCO1/SenC [Brucella melitensis bv. 3
           str. Ether]
 gi|256160151|ref|ZP_05457845.1| electron transport protein SCO1/SenC [Brucella ceti M490/95/1]
 gi|256255357|ref|ZP_05460893.1| electron transport protein SCO1/SenC [Brucella ceti B1/94]
 gi|256263620|ref|ZP_05466152.1| electron transporter SCO1/SenC [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369832|ref|YP_003107343.1| SCO1/SenC family protein [Brucella microti CCM 4915]
 gi|260169089|ref|ZP_05755900.1| SCO1/SenC family protein [Brucella sp. F5/99]
 gi|260565354|ref|ZP_05835838.1| electron transporter SCO1/SenC [Brucella melitensis bv. 1 str. 16M]
 gi|260566078|ref|ZP_05836548.1| electron transporter SCO1/SenC [Brucella suis bv. 4 str. 40]
 gi|261222558|ref|ZP_05936839.1| electron transporter SCO1/SenC [Brucella ceti B1/94]
 gi|261315591|ref|ZP_05954788.1| electron transporter SCO1/SenC [Brucella pinnipedialis M163/99/10]
 gi|261318029|ref|ZP_05957226.1| electron transporter SCO1/SenC [Brucella pinnipedialis B2/94]
 gi|261325480|ref|ZP_05964677.1| electron transporter SCO1/SenC [Brucella neotomae 5K33]
 gi|261752707|ref|ZP_05996416.1| electron transporter SCO1/SenC [Brucella suis bv. 5 str. 513]
 gi|261755367|ref|ZP_05999076.1| electron transporter SCO1/SenC [Brucella suis bv. 3 str. 686]
 gi|261758594|ref|ZP_06002303.1| electron transporter SCO1/SenC [Brucella sp. F5/99]
 gi|265989060|ref|ZP_06101617.1| electron transporter SCO1/SenC [Brucella pinnipedialis M292/94/1]
 gi|265991473|ref|ZP_06104030.1| electron transporter SCO1/SenC [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995311|ref|ZP_06107868.1| electron transporter SCO1/SenC [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998523|ref|ZP_06111080.1| electron transporter SCO1/SenC [Brucella ceti M490/95/1]
 gi|17982515|gb|AAL51774.1| sco2 protein [Brucella melitensis bv. 1 str. 16M]
 gi|23348262|gb|AAN30329.1| SCO1/SenC family protein [Brucella suis 1330]
 gi|148371898|gb|ABQ61877.1| SCO1/SenC family protein [Brucella ovis ATCC 25840]
 gi|161336175|gb|ABX62480.1| electron transport protein SCO1/SenC [Brucella canis ATCC 23365]
 gi|163674394|gb|ABY38505.1| electron transport protein SCO1/SenC [Brucella suis ATCC 23445]
 gi|225617873|gb|EEH14918.1| SCO2 protein [Brucella ceti str. Cudo]
 gi|225641263|gb|ACO01177.1| electron transport protein SCO1/SenC [Brucella melitensis ATCC
           23457]
 gi|255999995|gb|ACU48394.1| SCO1/SenC family protein [Brucella microti CCM 4915]
 gi|260151422|gb|EEW86516.1| electron transporter SCO1/SenC [Brucella melitensis bv. 1 str. 16M]
 gi|260155596|gb|EEW90676.1| electron transporter SCO1/SenC [Brucella suis bv. 4 str. 40]
 gi|260921142|gb|EEX87795.1| electron transporter SCO1/SenC [Brucella ceti B1/94]
 gi|261297252|gb|EEY00749.1| electron transporter SCO1/SenC [Brucella pinnipedialis B2/94]
 gi|261301460|gb|EEY04957.1| electron transporter SCO1/SenC [Brucella neotomae 5K33]
 gi|261304617|gb|EEY08114.1| electron transporter SCO1/SenC [Brucella pinnipedialis M163/99/10]
 gi|261738578|gb|EEY26574.1| electron transporter SCO1/SenC [Brucella sp. F5/99]
 gi|261742460|gb|EEY30386.1| electron transporter SCO1/SenC [Brucella suis bv. 5 str. 513]
 gi|261745120|gb|EEY33046.1| electron transporter SCO1/SenC [Brucella suis bv. 3 str. 686]
 gi|262553147|gb|EEZ08981.1| electron transporter SCO1/SenC [Brucella ceti M490/95/1]
 gi|262766424|gb|EEZ12213.1| electron transporter SCO1/SenC [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002257|gb|EEZ14832.1| electron transporter SCO1/SenC [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093672|gb|EEZ17677.1| electron transporter SCO1/SenC [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661257|gb|EEZ31518.1| electron transporter SCO1/SenC [Brucella pinnipedialis M292/94/1]
 gi|326409440|gb|ADZ66505.1| electron transport protein SCO1/SenC [Brucella melitensis M28]
 gi|326539146|gb|ADZ87361.1| electron transport protein SCO1/SenC [Brucella melitensis M5-90]
          Length = 196

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 73/193 (37%), Positives = 105/193 (54%), Gaps = 4/193 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    I   + + V+   A  +F          F    +LV  DG  FS   L   P++
Sbjct: 1   MKKFLPIFIVVFIIVIIGAAGFNFVRDKQAAKEPFGGSFNLVTMDGKPFSEKDLRATPAV 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  LD  LKQ+ P    + AYF+TVDP+RDT +VM  +V   +DR
Sbjct: 61  VFFGFTHCPDVCPTTLYELDGWLKQLGPEAGDIKAYFVTVDPERDTQDVMNTYVSNVTDR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+GI+G P ++  + K++ +Y   V  E       Y +DHT ++ L D  G   G I Y+
Sbjct: 121 IMGITGTPDNIAEMVKSYHVYARKVPIED----GDYTMDHTASIFLLDKGGRFRGTIAYQ 176

Query: 181 DDSDSAIEKINRL 193
           ++ D+A+EK+  L
Sbjct: 177 ENPDTALEKLKNL 189


>gi|310797776|gb|EFQ32669.1| SCO1/SenC [Glomerella graminicola M1.001]
          Length = 283

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/201 (22%), Positives = 87/201 (43%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
            G + +A    + +     K               G  +      L+ Q+G  F+   + 
Sbjct: 76  AGVLFVATGVGLTWYFEHEKQRMERKRIAEATKGIGRPKVGGSFELIDQNGNKFTSEDMK 135

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT-LLNAYFITVDPKRDTPEVMKKFV 114
            + ++V+FGFT+C  +CP  L ++ R+   V+      +   FIT DP+RD P V+K+++
Sbjct: 136 GRYALVYFGFTHCPDICPDELDKMARMYDLVEEKRPGSILPIFITCDPERDNPAVVKEYL 195

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  + IG++G    +  + K +R+Y +    +     + Y VDH+    L D  G  V
Sbjct: 196 SEFHPKFIGLTGTYDQIKAMCKLYRVYFST--PQHVKPGQDYLVDHSIYFYLMDPEGDFV 253

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             +  +    +A + I   + 
Sbjct: 254 EALGRQHSPTAAAKIILDHMN 274


>gi|322488098|emb|CBZ23344.1| putative cytochrome c oxidase assembly factor [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 296

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/211 (23%), Positives = 89/211 (42%), Gaps = 16/211 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGT 47
           +K  G+I G  LL +         + +                G         LV   G 
Sbjct: 77  LKKYGMIGGFALLCIATLWYGSRQAKQRYFGAEGSARVSVETRGRPALGGPFVLVNTKGE 136

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRD 105
             S +      +  +FGFT+C  +CP  L+R+  ++   +       +   F++ DP+RD
Sbjct: 137 PVSQAEFLGSWAFFYFGFTHCPEICPVELNRMSHVVDAVRAGRPQERIAPLFVSCDPRRD 196

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALL 165
           + E + +++  F    IG+ G P  V    +++RIY + + AE+   +E Y +DH+ A+ 
Sbjct: 197 SLEAIDEYLSVFHPDFIGLVGTPKQVNDACRSYRIYYS-IPAEEDAEQEDYLIDHSIAIF 255

Query: 166 LFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           LFD  G  V     + D     EK+   ++ 
Sbjct: 256 LFDPQGRFVDFFGNRYDEREITEKVLHYMSE 286


>gi|116786636|gb|ABK24183.1| unknown [Picea sitchensis]
          Length = 331

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/201 (24%), Positives = 85/201 (42%), Gaps = 21/201 (10%)

Query: 5   GIILGTILLAVLGSIAYVSFSSK----------------FVDGNRRFNSDVHLVAQDGTD 48
            + L  +++  +G I Y     K                   G        +LV  +G  
Sbjct: 124 WMSLVLLIITGVGLIIYFDREKKRRIEEIKNLPAQVKEGPSVGKAAIGGPFNLVNHEGKP 183

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTP 107
            +      K S+++FGFT+C  +CP  L ++   + ++           FI+VDP+RDT 
Sbjct: 184 VTDRDFTGKWSLIYFGFTHCPDICPDELQKMVAAIDKIKEKAGFEVVPVFISVDPERDTV 243

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E + ++V+ F   ++G++G   D+ +VA+ FR+Y      E    E  Y VDH+  + L 
Sbjct: 244 EQVHEYVKEFHPNLVGLTGSQSDIRQVAREFRVYYMKTEEE----EADYLVDHSIIMYLM 299

Query: 168 DTAGSIVGVIPYKDDSDSAIE 188
           D     V       D D+  E
Sbjct: 300 DPDMEFVKFFGKNYDVDALTE 320


>gi|254714451|ref|ZP_05176262.1| electron transport protein SCO1/SenC [Brucella ceti M644/93/1]
 gi|254717349|ref|ZP_05179160.1| electron transport protein SCO1/SenC [Brucella ceti M13/05/1]
 gi|261219179|ref|ZP_05933460.1| electron transporter SCO1/SenC [Brucella ceti M13/05/1]
 gi|261322240|ref|ZP_05961437.1| electron transporter SCO1/SenC [Brucella ceti M644/93/1]
 gi|260924268|gb|EEX90836.1| electron transporter SCO1/SenC [Brucella ceti M13/05/1]
 gi|261294930|gb|EEX98426.1| electron transporter SCO1/SenC [Brucella ceti M644/93/1]
          Length = 196

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 73/193 (37%), Positives = 105/193 (54%), Gaps = 4/193 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    I   + + V+   A  +F          F    +LV  DG  FS   L   P++
Sbjct: 1   MKKFLPIFIVVFIIVIIGAAGFNFVRDKQAAKEPFGGSFNLVTMDGKPFSEKDLRATPAV 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  LD  LKQ+ P    + AYF+TVDP+RDT +VM  +V   +DR
Sbjct: 61  VFFGFTHCPDVCPTTLYELDGWLKQLGPKAGDIKAYFVTVDPERDTQDVMNTYVSNVTDR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+GI+G P ++  + K++ +Y   V  E       Y +DHT ++ L D  G   G I Y+
Sbjct: 121 IMGITGTPDNIAEMVKSYHVYARKVPIED----GDYTMDHTASIFLLDKGGRFRGTIAYQ 176

Query: 181 DDSDSAIEKINRL 193
           ++ D+A+EK+  L
Sbjct: 177 ENPDTALEKLKNL 189


>gi|322695509|gb|EFY87316.1| protein sco1 [Metarhizium acridum CQMa 102]
          Length = 244

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/201 (24%), Positives = 86/201 (42%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLSSLY 55
            G + +A  G++ +     K               G  +      L+ Q+G  F+   + 
Sbjct: 42  AGILFVATCGALVWYFEFEKERMQRKRIADASKGVGRPKVGGPFELLDQNGKPFTSEMMK 101

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL-NAYFITVDPKRDTPEVMKKFV 114
            K S+V+FGFT C  +CP  L ++ R+L  V+          FIT DP+RD P  +K ++
Sbjct: 102 GKYSLVYFGFTRCPDICPEELDKMARMLDIVEEKAPGALLPIFITCDPERDDPPALKSYL 161

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F D+ IG++G    +  + K +R+Y +    +     + Y VDH+    L D  G  V
Sbjct: 162 AEFHDKFIGLTGTYDQIKDLCKKYRVYFST--PQNVKPGQDYLVDHSIYFYLMDPEGDFV 219

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             +  +   D   + I   + 
Sbjct: 220 EALGRQHSPDQGAQLILDHMK 240


>gi|323524650|ref|YP_004226803.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1001]
 gi|323381652|gb|ADX53743.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1001]
          Length = 205

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 53/189 (28%), Positives = 93/189 (49%), Gaps = 5/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           LG  LL         +F +  + GN +F S+  L    G   +++    K  ++FFG+T+
Sbjct: 19  LGGALLVGGCGKEQPAFQNLDITGNTQFGSNFSLPDTSGKVRTMADYKGKVVVLFFGYTH 78

Query: 68  CSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-IS 125
           C  VCPTT++ L + L+Q+       +   F+T+DP+RDT  ++ ++V  F+   +G   
Sbjct: 79  CPDVCPTTMAELSQALQQLGPEDAKRVQVLFVTLDPERDTAPLLAQYVPAFNPTFVGLRP 138

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
            D  ++ +V K+FR+Y   V  +     + Y +DHT A  +FDT G +         +  
Sbjct: 139 ADEAELKKVTKDFRVYYAKVPGK---TPDSYTMDHTAASYVFDTDGKLRLFARDGQGAAP 195

Query: 186 AIEKINRLI 194
            +  I  L+
Sbjct: 196 WVHDIKLLL 204


>gi|156088299|ref|XP_001611556.1| SCO1/SenC family protein [Babesia bovis]
 gi|154798810|gb|EDO07988.1| SCO1/SenC family protein [Babesia bovis]
          Length = 245

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/202 (21%), Positives = 86/202 (42%), Gaps = 14/202 (6%)

Query: 9   GTILLAVLGSIAYVSFSS----------KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
             ++   + +  Y    S          +   G  +      LV Q G + SLS    + 
Sbjct: 41  SLLVCGGVAAGVYTFIESRRKQQRAFVDEERYGKPQLGGPFTLVDQHGKERSLSDFKGRL 100

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL-NAYFITVDPKRDTPEVMKKFVQRF 117
            +++FGF NC  VCP  + +   ++  +D     +    FITVDPKRDT   +  + + +
Sbjct: 101 VLIYFGFANCPDVCPVEMDKQRAVIDILDKRFGPVLQPLFITVDPKRDTVSKLAVYAKAY 160

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
             R++ ++G    +  V+K FR+Y N      +  ++ Y +DH+    L D  G  +   
Sbjct: 161 HPRLVALTGTDDQIKDVSKKFRVYYNQ---GITATDQDYLIDHSIIHYLLDENGEFIEFY 217

Query: 178 PYKDDSDSAIEKINRLITYGNV 199
               ++    + I +++   ++
Sbjct: 218 SKNVNAKEMADDIAKIVQKRDI 239


>gi|328544920|ref|YP_004305029.1| Electron transport protein SCO1/SenC [Polymorphum gilvum
           SL003B-26A1]
 gi|326414662|gb|ADZ71725.1| Electron transport protein SCO1/SenC [Polymorphum gilvum
           SL003B-26A1]
          Length = 208

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/170 (32%), Positives = 87/170 (51%), Gaps = 4/170 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
               ++          LVA DG   + +    KP++ +FGFT C  VCPTTLS +   + 
Sbjct: 36  GQALIEPVSAIGGPFTLVAGDGRTVTDAEFKGKPTLYYFGFTFCPDVCPTTLSDMQGWIT 95

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            +      LN  F+TVDP+RDTPEV++ +V  F  RI+ +SG    +  + + +R+Y   
Sbjct: 96  ALGADADKLNYAFVTVDPERDTPEVIRDYVAAFDPRIVPLSGTEAQIADMIRTYRVYAKK 155

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           V  +       Y +DH+ A+ L +     VG I Y +  ++A+ K+ RLI
Sbjct: 156 VPLDD----GGYTMDHSAAVFLMNKDNRFVGTIAYGEAEETALAKLRRLI 201


>gi|320032645|gb|EFW14597.1| mitochondrial metallochaperone Sco1 [Coccidioides posadasii str.
           Silveira]
          Length = 303

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 89/205 (43%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G I Y  +    ++           G  +      L   DG  F+   
Sbjct: 87  WKAALLFVLTGAGMIVYFQYEKARLERERIVQMSKGVGKPKVGGPFILKDLDGNVFTEEQ 146

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRL---DRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
           L  K + ++FGFT+C  +CP  L ++     ++K+     + L + F+T DP RDTPEV+
Sbjct: 147 LKGKYNFIYFGFTHCPDICPDELDKMAAIIDIIKEKSKGNSPLRSIFVTCDPARDTPEVL 206

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           + +++ F   I+G++G    V  + K +R+Y +    E     E Y VDH+    L D  
Sbjct: 207 RAYLKEFHGDILGLTGTYEQVKNMCKQYRVYFST--PENIKPGEDYLVDHSIYFYLMDPE 264

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  V  I  +D  +SA   I   I 
Sbjct: 265 GDFVECIGRQDTPESAANIILDHIK 289


>gi|303313840|ref|XP_003066929.1| SCO1/SenC family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|240106596|gb|EER24784.1| SCO1/SenC family protein [Coccidioides posadasii C735 delta SOWgp]
          Length = 303

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 89/205 (43%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G I Y  +    ++           G  +      L   DG  F+   
Sbjct: 87  WKAALLFVLTGAGMIVYFQYEKARLERERIVQMSKGVGKPKVGGPFILKDLDGNVFTEEQ 146

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRL---DRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
           L  K + ++FGFT+C  +CP  L ++     ++K+     + L + F+T DP RDTPEV+
Sbjct: 147 LKGKYNFIYFGFTHCPDICPDELDKMAAIIDIIKEKSKGNSPLRSIFVTCDPARDTPEVL 206

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           + +++ F   I+G++G    V  + K +R+Y +    E     E Y VDH+    L D  
Sbjct: 207 RAYLKEFHGDILGLTGTYEQVKNMCKQYRVYFST--PENIKPGEDYLVDHSIYFYLMDPE 264

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  V  I  +D  +SA   I   I 
Sbjct: 265 GDFVECIGRQDTPESAANIILDHIK 289


>gi|119185259|ref|XP_001243439.1| hypothetical protein CIMG_07335 [Coccidioides immitis RS]
          Length = 303

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 89/205 (43%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G I Y  +    ++           G  +      L   DG  F+   
Sbjct: 87  WKAALLFVLTGAGMIVYFQYEKARLERERIVQMSKGVGKPKVGGPFILKDLDGNVFTEEQ 146

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRL---DRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
           L  K + ++FGFT+C  +CP  L ++     ++K+     + L + F+T DP RDTPEV+
Sbjct: 147 LKGKYNFIYFGFTHCPDICPDELDKMAAIIDIIKEKSKGNSPLRSIFVTCDPARDTPEVL 206

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           + +++ F   I+G++G    V  + K +R+Y +    E     E Y VDH+    L D  
Sbjct: 207 RAYLKEFHGDILGLTGTYEQVKNMCKQYRVYFST--PENIKPGEDYLVDHSIYFYLMDPE 264

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  V  I  +D  +SA   I   I 
Sbjct: 265 GDFVECIGRQDTPESAANIILDHIK 289


>gi|78067635|ref|YP_370404.1| electron transport protein SCO1/SenC [Burkholderia sp. 383]
 gi|77968380|gb|ABB09760.1| Electron transport protein SCO1/SenC [Burkholderia sp. 383]
          Length = 205

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 89/189 (47%), Gaps = 5/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
             T  L + G      F +  + GN +F SD  L    G   +L+    +  ++FFG+T+
Sbjct: 19  AFTAALLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTAGKVHTLADFKGRAVVMFFGYTH 78

Query: 68  CSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-IS 125
           C  VCPTT++ L   LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG   
Sbjct: 79  CPDVCPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRP 138

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
            D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +        
Sbjct: 139 ADEAALKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPGP 195

Query: 186 AIEKINRLI 194
            +  +  L+
Sbjct: 196 WVHDLKLLV 204


>gi|329891289|ref|ZP_08269632.1| SCO1/SenC family protein [Brevundimonas diminuta ATCC 11568]
 gi|328846590|gb|EGF96154.1| SCO1/SenC family protein [Brevundimonas diminuta ATCC 11568]
          Length = 201

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/192 (28%), Positives = 88/192 (45%), Gaps = 7/192 (3%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           LG I + V+G     + ++    G      D  L  QDG     + L  K ++VFFGFT 
Sbjct: 15  LGLITMVVVGGRQQATQTTDVATGQPLVGGDFTLTNQDGQVVDQTILNGKWTLVFFGFTY 74

Query: 68  CSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFV--QRFSDRIIGIS 125
           C   CPTTL  L+ + +++      L   FI++DP+RDTP+++K ++    F D +IG++
Sbjct: 75  CPDYCPTTLGVLNAVQERMGDKAKDLQIVFISIDPERDTPQMLKDYLSSDGFPDGVIGLT 134

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
           G P  V + AK +R +   V     G  E Y ++H   + L    G     + +      
Sbjct: 135 GTPEQVAKAAKAYRAFYQKV-----GEGEGYTMNHGLTVYLMGPDGKFRSAVAHDLGPSR 189

Query: 186 AIEKINRLITYG 197
               I   +  G
Sbjct: 190 TATLIENAMEKG 201


>gi|313902943|ref|ZP_07836339.1| electron transport protein SCO1/SenC [Thermaerobacter subterraneus
           DSM 13965]
 gi|313466878|gb|EFR62396.1| electron transport protein SCO1/SenC [Thermaerobacter subterraneus
           DSM 13965]
          Length = 231

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 91/228 (39%), Gaps = 34/228 (14%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD------------------------------ 30
           M+ L  +   +L+ +     +    +                                  
Sbjct: 1   MRKLWWVGLAVLVLLAAGSWWFGTRAGSDQPGGPGAGPAGTPAPSSGQGTAGTNNGFKGM 60

Query: 31  --GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDP 88
              N R   D  L A DG+ F LS    K  ++FFG+TNC  VCP T++    L K+V  
Sbjct: 61  VLQNPREAPDFELKAADGSTFKLSDQRGKVVLLFFGYTNCPDVCPATMAVWKELGKRVKD 120

Query: 89  TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
               +   FITVDP+RDTP+ +++++ ++ + I+G++G    +  V   + +    V   
Sbjct: 121 RADDVRMVFITVDPERDTPKRLREYLPKYGEHIVGLTGTQEQLKPVWDAYSVKPERVEMP 180

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            S +  KY + H   + L D  G I  + P    ++     I  L+  
Sbjct: 181 DSAL--KYAMAHPAQVYLIDPEGKIRLLYPLGYKAEDIEHDIRLLLEQ 226


>gi|322496381|emb|CBZ31452.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 310

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 51/211 (24%), Positives = 87/211 (41%), Gaps = 16/211 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGT 47
           +K  G+I G  LL +         + K                G         LV   G 
Sbjct: 91  LKTYGMIGGFALLCIATLWYGSRQAKKRYFGAEGSARVSVETRGRPALGGPFVLVNTKGE 150

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRD 105
             S +      +  +FGFT+C  +CP  L+R+  ++  V            F++ DP+RD
Sbjct: 151 PVSQAEFLGSWAFFYFGFTHCPEICPVELNRMSHVVDAVRAARPQERIAPLFVSCDPRRD 210

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALL 165
           + E + +++  F    IG+ G P  V    +++RIY + +  E+   +E Y +DH+ A+ 
Sbjct: 211 SLEAIDEYLSVFHPDFIGLVGTPKQVNDACRSYRIYYS-IPTEEDAEQEDYLIDHSIAIF 269

Query: 166 LFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           LFD  G  V     + D     EK+   ++ 
Sbjct: 270 LFDPQGRFVDFFGNRYDEREITEKVLHYMSE 300


>gi|298369882|ref|ZP_06981198.1| antioxidant, AhpC/TSA family [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281342|gb|EFI22831.1| antioxidant, AhpC/TSA family [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 223

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 52/164 (31%), Positives = 78/164 (47%), Gaps = 3/164 (1%)

Query: 32  NRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
                 D  L   DG  F+LS L  K  ++ FG+TNC  VCPT L   + +LKQ+     
Sbjct: 62  KEDIGGDFTLTDGDGKPFNLSDLKGKVVVLSFGYTNCPDVCPTELLTQNDVLKQLGDQAK 121

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKS 150
            +   F++VDP+RDTPEV+ K+ ++F+   IG++      + V K  +R+    V   + 
Sbjct: 122 DVKVAFVSVDPERDTPEVIGKYAKQFNPDFIGLTATGDQSLPVIKQQYRVVSAKVN--QG 179

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
                Y VDHT    L D  G +    PY  +  +    I  L+
Sbjct: 180 ADSNTYLVDHTAGAYLVDKNGDVAVFEPYGSEPAAIAADIKTLL 223


>gi|146076547|ref|XP_001462953.1| cytochrome c oxidase assembly factor [Leishmania infantum JPCM5]
 gi|134067034|emb|CAM65139.1| putative cytochrome c oxidase assembly factor [Leishmania infantum
           JPCM5]
          Length = 310

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 51/211 (24%), Positives = 87/211 (41%), Gaps = 16/211 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGT 47
           +K  G+I G  LL +         + K                G         LV   G 
Sbjct: 91  LKTYGMIGGFALLCIATLWYGSRQAKKRYFGAEGSARVSVETRGRPALGGPFVLVNTKGE 150

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRD 105
             S +      +  +FGFT+C  +CP  L+R+  ++  V            F++ DP+RD
Sbjct: 151 PVSQAEFLGSWAFFYFGFTHCPEICPVELNRMSHVVDAVRAARPQERIAPLFVSCDPRRD 210

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALL 165
           + E + +++  F    IG+ G P  V    +++RIY + +  E+   +E Y +DH+ A+ 
Sbjct: 211 SLEAIDEYLSVFHPDFIGLVGTPKQVNDACRSYRIYYS-IPTEEDAEQEDYLIDHSIAIF 269

Query: 166 LFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           LFD  G  V     + D     EK+   ++ 
Sbjct: 270 LFDPQGRFVDFFGNRYDEREITEKVLHYMSE 300


>gi|163852639|ref|YP_001640682.1| electron transport protein SCO1/SenC [Methylobacterium extorquens
           PA1]
 gi|163664244|gb|ABY31611.1| electron transport protein SCO1/SenC [Methylobacterium extorquens
           PA1]
          Length = 226

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 59/200 (29%), Positives = 88/200 (44%), Gaps = 10/200 (5%)

Query: 1   MKALGIILGTILLAVLGSIAYVS------FSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
           M+    +L  +   V G +A                G         LV QDG   S    
Sbjct: 31  MRPSRSVLLPLAAFVAGLVAISVALVMTLVPQHPQSGPSGIGGPFTLVNQDGATVSERDF 90

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
             KP ++FFGFT+C  VCPTTL ++  +L  + P    L   F++VDP+RDTP  +K ++
Sbjct: 91  AGKPYLMFFGFTHCPDVCPTTLQQISDVLAALGPKADRLKVAFVSVDPERDTPASLKTYL 150

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  RI+G++G P  V    K FR Y   V     G    Y ++HT  + L D     V
Sbjct: 151 SSFDPRIVGLTGSPEQVAATVKTFRAYAKKVP----GSSGDYTMEHTALVYLMDARNGFV 206

Query: 175 GVIPYKDDSDSAIEKINRLI 194
           G +     +     ++++ I
Sbjct: 207 GAVNLNRPAAETAAELSKRI 226


>gi|170699770|ref|ZP_02890803.1| electron transport protein SCO1/SenC [Burkholderia ambifaria
           IOP40-10]
 gi|172061794|ref|YP_001809446.1| electron transport protein SCO1/SenC [Burkholderia ambifaria
           MC40-6]
 gi|170135297|gb|EDT03592.1| electron transport protein SCO1/SenC [Burkholderia ambifaria
           IOP40-10]
 gi|171994311|gb|ACB65230.1| electron transport protein SCO1/SenC [Burkholderia ambifaria
           MC40-6]
          Length = 205

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 54/189 (28%), Positives = 87/189 (46%), Gaps = 5/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
                  + G      F +  + GN +F SD  L    G   +L+    +  ++FFG+T+
Sbjct: 19  AFAAATLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTTGKVRTLADFKGRAVVMFFGYTH 78

Query: 68  CSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-IS 125
           C  VCPTT++ L   LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG   
Sbjct: 79  CPDVCPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRP 138

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
            D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +        
Sbjct: 139 ADETQLKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPGP 195

Query: 186 AIEKINRLI 194
            +  +  L+
Sbjct: 196 WVHDLKLLV 204


>gi|163735630|ref|ZP_02143061.1| hypothetical protein RLO149_00145 [Roseobacter litoralis Och 149]
 gi|161391058|gb|EDQ15396.1| hypothetical protein RLO149_00145 [Roseobacter litoralis Och 149]
          Length = 188

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 53/190 (27%), Positives = 89/190 (46%), Gaps = 4/190 (2%)

Query: 7   ILGTILLAVLGSIAYVSFS--SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFG 64
           + G   LA +  + +  +   S   D    F ++  L    G   +      +  +VFFG
Sbjct: 1   MAGVAALAFVWLLLWSDYRADSARTDAEPPFFAEFELTDHQGMVQTEEDFAGRWMLVFFG 60

Query: 65  FTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGI 124
           FTNC  VCPTTLS +  +++ +      +   FIT+DP+RDTP  + ++V  F   IIG+
Sbjct: 61  FTNCPDVCPTTLSEVAAVMEGLGDDAAKVQPIFITIDPERDTPAALAEYVPLFDAGIIGL 120

Query: 125 SGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSD 184
           +G P  +   ++ F I+   V  E++   + Y + HT+ L LFD         PY   ++
Sbjct: 121 TGTPEQIAATSETFPIFFERV--EEAAAPDGYTMGHTSHLFLFDPDAGFADSWPYGTSAE 178

Query: 185 SAIEKINRLI 194
             +  +   I
Sbjct: 179 EILADLEERI 188


>gi|254562397|ref|YP_003069492.1| electron transport protein SenC-related [Methylobacterium
           extorquens DM4]
 gi|254269675|emb|CAX25647.1| Electron transport protein SenC-related [Methylobacterium
           extorquens DM4]
          Length = 200

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 56/188 (29%), Positives = 85/188 (45%), Gaps = 4/188 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
                L+A+  ++           G         LV QDG   S      KP ++FFGFT
Sbjct: 17  AFVAGLVAISVALVMTLVPQHPQSGPSGIGGPFTLVNQDGATVSERDFAGKPYLMFFGFT 76

Query: 67  NCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISG 126
           +C  VCPTTL ++  +L  + P    L   F++VDP+RDTP  +K ++  F  RI+G++G
Sbjct: 77  HCPDVCPTTLQQISDVLAALGPKADRLKVAFVSVDPERDTPASLKTYLSSFDPRIVGLTG 136

Query: 127 DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSA 186
            P  V    K FR Y   V     G    Y ++HT  + L D     VG +     +   
Sbjct: 137 SPEQVAATVKTFRAYAKKVP----GSSGDYTMEHTALVYLMDARNGFVGAVNLNRPAAET 192

Query: 187 IEKINRLI 194
             ++++ I
Sbjct: 193 AAELSKRI 200


>gi|307106761|gb|EFN55006.1| hypothetical protein CHLNCDRAFT_24122 [Chlorella variabilis]
          Length = 238

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 76/173 (43%), Gaps = 5/173 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
            S  V G         L+   G  F+   L  + ++++FGFT C  +CP  L ++     
Sbjct: 64  KSSVVVGQAAIGGPFDLIDHTGKRFTDKDLLGRFALLYFGFTWCPDICPEELEKIAAATD 123

Query: 85  QVDP-TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVN 143
             +  +G  +   F++VDP+RD  E ++ +V+ F  R+IG++G    V   AK +R+Y +
Sbjct: 124 LTEKLSGVQVVPVFLSVDPQRDGVEQVRDYVKEFHPRMIGLTGPYERVGEAAKAYRVYFS 183

Query: 144 NVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
                    E+ Y VDH+    L +  G  V        ++   + I   +  
Sbjct: 184 KTQD----SEDDYLVDHSIITYLINPEGKFVSFYGKNFTAEEMAKSIASHVQR 232


>gi|302894507|ref|XP_003046134.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256727061|gb|EEU40421.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 279

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 81/201 (40%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLSSLY 55
            G + +   G + +     K               G  +      LV Q+G  F+   + 
Sbjct: 77  AGILFVGTCGLLVWYFEYEKERMQRKRIAEAAKGVGRPKVGGTFELVDQNGKPFTSEMMK 136

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K S+V+FGFT C  +CP  L ++  +     +     L   FIT DP RD P  +K+++
Sbjct: 137 GKHSLVYFGFTRCPDICPEELDKMATMFDIVQEKAPDALLPIFITCDPARDDPPALKEYL 196

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F ++ IG++G    +  + K +R+Y +    +     + Y VDH+    L D  G  V
Sbjct: 197 SEFHEKFIGLTGTYDQIKALCKKYRVYFST--PQNVKPGQDYLVDHSIYFYLMDPEGDFV 254

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             +  +     A   I   + 
Sbjct: 255 EALGRQHSPQQAAAVILDHMK 275


>gi|253997244|ref|YP_003049308.1| electron transport protein SCO1/SenC [Methylotenera mobilis JLW8]
 gi|253983923|gb|ACT48781.1| electron transport protein SCO1/SenC [Methylotenera mobilis JLW8]
          Length = 202

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 4/173 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
             F+S  + G   F + + L    G   SLS    K   +FFG+T+C  VCPTTL+ + +
Sbjct: 34  QKFNSTDITGV-DFGNTLSLTDHTGKPRSLSDFKGKVVALFFGYTHCPDVCPTTLNDMKQ 92

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
            +K +      +   F+T+DP+RDT  ++ +FV  F    IG+ G       V K+F+I+
Sbjct: 93  SMKLLGAHANEMQVLFVTLDPERDTQPLLAQFVPAFDPSFIGLYGTKEQTATVLKDFKIF 152

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              V  +       Y +DH+  + +FD  G I   + Y    D     I +L+
Sbjct: 153 AAKVENKGRS---GYTIDHSAGVYVFDKTGKIRLYVDYGTKPDMIAADIQKLL 202


>gi|254577115|ref|XP_002494544.1| ZYRO0A03982p [Zygosaccharomyces rouxii]
 gi|238937433|emb|CAR25611.1| ZYRO0A03982p [Zygosaccharomyces rouxii]
          Length = 300

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 57/201 (28%), Positives = 90/201 (44%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
             ++ L V G + Y     K               G        HL   +G  FS   L 
Sbjct: 82  AASLFLIVGGGLYYYFTKEKRRLEIEKEAEANRGYGKPMVGGPFHLKDCEGNVFSDKDLL 141

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K SI++FGFT+C  +CP  L +L   L ++    G+ +   F+T DP RDTPEV+ +++
Sbjct: 142 GKFSIIYFGFTHCPDICPDELDKLGVWLDKLKSKYGSKVQPIFVTCDPNRDTPEVLTQYL 201

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           Q F   IIG++G    V    K +R+Y +     +    + Y VDH+    L D  G+ +
Sbjct: 202 QDFHPDIIGLTGTYDQVKNACKQYRVYFSTPP--QVQPGQDYLVDHSIFFYLMDPEGNFI 259

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             +    D+++  E+I   I 
Sbjct: 260 EAMGRNYDNETGAERIQEHIK 280


>gi|171320554|ref|ZP_02909579.1| electron transport protein SCO1/SenC [Burkholderia ambifaria MEX-5]
 gi|171094213|gb|EDT39295.1| electron transport protein SCO1/SenC [Burkholderia ambifaria MEX-5]
          Length = 205

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 54/189 (28%), Positives = 87/189 (46%), Gaps = 5/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
                  + G      F +  + GN +F SD  L    G   +L+    +  ++FFG+T+
Sbjct: 19  AFAAATLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTAGKVRTLADFKGRAVVMFFGYTH 78

Query: 68  CSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-IS 125
           C  VCPTT++ L   LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG   
Sbjct: 79  CPDVCPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRP 138

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
            D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +        
Sbjct: 139 ADEAQLKKVTKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPGP 195

Query: 186 AIEKINRLI 194
            +  +  L+
Sbjct: 196 WVHDLKLLV 204


>gi|162329549|ref|NP_001104758.1| protein SCO2 homolog, mitochondrial precursor [Mus musculus]
 gi|81879244|sp|Q8VCL2|SCO2_MOUSE RecName: Full=Protein SCO2 homolog, mitochondrial; Flags: Precursor
 gi|18043418|gb|AAH19554.1| Sco2 protein [Mus musculus]
          Length = 255

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 48/205 (23%), Positives = 94/205 (45%), Gaps = 15/205 (7%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF----------NSDVHLVAQDGTDFSLS 52
              +++  +  A LG     + + K     ++             D  L+   G     +
Sbjct: 47  RTRLLITALFGAGLGWAWLAARAEKEQWRQQQRTEALRQAAVGQGDFSLLDHKGQPRCKA 106

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVM 110
               +  +++FGFT+C  +CP  L +L ++++  + +P   L+   FITVDP+RD    M
Sbjct: 107 DFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPDLPLVQPVFITVDPERDDVAAM 166

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            ++VQ F  R++G++G    V   ++N+R+Y +    ++   ++ Y VDH+ A+ L +  
Sbjct: 167 ARYVQEFHPRLLGLTGSTEQVAHASRNYRVYYSAGPKDE---DQDYIVDHSIAIYLLNPD 223

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G           ++  +E I R I 
Sbjct: 224 GLFTDYYGRSRSAEQIVESIRRHIA 248


>gi|320582492|gb|EFW96709.1| Copper-binding protein of the mitochondrial inner membrane [Pichia
           angusta DL-1]
          Length = 270

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 57/201 (28%), Positives = 95/201 (47%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              + +    ++ YV  S K               G        +L+  +G  F+  +L 
Sbjct: 51  AVVVFVIFGSALTYVFTSEKEKLKLRREAEQNRGVGKPLIGGPFNLIDTEGKPFTQENLK 110

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K SI++FGFT+C  +CP  L +L  +L          L   FIT DP RD+PEV+K+++
Sbjct: 111 GKFSIIYFGFTHCPDICPDELDKLGLILDGLKSKYNIELQPIFITCDPARDSPEVVKEYL 170

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           + F   IIG++GD  ++ +  KN+R+Y +          + Y VDH+      D  G  +
Sbjct: 171 KDFHPSIIGLTGDYDEIKKCCKNYRVYFST--PRNVKPGQDYLVDHSIFFYFMDPEGEFI 228

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
            V+  + D++ AI+KI   I+
Sbjct: 229 DVLGRQYDAEEAIDKIKSNIS 249


>gi|242812458|ref|XP_002485961.1| mitochondrial metallochaperone Sco1, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218714300|gb|EED13723.1| mitochondrial metallochaperone Sco1, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 302

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/200 (29%), Positives = 87/200 (43%), Gaps = 16/200 (8%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G I Y       ++           G  +      L   DG +F+   
Sbjct: 89  WKAALLFVLTGAGMIIYFRVEKARLERKRITEMSKGVGKPKVGGPFVLKDLDGKEFTAED 148

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT---LLNAYFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++ +V        ++   FIT DP RDTPEV+
Sbjct: 149 LKGKYSFVYFGFTHCPDICPDELDKMAAIIDKVKEASNGAEVMRPVFITCDPARDTPEVL 208

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           K ++  F   IIG++G    V +V K +R+Y +    E     E Y VDH+    L D  
Sbjct: 209 KTYLAEFHPDIIGLTGTYEQVKQVCKAYRVYFST--PENVKSGEDYLVDHSIYFYLMDPE 266

Query: 171 GSIVGVIPYKDDSDSAIEKI 190
           G  V  +  +D  +SA   I
Sbjct: 267 GDFVECVGRQDTPESATRLI 286


>gi|259417996|ref|ZP_05741915.1| protein SenC [Silicibacter sp. TrichCH4B]
 gi|259346902|gb|EEW58716.1| protein SenC [Silicibacter sp. TrichCH4B]
          Length = 207

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/210 (22%), Positives = 88/210 (41%), Gaps = 17/210 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGN-------------RRFNSDVHLVAQDGT 47
           M+ + I+    ++A+LG + Y++      D                       L+   G 
Sbjct: 2   MRNIAILAFACVVALLGGVWYLTLRGNGSDDAFAQCRASAVAGGSAAIGGPFELLNAKGE 61

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTP 107
             +   +  +PS+V+FG+T C  VCP   +R    +  ++  G      FI++DPKRDTP
Sbjct: 62  TVTDKDVITEPSLVYFGYTFCPDVCPFDAARNADAVDVLEERGYSTTPVFISIDPKRDTP 121

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           EV+  F     +++IG++G P  +   ++ ++ Y       + G ++ Y VDHTT   L 
Sbjct: 122 EVVGDFAYNIHEKMIGLTGSPEQIKAASQAYKTYYK----AQEGDDDYYLVDHTTMTYLV 177

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
                 V         +   +++   +   
Sbjct: 178 LPEYGFVDFFRRDVTPEQMADRVACFMDNS 207


>gi|221632437|ref|YP_002521658.1| putative SCO1/SenC family protein [Thermomicrobium roseum DSM 5159]
 gi|221156986|gb|ACM06113.1| putative SCO1/SenC family protein [Thermomicrobium roseum DSM 5159]
          Length = 206

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/195 (25%), Positives = 95/195 (48%), Gaps = 7/195 (3%)

Query: 6   IILGTILLAVLGSIAYVSFSSKFVDG----NRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           +    I+LAV+G   + S ++  ++G      +    + L   DG   +L+    K ++V
Sbjct: 15  LAAIAIVLAVVGWYVWQSRAAPSLNGMLLDPPQEIPAIQLTGSDGQPHALTDFQGKVTVV 74

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFG+T+C  VCP T S + R    +      +   F++VDP+RD+PE +  ++ ++    
Sbjct: 75  FFGYTHCPDVCPMTASTMARARAMLGNQADRVQLVFVSVDPERDSPERLASYLAKYDPTF 134

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           +G++GD   +  +A  F ++   V   +S     Y V+HT++  + DT G +  V+P+  
Sbjct: 135 LGLTGDEDRIRELATVFGVHYAKV---ESTSALGYLVEHTSSSFVLDTQGKLRAVLPFGL 191

Query: 182 DSDSAIEKINRLITY 196
             +     +  L+  
Sbjct: 192 TPEQVASDLRALLRR 206


>gi|120612537|ref|YP_972215.1| electron transport protein SCO1/SenC [Acidovorax citrulli AAC00-1]
 gi|120591001|gb|ABM34441.1| electron transport protein SCO1/SenC [Acidovorax citrulli AAC00-1]
          Length = 207

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 53/184 (28%), Positives = 85/184 (46%), Gaps = 4/184 (2%)

Query: 12  LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAV 71
           LL         SF    + G   +  D+ L   +G    L     K  +VFFG+T C  V
Sbjct: 24  LLGGCSQEKAPSFQGVDITG-AEYARDLPLPDHNGQPRHLKDFAGKVVVVFFGYTQCPDV 82

Query: 72  CPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDV 131
           CPT+++ L  + + +   G  L   F+TVDP+RDTPEV+K ++  F    + + G P  +
Sbjct: 83  CPTSMAELAEVKRSLGADGDRLQGLFVTVDPERDTPEVLKAYMTNFDPGFLALRGTPEQL 142

Query: 132 MRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKIN 191
             VAK+F+IY   V  +       Y +DH+    ++D AG +     Y   + +    + 
Sbjct: 143 AAVAKDFKIYYKKVPGK---TPTSYTMDHSAGSYIYDPAGRLRVYHRYGSGAQALASDVK 199

Query: 192 RLIT 195
            L+ 
Sbjct: 200 ALLQ 203


>gi|330429965|gb|AEC21299.1| SCO1/SenC family protein [Pusillimonas sp. T7-7]
          Length = 200

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/197 (23%), Positives = 88/197 (44%), Gaps = 7/197 (3%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGN----RRFNSDVHLVAQDGTDFSLSSLYIK 57
           K   ++    ++A+   +           G+         D+ ++   G   +L+    K
Sbjct: 7   KRRALLSAAAMVALAPMLNACGKEEPVFIGSDITGTELGKDMAMIDGSGQLRTLADYKGK 66

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             +VFFGFT C  VCPT ++ L + ++ +      +    ++VDP+RDTPE++  +V  F
Sbjct: 67  VVVVFFGFTQCPDVCPTAMAELAQTMELLGDDAAKVQVLMVSVDPERDTPEILSAYVSAF 126

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           +   +G++G P  +   AK+F+ Y            E+Y +DH ++  L DT G    ++
Sbjct: 127 NPNFVGLTGSPEQLSTTAKSFKAYYAKSPG---ATPEQYSMDHASSFYLIDTEGEARVLV 183

Query: 178 PYKDDSDSAIEKINRLI 194
                +      I +L+
Sbjct: 184 SGNASAQDMANDIRQLL 200


>gi|315047744|ref|XP_003173247.1| SCO2 [Arthroderma gypseum CBS 118893]
 gi|311343633|gb|EFR02836.1| SCO2 [Arthroderma gypseum CBS 118893]
          Length = 304

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 55/201 (27%), Positives = 88/201 (43%), Gaps = 16/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
               +L   G I Y  +    ++           G  R      L   +G  F+  +L  
Sbjct: 90  ALLFVLTGAGMIVYFQYEKARLERERIVEMSKGVGKPRVGGPFVLKDLNGDTFTEENLKG 149

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQ---VDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           K S V+FGFT+C  +CP  L ++  ++ +         ++   FIT DP RDTPEV++ +
Sbjct: 150 KYSFVYFGFTHCPDICPDELDKMAEIIDEVRARSNGQEVMRPVFITCDPARDTPEVLRAY 209

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++ F   IIG++G    V  V + +R+Y +    +     E Y VDH+    L D  G  
Sbjct: 210 LKEFHKDIIGLTGTYEQVRDVCRQYRVYFST--PQNIKPGEDYLVDHSIYFYLMDPEGDF 267

Query: 174 VGVIPYKDDSDSAIEKINRLI 194
           V  I  +D   +A + I   I
Sbjct: 268 VECIGRQDTPQTASKVILDHI 288


>gi|307728360|ref|YP_003905584.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1003]
 gi|307582895|gb|ADN56293.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1003]
          Length = 205

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 91/189 (48%), Gaps = 5/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           LG  L          +F +  + GN +F S+  L    G   S++    K  ++FFG+T+
Sbjct: 19  LGGALFVAGCGKQQPAFQNLDITGNTQFGSNFSLPDTSGKIRSMADYKGKVVVLFFGYTH 78

Query: 68  CSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-IS 125
           C  VCPTT++ L + L+Q+       +   F+TVDP+RDT  ++ ++V  F+   +G   
Sbjct: 79  CPDVCPTTMAELSQALQQLGPEDAKRVQVLFVTVDPERDTAALLAQYVPAFNPTFVGLRP 138

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
            D   V +V K+FRIY   V  +     + Y +DHT A  +FDT G +         +  
Sbjct: 139 ADDAQVKKVTKDFRIYYAKVPGK---TPDSYTMDHTAASYVFDTDGKLRLFARDGQGAAP 195

Query: 186 AIEKINRLI 194
            +  I  L+
Sbjct: 196 WVHDIKLLL 204


>gi|218531480|ref|YP_002422296.1| electron transporter SCO1/SenC [Methylobacterium chloromethanicum
           CM4]
 gi|218523783|gb|ACK84368.1| electron transport protein SCO1/SenC [Methylobacterium
           chloromethanicum CM4]
          Length = 200

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 59/200 (29%), Positives = 89/200 (44%), Gaps = 10/200 (5%)

Query: 1   MKALGIILGTILLAVLGSIAYVS------FSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
           M+    +L  +   V G +A                G         LV QDG   S    
Sbjct: 5   MRPSRSVLLPLAAFVAGLVAISVALVMTLVPQHPQSGPSGIGGPFTLVNQDGATVSERDF 64

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
             KP ++FFGFT+C  VCPTTL ++  +L  + P    L   F++VDP+RDTP  +K ++
Sbjct: 65  AGKPYLMFFGFTHCPDVCPTTLQQISDVLAALGPKADRLKVAFVSVDPERDTPASLKTYL 124

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  RI+G++G P  V    K FR Y   V     G    Y ++HT  + L D   + V
Sbjct: 125 SSFDPRIVGLTGSPEQVAATVKTFRAYAKKVP----GSSGDYTMEHTALVYLMDARNAFV 180

Query: 175 GVIPYKDDSDSAIEKINRLI 194
           G +     +     ++++ I
Sbjct: 181 GAVNLNRPAAETAAELSKRI 200


>gi|239607498|gb|EEQ84485.1| mitochondrial metallochaperone Sco1 [Ajellomyces dermatitidis ER-3]
 gi|327352488|gb|EGE81345.1| mitochondrial metallochaperone Sco1 [Ajellomyces dermatitidis ATCC
           18188]
          Length = 316

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 87/205 (42%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  ++  +G I Y  +    ++           G  +      L   DG +F+  +
Sbjct: 100 WKAAALFVVTGVGMIFYFRYEKARLERKRIAEMSKGVGKPKVGGPFVLKDLDGNEFTEEN 159

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++  V             FIT DP RD+ +V+
Sbjct: 160 LKGKYSFVYFGFTHCPDICPDELDKMAEIIDIVKAKSNNKTVLRPVFITCDPARDSADVL 219

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +K++  F   IIG++G    V  V K +R+Y +          E Y VDH+    L D  
Sbjct: 220 RKYLAEFHKGIIGLTGTYEQVKNVCKQYRVYFST--PRNITPGEDYLVDHSIYFYLMDPE 277

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  V  I  +D +++A   I   I 
Sbjct: 278 GDFVECIGRQDTAETAAATILAHIN 302


>gi|295675374|ref|YP_003603898.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1002]
 gi|295435217|gb|ADG14387.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1002]
          Length = 209

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 57/194 (29%), Positives = 97/194 (50%), Gaps = 5/194 (2%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
           ALG  LG  LL         +F++  + GN +F SD  L    G   +L+    K  ++F
Sbjct: 18  ALGAALGGTLLMTGCGKQPPAFTNLDITGNTQFASDFSLPDTSGKIRTLADYKGKVVVLF 77

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FG+T+C  VCPTT++ L + L+Q+       +   F+T+DP+RDTP+++ ++V  F+   
Sbjct: 78  FGYTHCPDVCPTTMAELSQALQQLGPEDAKRVQVLFVTLDPERDTPQLLAQYVPAFNPSF 137

Query: 122 IG-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           +G        + ++AK+FR+Y   V  +     + Y +DHT A  +FDT G +       
Sbjct: 138 VGLRPASEEQLAKLAKDFRVYYAKVPGK---TPDSYTMDHTAASYVFDTDGKLRLFARDG 194

Query: 181 DDSDSAIEKINRLI 194
             +   +     L+
Sbjct: 195 QGATPWVHDFKLLL 208


>gi|167516488|ref|XP_001742585.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163779209|gb|EDQ92823.1| predicted protein [Monosiga brevicollis MX1]
          Length = 274

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/209 (21%), Positives = 84/209 (40%), Gaps = 17/209 (8%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSL 51
           +      ++L + G+  Y     +               G      D  L    G     
Sbjct: 66  ISWTTLAVMLGLGGAAVYYFDHERQRVEKVRAKQRTSSVGQSALGGDWTLTDMHGEKRHN 125

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG--TLLNAYFITVDPKRDTPEV 109
           +    +  +++FGFT C  VCP  L ++  ++  +D       +   F++VDP RDT   
Sbjct: 126 TDFLGQWHLLYFGFTFCPDVCPEELDKMAEVINHLDAQSKLPKIQPLFVSVDPDRDTLPK 185

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           ++ +V++F  R++G++G    +  + K FR+Y +    +    +E Y VDH+    L D 
Sbjct: 186 IQAYVEQFHPRLLGLTGTHEQIKHICKKFRVYYSRPQVD---GDEDYLVDHSIIQYLMDP 242

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLITYGN 198
            G  V        ++  +E +   I   N
Sbjct: 243 EGHFVAYYGQNMTAEQMLESVQDHIREYN 271


>gi|170691526|ref|ZP_02882691.1| electron transport protein SCO1/SenC [Burkholderia graminis C4D1M]
 gi|170143731|gb|EDT11894.1| electron transport protein SCO1/SenC [Burkholderia graminis C4D1M]
          Length = 205

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 92/189 (48%), Gaps = 5/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           LG  L          +F +  + GN +F S+  L    G   +++    K  ++FFG+T+
Sbjct: 19  LGGALFVAGCGKEQPAFQNLDITGNTQFGSNFSLPDTSGKIRTMADYKGKVVVLFFGYTH 78

Query: 68  CSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-IS 125
           C  VCPTT++ L + L+Q+ P     +   F+TVDP+RDT  ++ ++V  F+   +G   
Sbjct: 79  CPDVCPTTMAELSQALQQLGPDDAKRVQVLFVTVDPERDTAALLGQYVPAFNPSFVGLRP 138

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
            D   V +V K+FRIY   V  +     + Y +DHT A  +FDT G +         +  
Sbjct: 139 ADDAQVKKVTKDFRIYYAKVPGK---TPDSYTMDHTAASYVFDTDGKLRLFARDGQGAAP 195

Query: 186 AIEKINRLI 194
            +  I  L+
Sbjct: 196 WVHDIKLLL 204


>gi|327306585|ref|XP_003237984.1| mitochondrial metallochaperone Sco1 [Trichophyton rubrum CBS
           118892]
 gi|326460982|gb|EGD86435.1| mitochondrial metallochaperone Sco1 [Trichophyton rubrum CBS
           118892]
          Length = 303

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/201 (26%), Positives = 87/201 (43%), Gaps = 16/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
               +L   G I Y  +    ++           G  R      L   +G  F+  +L  
Sbjct: 88  AVLFVLTGAGMIVYFQYEKARLERERIVEMSKGVGKPRVGGPFVLKDLNGETFTEENLKG 147

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQ---VDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           K S V+FGFT+C  +CP  L ++  ++ +         ++   FIT DP RD+PEV++ +
Sbjct: 148 KYSFVYFGFTHCPDICPDELDKMAEIIDEVRARSNGQEVMRPVFITCDPARDSPEVLRGY 207

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           +  F   IIG++G    V  V + +R+Y +    +     E Y VDH+    L D  G  
Sbjct: 208 LNEFHKDIIGLTGTYEQVKDVCRQYRVYFST--PQNIKPGEDYLVDHSIYFYLMDPEGDF 265

Query: 174 VGVIPYKDDSDSAIEKINRLI 194
           V  I  +D   +A + I   I
Sbjct: 266 VECIGRQDTPQTASKVILDHI 286


>gi|154322138|ref|XP_001560384.1| Sco1 protein [Botryotinia fuckeliana B05.10]
 gi|150850463|gb|EDN25656.1| Sco1 protein [Botryotinia fuckeliana B05.10]
          Length = 307

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/205 (25%), Positives = 88/205 (42%), Gaps = 20/205 (9%)

Query: 8   LGTILL-AVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLY 55
            G + L A  G I Y  +    ++           G  +      L+   G  FS   + 
Sbjct: 100 AGVLFLGAGAGLIFYFRYEKARMERKRIAEAAKGVGRPKVGGPFELLDHKGGKFSSEDMK 159

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN------AYFITVDPKRDTPEV 109
            K S+V+FGFT+C  +CP  L ++ +++  ++ + T  +        FIT DP RDTP V
Sbjct: 160 GKYSLVYFGFTHCPDICPEELDKMAQMIDLINNSPTRTSSTPALLPIFITCDPARDTPAV 219

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           +  ++  F   IIG++G    +  + K +R+Y +    E     + Y VDH+    L D 
Sbjct: 220 LATYLAEFHPSIIGLTGTWEQIKDICKKYRVYFST--PEGVQKGQDYLVDHSIYFYLMDP 277

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLI 194
            G  V  I  +   + A   I   +
Sbjct: 278 EGDFVEAIGRQHSPEQAARIIQEHV 302


>gi|302877495|ref|YP_003846059.1| electron transport protein SCO1/SenC [Gallionella capsiferriformans
           ES-2]
 gi|302580284|gb|ADL54295.1| electron transport protein SCO1/SenC [Gallionella capsiferriformans
           ES-2]
          Length = 196

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 50/194 (25%), Positives = 85/194 (43%), Gaps = 5/194 (2%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFG 64
            + L  + +A  G     S       G +   +D  L    G   +L     K  ++FFG
Sbjct: 7   FVFLLMLFIAGCGEPKLPSPFHAAEVGAKYAGADFKLTDHTGKLRTLHDFRGKVVVLFFG 66

Query: 65  FTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGI 124
           + +C  VCPTT++ L +++ ++      +   F+TVDP+RDT  ++ ++V  F    +G+
Sbjct: 67  YMHCPDVCPTTMADLSQVMTRLGKDADRVQVLFVTVDPERDTQALLAQYVPAFHPSFLGL 126

Query: 125 SGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSD 184
            GD     +VAK F +               Y VDH+    L DT G +  + P+   +D
Sbjct: 127 FGDAGSTAQVAKVFDVMYQK-----QATATGYNVDHSAGSFLIDTDGRVRLLSPFAQRTD 181

Query: 185 SAIEKINRLITYGN 198
              + I  L+  G 
Sbjct: 182 WLEQDIRLLLALGK 195


>gi|76363826|ref|XP_888624.1| possible SCO2 protein precursor [Leishmania major]
 gi|12311839|emb|CAC22657.1| putative cytochrome c oxidase assembly factor [Leishmania major
           strain Friedlin]
          Length = 310

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 50/211 (23%), Positives = 87/211 (41%), Gaps = 16/211 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGT 47
           +K  G+I G  LL V         + +                G         LV   G 
Sbjct: 91  LKTYGMIGGFALLCVATLWYGSRQAKQRYFGAEGSARVSVETRGRPALGGPFVLVNTKGE 150

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRD 105
             S +      +  +FGFT+C  +CP  L+R+  ++  V            F++ DP+RD
Sbjct: 151 PVSQAEFLGSWAFFYFGFTHCPEICPVELNRMSHVVDAVRAARPQERIAPLFVSCDPRRD 210

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALL 165
           + E + +++  F    IG+ G P  V    +++RIY + +  ++   +E Y +DH+ A+ 
Sbjct: 211 SLEAIDEYLSVFHPDFIGLVGTPKQVNDACRSYRIYYS-IPTDEDAAQEDYLIDHSIAIF 269

Query: 166 LFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           LFD  G  V     + D     EK+   ++ 
Sbjct: 270 LFDPQGRFVDFFGNRYDEREITEKVLHYMSE 300


>gi|115352944|ref|YP_774783.1| electron transport protein SCO1/SenC [Burkholderia ambifaria AMMD]
 gi|115282932|gb|ABI88449.1| electron transport protein SCO1/SenC [Burkholderia ambifaria AMMD]
          Length = 205

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/189 (28%), Positives = 87/189 (46%), Gaps = 5/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
                  + G      F +  + GN +F SD  L    G   +L+    +  ++FFG+T+
Sbjct: 19  AFAAATLLAGCDNAPKFQNLDITGNTQFGSDFSLPDTTGKVRTLADFKGRAVVMFFGYTH 78

Query: 68  CSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-IS 125
           C  VCPTT++ L   LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG   
Sbjct: 79  CPDVCPTTMAELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRP 138

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
            D   + +V K+FR+Y   V  +       Y +DHT A  +FD  G +   +        
Sbjct: 139 ADEAQLKKVTKDFRVYYAKVAGK---TPGSYTMDHTAASYVFDRDGKLRLFVRDGQGPGP 195

Query: 186 AIEKINRLI 194
            +  +  L+
Sbjct: 196 WVHDLKLLV 204


>gi|296805016|ref|XP_002843335.1| SCO2 [Arthroderma otae CBS 113480]
 gi|238845937|gb|EEQ35599.1| SCO2 [Arthroderma otae CBS 113480]
          Length = 292

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/201 (26%), Positives = 89/201 (44%), Gaps = 16/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
               +L   G I Y  +    ++           G  R      L   +G  F+  +L  
Sbjct: 82  ASLFVLTGAGMIVYFQYEKARLERERIVEMSKGVGKPRVGGPFVLKDLNGETFTEENLKG 141

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD---PTGTLLNAYFITVDPKRDTPEVMKKF 113
           + S V+FGFT+C  +CP  L ++  ++ +V        ++   FIT DP RD+PEV++ +
Sbjct: 142 RYSFVYFGFTHCPDICPDELDKMAEIIDEVKARSNGQEVMRPVFITCDPARDSPEVLRAY 201

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++ F   IIG++G    V  V + +R+Y +    +     E Y VDH+    L D  G  
Sbjct: 202 LKEFHKDIIGLTGTYEQVKDVCRQYRVYFST--PQNIKPGEDYLVDHSIYFYLMDPEGDF 259

Query: 174 VGVIPYKDDSDSAIEKINRLI 194
           V  I  +D   +A + I   I
Sbjct: 260 VECIGRQDTPQTASKVILDHI 280


>gi|84499244|ref|ZP_00997532.1| SCO1/SenC family protein [Oceanicola batsensis HTCC2597]
 gi|84392388|gb|EAQ04599.1| SCO1/SenC family protein [Oceanicola batsensis HTCC2597]
          Length = 215

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 87/203 (42%), Gaps = 10/203 (4%)

Query: 2   KALGIILG---TILLAVLGSIAYVSFSSKFVD----GNRRFNSDVHLVAQDGTDFSLSSL 54
           K L  +L     +L      +  +   +        G     SD  LV   G   + +  
Sbjct: 11  KRLRFLLWSGAAVLTVATAGLLLLRDQAAPAQVVYSGEADIRSDFELVDHTGRPVTQTDY 70

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
             +  +VFFGFTNC  VCPTTL+ +   L  +      +   FITVDP+RDTPEVM  +V
Sbjct: 71  AGRWQLVFFGFTNCPDVCPTTLAYMATTLDLLGEDADHVAPLFITVDPERDTPEVMADYV 130

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  R++G++G P      A++F++Y  ++   +   ++ Y + H   + L    G   
Sbjct: 131 ANFHPRLVGLTGSPAQAAEAAQSFKVYHEHMADAE--AQDGYTMAHAGHIYLMRPDGRFE 188

Query: 175 GVI-PYKDDSDSAIEKINRLITY 196
            V        +   E+I   +  
Sbjct: 189 AVFLEGDQPPEDLAEEIEMRLDK 211


>gi|91781685|ref|YP_556891.1| electron transport protein SCO1/SenC [Burkholderia xenovorans
           LB400]
 gi|91685639|gb|ABE28839.1| Electron transport protein SCO1/SenC [Burkholderia xenovorans
           LB400]
          Length = 205

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 55/193 (28%), Positives = 94/193 (48%), Gaps = 5/193 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           +   LG  LL         +F +  + GN +F S+  L    G   +++    K  ++FF
Sbjct: 15  IACALGGALLVAGCGKQPPAFQNLDITGNTQFASNFSLPDTSGHIRTMADYKGKVVVLFF 74

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           G+T+C  VCPTT++ L + L+Q+       +   F+TVDP+RDTP ++ ++V  F+   +
Sbjct: 75  GYTHCPDVCPTTMAELSQALQQLGPEDAKRVQVLFVTVDPERDTPALLAQYVPAFNPTFV 134

Query: 123 G-ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           G    D   + R+ K+FR+Y   V  +     + Y +DHT A  +FDT G +        
Sbjct: 135 GLRPADQAQLTRITKDFRVYYAKVPGK---TPDSYTMDHTAASYVFDTDGKLRLFARDGQ 191

Query: 182 DSDSAIEKINRLI 194
            +   +  I  L+
Sbjct: 192 GATPWVHDIKLLL 204


>gi|115385102|ref|XP_001209098.1| protein SCO2, mitochondrial precursor [Aspergillus terreus NIH2624]
 gi|114196790|gb|EAU38490.1| protein SCO2, mitochondrial precursor [Aspergillus terreus NIH2624]
          Length = 291

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 59/205 (28%), Positives = 89/205 (43%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  ++   G I Y     + ++           G  +      L   DG +F+   
Sbjct: 77  WKAALLFVITGAGMIVYFRVEKERLERKRIAEMSKGVGRPKVGGPFVLKDLDGKEFTAED 136

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  + S V+FGFT+C  +CP  L ++  ++ +V       N     FIT DP RDTPEV+
Sbjct: 137 LKGRYSFVYFGFTHCPDICPDELDKMAEIIDKVKEATKGENIFLPVFITCDPARDTPEVL 196

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           + ++Q F   IIG++G    +  V K +R+Y +     K    E Y VDH+    L D  
Sbjct: 197 RSYLQEFHKDIIGLTGTYDQIKHVCKQYRVYFSTPRDVK--PGEDYLVDHSIYFYLMDPE 254

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  V  I  +D  DSA + I   I 
Sbjct: 255 GDFVECIGRQDTPDSATKVIMEHIN 279


>gi|319795886|ref|YP_004157526.1| electron transport protein sco1/senc [Variovorax paradoxus EPS]
 gi|315598349|gb|ADU39415.1| electron transport protein SCO1/SenC [Variovorax paradoxus EPS]
          Length = 205

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 56/197 (28%), Positives = 88/197 (44%), Gaps = 9/197 (4%)

Query: 2   KALGIILGTILLAVLGSI---AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           + L I  G +    L +      VSF+   + G   +  D  L   DG + +++    K 
Sbjct: 12  RHLLIAGGGLAALSLAACDKVLPVSFNGIDITG-ANYAQDFRLTDPDGRERTVADFKGKA 70

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS 118
            ++FFGFT C  VCPT L R   +   +   G  L   F+TVDP+RDTP V+K +   F 
Sbjct: 71  VMLFFGFTQCPDVCPTALLRAAEIRHMLGADGERLQVIFVTVDPERDTPVVLKAYTNAFD 130

Query: 119 DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
              IG+ GD       AK F+ Y   V          Y +DH+    ++D  G I  V+ 
Sbjct: 131 PSFIGLYGDLQRTSETAKAFKAYYKKVP-----TGASYTMDHSAFSYVYDPQGKIRLVLR 185

Query: 179 YKDDSDSAIEKINRLIT 195
           ++  +    E + +++ 
Sbjct: 186 HEQGAPECAEDLRKILK 202


>gi|89900480|ref|YP_522951.1| electron transport protein SCO1/SenC [Rhodoferax ferrireducens
           T118]
 gi|89345217|gb|ABD69420.1| electron transport protein SCO1/SenC [Rhodoferax ferrireducens
           T118]
          Length = 201

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 49/193 (25%), Positives = 85/193 (44%), Gaps = 4/193 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
             ++ G I L    S    SF+   + G   +  D  L   +G   +L     K  ++FF
Sbjct: 13  YALLTGAIGLIPACSKQGPSFAGIDLTG-ADYAKDFALTDHNGQPRTLKDFAGKVVVMFF 71

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           G+  C  VCPT+++ L  + + +   G  +   F+TVDP RDTPEV+K ++  F    + 
Sbjct: 72  GYVQCPDVCPTSMAELAEVKRLLGKDGERVQGLFVTVDPARDTPEVLKGYMAAFDPTFLA 131

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           +   P  +  +AK++++Y   V          Y +DH+    ++DT G +     Y   +
Sbjct: 132 LYTTPEKLAVLAKDYKVYYKKVEGP---TPTSYSMDHSAGSFVYDTQGKLRLYNRYGSGA 188

Query: 184 DSAIEKINRLITY 196
                 I  L+  
Sbjct: 189 ALLAADIKLLLQQ 201


>gi|46136053|ref|XP_389718.1| hypothetical protein FG09542.1 [Gibberella zeae PH-1]
          Length = 282

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 51/196 (26%), Positives = 84/196 (42%), Gaps = 15/196 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLSSLY 55
            G + +   G + +     K               G  +      LV QDG  F+   + 
Sbjct: 78  AGFLFVGTCGLLVWYFEFEKERMQRKRIAEAAKGVGRPKVGGTFELVDQDGKPFTSEMMK 137

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K S+V+FGFT C  +CP  L ++  +L  V+      L   FIT DP RDTP+ +K+++
Sbjct: 138 GKHSLVYFGFTRCPDICPEELDKMATMLDIVEQKAPDALLPIFITCDPARDTPKALKEYL 197

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F D+ +G++G    +  + K +R+Y +    +     + Y VDH+    L D  G  V
Sbjct: 198 SEFHDKFVGLTGTYDQIKDLCKKYRVYFST--PQNVKPGQDYLVDHSIYFYLMDPDGDFV 255

Query: 175 GVIPYKDDSDSAIEKI 190
             +  +     A   I
Sbjct: 256 EALGRQHSPQQAAALI 271


>gi|241764414|ref|ZP_04762439.1| electron transport protein SCO1/SenC [Acidovorax delafieldii 2AN]
 gi|241366204|gb|EER60775.1| electron transport protein SCO1/SenC [Acidovorax delafieldii 2AN]
          Length = 187

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 55/189 (29%), Positives = 87/189 (46%), Gaps = 4/189 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           +    L    S     F    + G   +  DV L   +G   SL     K  +VFFG+T 
Sbjct: 1   MSASALLSACSEKKTEFRGVDITG-ADYARDVPLTDHNGQKRSLKDFRGKVVVVFFGYTQ 59

Query: 68  CSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGD 127
           C  VCPT++  L  + + +   G  L   F+TVDP+RDTP V+K ++  F    + +SG 
Sbjct: 60  CPDVCPTSMQELAEVKQMLGQDGDRLQGIFVTVDPERDTPSVLKAYMANFDPSFLALSGT 119

Query: 128 PIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAI 187
           P ++  VAK+F+IY   V  +       Y +DH+    ++DTAG +     Y   + +  
Sbjct: 120 PEEIAAVAKDFKIYFKKVDGK---TPTSYTMDHSAGSYVYDTAGRLRVYNRYGSGAQALA 176

Query: 188 EKINRLITY 196
             +  L+  
Sbjct: 177 ADVRALLQE 185


>gi|99082679|ref|YP_614833.1| electron transport protein SCO1/SenC [Ruegeria sp. TM1040]
 gi|99038959|gb|ABF65571.1| SCO2 protein [Ruegeria sp. TM1040]
          Length = 207

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 51/210 (24%), Positives = 86/210 (40%), Gaps = 17/210 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGN-------------RRFNSDVHLVAQDGT 47
           M+ + I+    + A+LG + Y++      D                       LV   G 
Sbjct: 2   MRNIAILAFASVAALLGGVWYLTLRGGASDDAFAQCRASAVAGGSAAIGGPFELVNAKGE 61

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTP 107
             +   +  +PSI++FG+T C  VCP   +R    +  +   G      FI++DPKRDTP
Sbjct: 62  TVTDKDVITEPSILYFGYTFCPDVCPLDTARNAEAVDVLADRGYSTTPVFISIDPKRDTP 121

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           EV+  F     +++IG++G P  V   ++ ++ Y       + G E+ Y VDHTT   L 
Sbjct: 122 EVVGDFAFNLHEKMIGLTGSPEQVKAASQAYKTYYK----AQEGDEDYYLVDHTTMSYLV 177

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
                 V         +   +++   I   
Sbjct: 178 LPEHGFVDFFRRDVSPEQMADRVACFIDNS 207


>gi|85706986|ref|ZP_01038075.1| probable lipoprotein [Roseovarius sp. 217]
 gi|85668427|gb|EAQ23299.1| probable lipoprotein [Roseovarius sp. 217]
          Length = 191

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 86/192 (44%), Gaps = 4/192 (2%)

Query: 5   GIILGTILLAVLGSIAYVSFSS--KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            +  G    A +  + +  + +     +      +D  L    G   +      +  +VF
Sbjct: 2   WVFAGVAAFAFIWLLLWSDYRADLARAEDEPPLFADFELTDHRGMIQTEEDFKGRWMLVF 61

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FGFTNC  VCPTTLS +  +++ +      +   FIT+DP+RDT   + ++V  F   II
Sbjct: 62  FGFTNCPDVCPTTLSEVAAVMEGLGDEAAKVQPIFITIDPERDTLMALAEYVPLFDAGII 121

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
           G++G P  +   ++ F I+   +  E++     Y + HT+ L LFD         PY   
Sbjct: 122 GLTGTPEQIAATSETFPIFFERI--EEATAPGGYTMGHTSHLFLFDPRAGFANSWPYGTP 179

Query: 183 SDSAIEKINRLI 194
           ++  +  + + I
Sbjct: 180 AEEILADLRKRI 191


>gi|170106431|ref|XP_001884427.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164640773|gb|EDR05037.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 215

 Score =  125 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 49/203 (24%), Positives = 77/203 (37%), Gaps = 16/203 (7%)

Query: 8   LGTILLAVLGSIAYVSFSS------------KFVDGNRRFNSDVHLVAQDGTDFSLSSLY 55
               + A +G   Y  +                  G  +      L    G  F+   L 
Sbjct: 6   AAIFVAAGVGLFFYFRYEKTRLLEEREKERMNKQYGRPQIGGPFSLTTDTGKPFTDEDLL 65

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG--TLLNAYFITVDPKRDTPEVMKKF 113
            K S+V+FGFTNC  +CP  L ++  +L  +      ++    FITVDP RD+   + ++
Sbjct: 66  GKWSLVYFGFTNCPDICPAELDKVTSVLDSIGTYPLASIFQPLFITVDPVRDSQSRISRY 125

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           +Q F     G+ G       V K +R+Y +      +     Y VDH+  + L D  G  
Sbjct: 126 LQDFHPSFTGLFGSYDATKAVCKAYRVYFSTPP--NADPNGDYLVDHSIFVYLMDPHGKF 183

Query: 174 VGVIPYKDDSDSAIEKINRLITY 196
           V         +    KIN  I+ 
Sbjct: 184 VEAFGQSVGEEVVKTKINEAISQ 206


>gi|261200303|ref|XP_002626552.1| mitochondrial metallochaperone Sco1 [Ajellomyces dermatitidis
           SLH14081]
 gi|239593624|gb|EEQ76205.1| mitochondrial metallochaperone Sco1 [Ajellomyces dermatitidis
           SLH14081]
          Length = 316

 Score =  125 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 87/205 (42%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  ++  +G I Y  +    ++           G  +      L   DG +F+  +
Sbjct: 100 WKAAALFVVTGVGMIFYFRYEKARLERKRIAEMSKGVGKPKVGGPFILKDLDGNEFTEEN 159

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++  V             FIT DP RD+ +V+
Sbjct: 160 LKGKYSFVYFGFTHCPDICPDELDKMAEIIDIVKAKSNNKTVLRPVFITCDPARDSADVL 219

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +K++  F   IIG++G    V  V K +R+Y +          E Y VDH+    L D  
Sbjct: 220 RKYLAEFHKGIIGLTGTYEQVKNVCKQYRVYFST--PRNITPGEDYLVDHSIYFYLMDPE 277

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  V  I  +D +++A   I   I 
Sbjct: 278 GDFVECIGRQDTAETAAATILAHIN 302


>gi|114327553|ref|YP_744710.1| SCO1/SenC family protein [Granulibacter bethesdensis CGDNIH1]
 gi|114315727|gb|ABI61787.1| SCO1/SenC family protein [Granulibacter bethesdensis CGDNIH1]
          Length = 218

 Score =  125 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 84/205 (40%), Gaps = 18/205 (8%)

Query: 5   GIILGTILLAVLGSI-------------AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSL 51
            +IL    +AV+G+                     + VDG+        L  Q+G   + 
Sbjct: 15  ALILVIAAVAVMGAWHAGLFGEGGGAGQEANFSRGQEVDGHAGIGGSFILTDQNGRTVTD 74

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
            +L  +  +V+FG+T C  +CPT L  +   +K +      L   F+T+DP RD P  + 
Sbjct: 75  QTLRGRWMLVYFGYTFCPDICPTELQSMSATIKALGALSGRLAPVFVTIDPARDRPAELA 134

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            ++  F   IIG++G    +   A+ + +Y         G  + Y +DH++ L L    G
Sbjct: 135 AYLAHFDPTIIGLTGTEAQISTFARKYHVYYAR-----KGEGKDYSMDHSSYLYLMRPDG 189

Query: 172 SIVGVIPYKDDSDSAIEKINRLITY 196
           S   + P     +     +  +++ 
Sbjct: 190 SFDRLFPGGMSPNDLAAALRPILSE 214


>gi|257093387|ref|YP_003167028.1| electron transport protein SCO1/SenC [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045911|gb|ACV35099.1| electron transport protein SCO1/SenC [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 193

 Score =  125 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 48/179 (26%), Positives = 86/179 (48%), Gaps = 4/179 (2%)

Query: 17  GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTL 76
           G     +F S  + G+  +  +  L    G    L+    K  ++FFG+T C  VCPTTL
Sbjct: 17  GCSGPPAFKSTDITGS-DWGKEFALTDPQGQARRLADFKGKAVVLFFGYTQCPDVCPTTL 75

Query: 77  SRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK 136
           + +  +L ++      +   F+T+DP RDTPEV+ ++V+ F    IG+ GD      VA+
Sbjct: 76  ASMRDVLARLGDDAKRVQVVFVTLDPVRDTPEVLAEYVKAFHPSFIGLHGDEATTAAVAR 135

Query: 137 NFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           +F+++      +       Y +DH+T    FD  G +  ++ + +  D+    +  L+ 
Sbjct: 136 DFKVFYAK---QAGSTAGSYSIDHSTGSYAFDPQGRLRLLVRHGETPDNVAADLKLLLA 191


>gi|240139972|ref|YP_002964449.1| Electron transport protein SenC-related [Methylobacterium
           extorquens AM1]
 gi|240009946|gb|ACS41172.1| Electron transport protein SenC-related [Methylobacterium
           extorquens AM1]
          Length = 196

 Score =  125 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 59/200 (29%), Positives = 88/200 (44%), Gaps = 10/200 (5%)

Query: 1   MKALGIILGTILLAVLGSIAYVS------FSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
           M+    +L  +   V G +A                G         LV QDG   S    
Sbjct: 1   MRPSRSVLLPLAAFVAGLVAISVALVMTLVPQHPQSGPSGIGGPFTLVNQDGATVSERDF 60

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
             KP ++FFGFT+C  VCPTTL ++  +L  + P    L   F++VDP+RDTP  +K ++
Sbjct: 61  AGKPYLMFFGFTHCPDVCPTTLQQISDVLAALGPKADRLKVAFVSVDPERDTPASLKTYL 120

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  RI+G++G P  V    K FR Y   V     G    Y ++HT  + L D     V
Sbjct: 121 SSFDSRIVGLTGSPEQVAATLKTFRAYAKKVP----GSSGDYTMEHTALVYLMDARNGFV 176

Query: 175 GVIPYKDDSDSAIEKINRLI 194
           G +     +     ++++ I
Sbjct: 177 GAVNLNRPAAETAAELSKRI 196


>gi|212544458|ref|XP_002152383.1| mitochondrial metallochaperone Sco1, putative [Penicillium
           marneffei ATCC 18224]
 gi|210065352|gb|EEA19446.1| mitochondrial metallochaperone Sco1, putative [Penicillium
           marneffei ATCC 18224]
          Length = 305

 Score =  125 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 59/200 (29%), Positives = 88/200 (44%), Gaps = 16/200 (8%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G I Y       ++           G  +      L   DG +F+   
Sbjct: 92  WKAALLFVLTGAGMIIYFRVEKARLERKRITEMSKGVGKPKVGGPFVLKDLDGKEFTAED 151

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT---LLNAYFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++ +V        ++   FIT DP RDTPEV+
Sbjct: 152 LKGKYSFVYFGFTHCPDICPDELDKMAAIIDKVKEGSNGAEVMRPVFITCDPARDTPEVL 211

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           KK++  F   IIG++G    V +V K +R+Y +    E     E Y VDH+    L D  
Sbjct: 212 KKYLAEFHPDIIGLTGTYQQVKQVCKAYRVYFST--PENVKPGEDYLVDHSIYFYLMDPE 269

Query: 171 GSIVGVIPYKDDSDSAIEKI 190
           G  V  +  +D  +SA   I
Sbjct: 270 GDFVECVGRQDTPESATRLI 289


>gi|219850268|ref|YP_002464701.1| electron transport protein SCO1/SenC [Chloroflexus aggregans DSM
           9485]
 gi|219544527|gb|ACL26265.1| electron transport protein SCO1/SenC [Chloroflexus aggregans DSM
           9485]
          Length = 198

 Score =  125 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 51/193 (26%), Positives = 93/193 (48%), Gaps = 4/193 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           L  I+    L + G  AY    +     N        L  Q G DF LS    K  ++FF
Sbjct: 6   LRFIVLIAALVLSGCTAYEFRGTVLEPPNPAPELP--LTDQFGRDFRLSDYRGKVVLLFF 63

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           GFT+C  +CPT L  L R+++++      +   F++VDP+RDTP++M++++  F+   +G
Sbjct: 64  GFTHCPDICPTALGDLKRVMEKLGNNAEKVQVVFVSVDPERDTPDLMQRYLASFNPTFLG 123

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           ++GD + + +  K++ + V       SG+   Y +DH+  +   D  G+   +  +    
Sbjct: 124 LNGDRVILEQAYKDYGVTVIRRDLPNSGLG--YTIDHSGYIYAIDQVGNWRLLWAHGTPV 181

Query: 184 DSAIEKINRLITY 196
           D  +  +  L+  
Sbjct: 182 DDIVSDVQALLRN 194


>gi|213409752|ref|XP_002175646.1| sco1 [Schizosaccharomyces japonicus yFS275]
 gi|212003693|gb|EEB09353.1| sco1 [Schizosaccharomyces japonicus yFS275]
          Length = 357

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 82/199 (41%), Gaps = 18/199 (9%)

Query: 9   GTILLAVLGSIAYVSFSSKFVDGNR----------------RFNSDVHLVAQDGTDFSLS 52
             +LLA +G + Y     + +                           L+ Q G  FS  
Sbjct: 148 LIMLLAGVGLLYYYRREKRRLQQLPTPQRTSTVVTNTRSSLPIGGPFSLIDQHGARFSSD 207

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPEVMK 111
            L  + ++V+FGFT C  VCP  L ++   +  ++     ++   FIT DP RD P  + 
Sbjct: 208 DLKGRYALVYFGFTRCPDVCPDELDKMTDAVDMINKVSGDVVTPVFITCDPLRDPPSEVA 267

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
           +++Q F  +++G++G   +V    K +R+Y +          + Y VDH+  + L    G
Sbjct: 268 EYLQDFHPKMVGLTGSYDEVKAACKAYRVYFSTPRNVDPEK-DDYLVDHSVFIYLLGPDG 326

Query: 172 SIVGVIPYKDDSDSAIEKI 190
             + V      +    EK+
Sbjct: 327 KFLDVFGRNSSAKEIAEKV 345


>gi|296536498|ref|ZP_06898589.1| Sco2 family protein [Roseomonas cervicalis ATCC 49957]
 gi|296263177|gb|EFH09711.1| Sco2 family protein [Roseomonas cervicalis ATCC 49957]
          Length = 229

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 80/177 (45%), Gaps = 4/177 (2%)

Query: 20  AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRL 79
             VS     +           LV Q+G   + +    +  + +FGFT C  VCPT L  +
Sbjct: 54  VPVSAGGVQLPQGVTLGGPFSLVNQEGRAVTQADFQGQLMVAYFGFTFCPDVCPTELGNI 113

Query: 80  DRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNF 138
              ++         +   F T+DP+RDTPE MK +V  F  R++G++G P  V   A+ F
Sbjct: 114 ASAMELLTPEQQARVTPAFFTIDPERDTPEQMKLYVGNFHPRMVGLTGTPEQVAETARRF 173

Query: 139 RIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           R+Y N V   +     +Y +DH++ + L    G +V ++      ++  E +   + 
Sbjct: 174 RVYYNKVQRPEMS---EYLMDHSSYIYLIGRDGRVVTLLRPNSSPEAIAEAVRGQLA 227


>gi|160897441|ref|YP_001563023.1| electron transport protein SCO1/SenC [Delftia acidovorans SPH-1]
 gi|160363025|gb|ABX34638.1| electron transport protein SCO1/SenC [Delftia acidovorans SPH-1]
          Length = 221

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 47/173 (27%), Positives = 81/173 (46%), Gaps = 6/173 (3%)

Query: 23  SFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRL 82
            F    + G  ++  D  L   DG + +L+    +  +VFFGFT C  VCPT L+R   +
Sbjct: 53  PFKGIDLTG-AQYGRDFRLRDADGRERTLADFKGQALMVFFGFTQCPDVCPTALTRALEI 111

Query: 83  LKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYV 142
            + +   G  L   FIT+DP+RDT +V+K +V  F    + + GD      VA+ F+++ 
Sbjct: 112 RELLGADGARLAVAFITIDPERDTAQVLKAYVGAFDPGFVALRGDEAQTAEVAREFKVFY 171

Query: 143 NNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
             V          Y +DH+    +FD  G +     ++ D+      + +++ 
Sbjct: 172 KKVP-----TGASYTMDHSAITYVFDPEGRLRVAFRHEQDAQDCAADLRQILQ 219


>gi|221199946|ref|ZP_03572989.1| electron transport protein SCO1/SenC [Burkholderia multivorans
           CGD2M]
 gi|221207385|ref|ZP_03580394.1| electron transport protein SCO1/SenC [Burkholderia multivorans
           CGD2]
 gi|221172588|gb|EEE05026.1| electron transport protein SCO1/SenC [Burkholderia multivorans
           CGD2]
 gi|221180185|gb|EEE12589.1| electron transport protein SCO1/SenC [Burkholderia multivorans
           CGD2M]
          Length = 205

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 55/175 (31%), Positives = 85/175 (48%), Gaps = 5/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
             F +  + GN +F SD  L    G   +L+    K  ++FFG+T+C  VCPTT++ L  
Sbjct: 33  PKFQNLDITGNTQFGSDFALPDTTGKVRTLADFKGKAVVMFFGYTHCPDVCPTTMAELSE 92

Query: 82  LLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFR 139
            LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG    D   + +V K+FR
Sbjct: 93  ALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADDAQLKKVTKDFR 152

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +Y   V  +       Y +DHT A  +FD  G +   +         +  +  LI
Sbjct: 153 VYYAKVPGK---TPGSYTMDHTAASYVFDPDGKLRLFVRDGQGPGPWVHDLKLLI 204


>gi|114706095|ref|ZP_01438998.1| inner mitochondrial membrane protein Sco1p-like protein
           [Fulvimarina pelagi HTCC2506]
 gi|114538941|gb|EAU42062.1| inner mitochondrial membrane protein Sco1p-like protein
           [Fulvimarina pelagi HTCC2506]
          Length = 194

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 59/196 (30%), Positives = 97/196 (49%), Gaps = 4/196 (2%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K   I L  +++      A    +             + +  Q+G   + S    KP+ +
Sbjct: 3   KRAHIGLAAVMVLAFLVSAVFIVAFDDGRSRAASTDPLAMTDQNGEPVTQSLFEGKPTAL 62

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFGFT+C  VCPTTL+ L  +L ++ P    LN  F+TVDP+RDTP+V+  +V  F +RI
Sbjct: 63  FFGFTHCPEVCPTTLAELSLVLNELGPKADDLNVVFVTVDPERDTPDVLADYVGAFDERI 122

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           + ++G    +  +A+N+ +Y   V  +       Y +DHT  + L +  G   G I + +
Sbjct: 123 VALTGSHEQLDAMAENWGVYYKKVPLKD----GDYTMDHTATVFLLNRGGEFTGTIGFGE 178

Query: 182 DSDSAIEKINRLITYG 197
           DS+ A  K+ RL+   
Sbjct: 179 DSEMAFRKLLRLVDQS 194


>gi|198430801|ref|XP_002129256.1| PREDICTED: similar to cytochrome oxidase deficient homolog 1 [Ciona
           intestinalis]
          Length = 291

 Score =  124 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 45/198 (22%), Positives = 84/198 (42%), Gaps = 12/198 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K++  ++    + VL    Y +   K VD       G      D  L+   G   +    
Sbjct: 86  KSVLFLVSCGSIMVLAMKFYKNKREKEVDNEMIKSYGRPELGGDFELIDHTGMLRTNKDF 145

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L ++  ++  V+    + +    FI++DP+RDT E +K 
Sbjct: 146 LGQWILIYFGFTHCPDICPEELEKMGNVVDTVNRNQHVPDILPVFISIDPERDTTEAVKA 205

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           ++  F   ++G++G    V + +  FR+Y +    +    +  Y VDHT  + L D  G 
Sbjct: 206 YIADFHPLMVGLTGTREQVDKASHAFRVYYSAGPKDD---DSDYLVDHTIIMYLIDPDGD 262

Query: 173 IVGVIPYKDDSDSAIEKI 190
                     +      I
Sbjct: 263 FCEYFGQNKSAGEIASTI 280


>gi|161523647|ref|YP_001578659.1| electron transport protein SCO1/SenC [Burkholderia multivorans ATCC
           17616]
 gi|189351585|ref|YP_001947213.1| hypothetical protein BMULJ_02789 [Burkholderia multivorans ATCC
           17616]
 gi|160341076|gb|ABX14162.1| electron transport protein SCO1/SenC [Burkholderia multivorans ATCC
           17616]
 gi|189335607|dbj|BAG44677.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 205

 Score =  124 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 55/175 (31%), Positives = 85/175 (48%), Gaps = 5/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
             F +  + GN +F SD  L    G   +L+    K  ++FFG+T+C  VCPTT++ L  
Sbjct: 33  PKFQNLDITGNTQFGSDFALPDTSGKVRTLADFKGKAVVMFFGYTHCPDVCPTTMAELSE 92

Query: 82  LLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFR 139
            LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG    D   + +V K+FR
Sbjct: 93  ALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADDAQLKKVTKDFR 152

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +Y   V  +       Y +DHT A  +FD  G +   +         +  +  LI
Sbjct: 153 VYYAKVPGK---TPGSYTMDHTAASYVFDPDGKLRLFVRDGQGPGPWVHDLKLLI 204


>gi|221065323|ref|ZP_03541428.1| electron transport protein SCO1/SenC [Comamonas testosteroni KF-1]
 gi|220710346|gb|EED65714.1| electron transport protein SCO1/SenC [Comamonas testosteroni KF-1]
          Length = 192

 Score =  124 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 61/195 (31%), Positives = 91/195 (46%), Gaps = 12/195 (6%)

Query: 8   LGTILLAVLGSIAY--------VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           +G   LA   + A           F    V G   +  D+ L   DG   SL     K  
Sbjct: 1   MGAATLACTAAFALTACKDDSKPKFQGVDVTG-ADYAKDIPLTDVDGKKRSLKDFSGKVV 59

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
            VFFG+T C  VCPTTL  L  + + +   G  L A F+++DP+RDTPEV+K ++  F +
Sbjct: 60  AVFFGYTQCPDVCPTTLQELLEVKQALGADGDKLQAVFVSLDPERDTPEVLKAYLANFDE 119

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
             +G+SG   ++  VAK+F+I+   V  +   VE  Y +DH+    LFD  G +     Y
Sbjct: 120 SFVGLSGTADEIAAVAKDFKIFFKKVPGK---VEGTYTLDHSAGTYLFDPQGRLRVYERY 176

Query: 180 KDDSDSAIEKINRLI 194
                   + +  L+
Sbjct: 177 GAGPQLLTQDVKALL 191


>gi|148555390|ref|YP_001262972.1| electron transport protein SCO1/SenC [Sphingomonas wittichii RW1]
 gi|148500580|gb|ABQ68834.1| electron transport protein SCO1/SenC [Sphingomonas wittichii RW1]
          Length = 208

 Score =  124 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 56/201 (27%), Positives = 96/201 (47%), Gaps = 11/201 (5%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGN-------RRFNSDVHLVAQDGTDFSLSSLYI 56
           L I+L   + AVL   A ++   +              F     L  Q G   + +SL  
Sbjct: 12  LRILLWAAVAAVLLGYAGLTLWPRLRPPADPQAGYAAAFGGPFRLTDQTGRTVTEASLRG 71

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           +P  +FFGFT C+ VCPTTL  + RL + + P G  L+  F+++D +RD P  + +++  
Sbjct: 72  RPFAIFFGFTRCAEVCPTTLQTMARLKRALGPAGETLDLVFVSLDHERDRPADIGQYLTL 131

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F   I+G++G   ++ R+ + + +Y   V  +       Y +DHT  + L D  G   G 
Sbjct: 132 FGTPIVGLTGSAAEIDRIVRAYHVYYKKVPVD----GGDYVIDHTATVFLMDAEGRFFGT 187

Query: 177 IPYKDDSDSAIEKINRLITYG 197
           + + +     + K+ RL+T G
Sbjct: 188 LAHDEGDPPRLAKLRRLVTAG 208


>gi|163854482|ref|YP_001628780.1| SCO1/SenC/PrrC family protein [Bordetella petrii DSM 12804]
 gi|163258210|emb|CAP40509.1| SCO1/SenC/PrrC family protein [Bordetella petrii]
          Length = 202

 Score =  124 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 85/173 (49%), Gaps = 4/173 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            SF    + G  +    + L   +G   +L     K ++VFFGFT C  VCPT+L+ L +
Sbjct: 32  PSFKGNDISGT-QLGKGLALTDHNGQARTLQDFAGKVTVVFFGFTQCPDVCPTSLAELSQ 90

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           +++++ P    +    ITVDP+RDT E++K++V  F  R +G++G    + + A +F+ Y
Sbjct: 91  VMEKLGPDADRVQVLMITVDPERDTAEILKQYVTTFDPRFLGLTGTAEQIKQAAASFKAY 150

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              V  E     + Y +DHT A  L D  G    +       D+    I  L+
Sbjct: 151 YAKVPTEN---GKNYTMDHTAAFYLLDGKGDSRVLANNTIGVDALAHDIKALL 200


>gi|296160436|ref|ZP_06843253.1| electron transport protein SCO1/SenC [Burkholderia sp. Ch1-1]
 gi|295889417|gb|EFG69218.1| electron transport protein SCO1/SenC [Burkholderia sp. Ch1-1]
          Length = 205

 Score =  124 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 55/190 (28%), Positives = 93/190 (48%), Gaps = 5/190 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
            LG  LL         +F +  + GN +F S+  L    G   +++    K  ++FFG+T
Sbjct: 18  ALGGALLVAGCGKQPPAFQNLDITGNTQFASNFSLPDTSGHIRTMADYKGKVVVLFFGYT 77

Query: 67  NCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-I 124
           +C  VCPTT++ L + L+Q+       +   F+TVDP+RDTP ++ ++V  F+   +G  
Sbjct: 78  HCPDVCPTTMAELSQALQQLGPEDAKRVQVLFVTVDPERDTPALLAQYVPAFNPTFVGLR 137

Query: 125 SGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSD 184
             D   + R+ K+FR+Y   V  +     + Y +DHT A  +FDT G +         + 
Sbjct: 138 PADQAQLTRITKDFRVYYAKVPGK---TPDSYTMDHTAASYVFDTDGKLRLFARDGQGAT 194

Query: 185 SAIEKINRLI 194
             +  I  L+
Sbjct: 195 PWVHDIKLLL 204


>gi|332029573|gb|EGI69462.1| Protein SCO1-like protein, mitochondrial [Acromyrmex echinatior]
          Length = 320

 Score =  124 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 46/161 (28%), Positives = 79/161 (49%), Gaps = 4/161 (2%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G  +      L+  +G          +  +++FGFT+C  VCP  + ++  ++  ++   
Sbjct: 136 GKAKIGGKFELINTEGKTVKSDDFLGQWVLIYFGFTHCPDVCPDEIEKMTNVVNTLEKQH 195

Query: 91  TLL-NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
                  FI+VDP+RDTP V+ K++  FSD+IIG++G+   V    K +R+Y +N   ++
Sbjct: 196 NFKIQPIFISVDPERDTPTVVDKYLTEFSDKIIGLTGNIEQVREACKAYRVYYSNGPKDQ 255

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
              +E Y VDHT  + L D  G  V       D +  +  I
Sbjct: 256 ---DEDYIVDHTIIIYLIDPEGLFVDYFGQTHDVEKIVTSI 293


>gi|121608364|ref|YP_996171.1| electron transport protein SCO1/SenC [Verminephrobacter eiseniae
           EF01-2]
 gi|121553004|gb|ABM57153.1| electron transport protein SCO1/SenC [Verminephrobacter eiseniae
           EF01-2]
          Length = 206

 Score =  124 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 54/201 (26%), Positives = 84/201 (41%), Gaps = 7/201 (3%)

Query: 1   MKALG---IILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           +K +    I + T+ L    S     F    + G      D+ L   +G          +
Sbjct: 10  LKTIAAGAISISTLALISACSGKKAEFRGIDITGMNS-APDLALTDHNGQARHTRDFAGR 68

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
              VFFG+T C  VCPTTL  + ++ + +   G  L   F+TVDP RDTPEV+K ++  F
Sbjct: 69  VVTVFFGYTQCPDVCPTTLQEMAQVKQLLGEDGGRLQVIFVTVDPDRDTPEVLKAYMASF 128

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
               + + G    +  VAK F +Y   V          Y +DH+    L+DTAG +    
Sbjct: 129 DPGFLALRGSAAQLAAVAKGFNVYYKKV---DGNTPGNYTMDHSAGSYLYDTAGRLRVYH 185

Query: 178 PYKDDSDSAIEKINRLITYGN 198
            Y   + +    +  L+    
Sbjct: 186 HYGSSAQALAADVKVLLAEAR 206


>gi|221211157|ref|ZP_03584136.1| SCO1/SenC family protein [Burkholderia multivorans CGD1]
 gi|221168518|gb|EEE00986.1| SCO1/SenC family protein [Burkholderia multivorans CGD1]
          Length = 208

 Score =  124 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 55/175 (31%), Positives = 85/175 (48%), Gaps = 5/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
             F +  + GN +F SD  L    G   +L+    K  ++FFG+T+C  VCPTT++ L  
Sbjct: 36  PKFQNLDITGNTQFGSDFALPDTSGKVRTLADFKGKAVVMFFGYTHCPDVCPTTMAELSE 95

Query: 82  LLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFR 139
            LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG    D   + +V K+FR
Sbjct: 96  ALKQLGPDAAKRVQVLFVTVDPERDTPALLGQYVPAFDPSFIGLRPADDAQLKKVTKDFR 155

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +Y   V  +       Y +DHT A  +FD  G +   +         +  +  LI
Sbjct: 156 VYYAKVPGK---TPGSYTMDHTAASYVFDPDGKLRLFVRDGQGPGPWVHDLKLLI 207


>gi|326318578|ref|YP_004236250.1| electron transport protein SCO1/SenC [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375414|gb|ADX47683.1| electron transport protein SCO1/SenC [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 207

 Score =  124 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 51/174 (29%), Positives = 83/174 (47%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            SF    + G   +  D+ L   +G    L     K  +VFFG+T C  VCPT+++ L  
Sbjct: 34  PSFQGVDITG-AEYARDLALPDHNGQQRHLKDFAGKVVVVFFGYTQCPDVCPTSMAELAE 92

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           + + +   G  L   F+TVDP+RDTPEV+K ++  F    + + G P  +  VAK+F+IY
Sbjct: 93  VKRSLGADGDRLQGLFVTVDPERDTPEVLKAYMTNFDPSFLALRGTPEQLAAVAKDFKIY 152

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
              V  +       Y +DH+    ++D AG +     Y   + +    +  L+ 
Sbjct: 153 YKKVPGK---TPTSYTMDHSAGSYIYDPAGRLRVYHRYGSGAQALASDVKALLQ 203


>gi|159486938|ref|XP_001701493.1| cytochrome c oxidase assembly factor [Chlamydomonas reinhardtii]
 gi|158271554|gb|EDO97370.1| cytochrome c oxidase assembly factor [Chlamydomonas reinhardtii]
          Length = 235

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 53/208 (25%), Positives = 93/208 (44%), Gaps = 22/208 (10%)

Query: 1   MKALGIILGTILLAVLGSIAYVS------------FSSKFVDGNRRFNSDVHLVAQDGTD 48
           M+ L      + L     + Y +              S+ V G         L  QDG  
Sbjct: 1   MRTL-----ILALMAGAGVTYATRLYTDQKLQQVTAKSQQVVGQASVGGPFELTDQDGKP 55

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTP 107
           FS   L  + ++++FGFT+C  +CP  L ++   +  V+      +   FI+VDP+RDTP
Sbjct: 56  FSNKDLLGEFALLYFGFTHCPDICPDELEKVAEAINTVEKWTGVPVQLVFISVDPQRDTP 115

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
            ++K +V+ F  R+IG++G    +  V+K++R+Y N         +  Y VDH+    L 
Sbjct: 116 ALIKSYVKEFHPRMIGLTGSLDKIKAVSKSYRVYYNKT----GESDTDYLVDHSIIHYLI 171

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLIT 195
              G  V       D+ +  ++I++ + 
Sbjct: 172 SPEGEFVTFFGKNADAPTIAKQISQHVA 199


>gi|163760375|ref|ZP_02167457.1| electron transport protein SCO1/SenC [Hoeflea phototrophica DFL-43]
 gi|162282326|gb|EDQ32615.1| electron transport protein SCO1/SenC [Hoeflea phototrophica DFL-43]
          Length = 161

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 62/160 (38%), Positives = 94/160 (58%), Gaps = 4/160 (2%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
           R  +D  LV  DG   + ++   +P++++FGFT C  VCPTTL  +   L  +   G  L
Sbjct: 2   RLGADFTLVDHDGEPITQAAFEGRPTLLYFGFTRCPEVCPTTLYEMAGWLDALGDEGRDL 61

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
            A+F+TVDP+RDTPE+MK + + F+DR+IGI+GDP +  R+   + +Y   +  E     
Sbjct: 62  QAFFVTVDPERDTPEIMKGYSEAFTDRVIGITGDPDESARLVAGWHVYAAKIPTED---- 117

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
             Y +DHT ++ L D  G   G I Y +D+ +AI K+ RL
Sbjct: 118 GDYTMDHTASVFLVDKHGVFKGTISYGEDAGTAIAKLRRL 157


>gi|323349678|gb|EGA83893.1| Sco1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 295

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 56/201 (27%), Positives = 87/201 (43%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              + LAV G+++Y     K               G        HL    G +F+  +L 
Sbjct: 76  AIALFLAVGGALSYFFNREKRRLETQKEAEANRGYGKPSLGGPFHLEDMYGNEFTEKNLL 135

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K SI++FGF+NC  +CP  L +L   L       G  L   FIT DP RD+P V+K+++
Sbjct: 136 GKFSIIYFGFSNCPDICPDELDKLGVWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYL 195

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F   I+G++G   +V    K +R+Y +          + Y VDH+    L D  G  V
Sbjct: 196 SDFHPSILGLTGTFDEVKNACKKYRVYFSTPP--NVKPGQDYLVDHSIFFYLMDPEGQFV 253

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             +    D  + ++KI   + 
Sbjct: 254 DALGRNYDEKTGVDKIVEHVK 274


>gi|190408796|gb|EDV12061.1| protein SCO1, mitochondrial precursor [Saccharomyces cerevisiae
           RM11-1a]
 gi|323306087|gb|EGA59821.1| Sco1p [Saccharomyces cerevisiae FostersB]
          Length = 295

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 56/201 (27%), Positives = 87/201 (43%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              + LAV G+++Y     K               G        HL    G +F+  +L 
Sbjct: 76  AIALFLAVGGALSYFFNREKRRLETQKEAEANRGYGKPSLGGPFHLEDMYGNEFTEKNLL 135

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K SI++FGF+NC  +CP  L +L   L       G  L   FIT DP RD+P V+K+++
Sbjct: 136 GKFSIIYFGFSNCPDICPDELDKLGVWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYL 195

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F   I+G++G   +V    K +R+Y +          + Y VDH+    L D  G  V
Sbjct: 196 SDFHPSILGLTGTFDEVKNACKKYRVYFSTPP--NVKPGQDYLVDHSIFFYLMDPEGQFV 253

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             +    D  + ++KI   + 
Sbjct: 254 DALGRNYDEKTGVDKIVEHVK 274


>gi|115444369|ref|NP_001045964.1| Os02g0159700 [Oryza sativa Japonica Group]
 gi|113535495|dbj|BAF07878.1| Os02g0159700 [Oryza sativa Japonica Group]
          Length = 197

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/175 (24%), Positives = 81/175 (46%), Gaps = 5/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +   +   G        +L+  DG   +    + K ++++FGFT+C  +CP  L ++  
Sbjct: 24  SAVKQEPSVGTAAIGGPFNLLNHDGKPVTQKDFFGKWTLLYFGFTHCPDICPDELQKMAL 83

Query: 82  LLKQVDPTGTLLNA-YFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
            + ++     +     FITVDP+RDT E ++ +V  F   +IG++G   ++ +VA+ +R+
Sbjct: 84  AIDKIKEKAKMEVVPVFITVDPERDTVEQVRDYVNEFHPNLIGLTGTTDEIRKVARAYRV 143

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           Y      E       Y VDH+  + L +     V       D+DS  + I + + 
Sbjct: 144 YYMKTEEE----GSDYLVDHSIVMYLMNPKMEFVKFYGKNYDADSLADGIIKELK 194


>gi|254251351|ref|ZP_04944669.1| SCO1/SenC family protein [Burkholderia dolosa AUO158]
 gi|124893960|gb|EAY67840.1| SCO1/SenC family protein [Burkholderia dolosa AUO158]
          Length = 205

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 86/180 (47%), Gaps = 5/180 (2%)

Query: 17  GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTL 76
           G      F +  + GN +F ++  L    G   +L+    K  ++FFG+T+C  VCPTT+
Sbjct: 28  GCDNAPKFQNLDITGNTQFGTNFALPDTTGKVRTLADFKGKAVVMFFGYTHCPDVCPTTM 87

Query: 77  SRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRV 134
           + L   LKQ+ P     +   F+TVDP+RDTP ++ ++V  F    IG    D   + +V
Sbjct: 88  AELSEALKQLGPDAAKRVQVLFVTVDPERDTPALLAQYVSAFDPSFIGLRPADEAALKKV 147

Query: 135 AKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            K+FR+Y   V  +       Y +DHT A  +FD  G +   +         +  +  LI
Sbjct: 148 TKDFRVYYAKVPGK---TPGSYTMDHTAASYVFDPDGKLRLFVRDGQGPGPWVHDLKLLI 204


>gi|6319511|ref|NP_009593.1| Sco1p [Saccharomyces cerevisiae S288c]
 gi|134307|sp|P23833|SCO1_YEAST RecName: Full=Protein SCO1, mitochondrial; Flags: Precursor
 gi|536256|emb|CAA84979.1| SCO1 [Saccharomyces cerevisiae]
 gi|666104|emb|CAA35490.1| SCO1 protein precursor [Saccharomyces cerevisiae]
 gi|45269617|gb|AAS56189.1| YBR037C [Saccharomyces cerevisiae]
 gi|151946428|gb|EDN64650.1| suppressor of cytochrome oxidase deficiency [Saccharomyces
           cerevisiae YJM789]
 gi|207347763|gb|EDZ73837.1| YBR037Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256269008|gb|EEU04350.1| Sco1p [Saccharomyces cerevisiae JAY291]
 gi|285810372|tpg|DAA07157.1| TPA: Sco1p [Saccharomyces cerevisiae S288c]
 gi|290878054|emb|CBK39113.1| Sco1p [Saccharomyces cerevisiae EC1118]
 gi|323334527|gb|EGA75901.1| Sco1p [Saccharomyces cerevisiae AWRI796]
 gi|323356306|gb|EGA88110.1| Sco1p [Saccharomyces cerevisiae VL3]
          Length = 295

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 56/201 (27%), Positives = 87/201 (43%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              + LAV G+++Y     K               G        HL    G +F+  +L 
Sbjct: 76  AIALFLAVGGALSYFFNREKRRLETQKEAEANRGYGKPSLGGPFHLEDMYGNEFTEKNLL 135

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K SI++FGF+NC  +CP  L +L   L       G  L   FIT DP RD+P V+K+++
Sbjct: 136 GKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYL 195

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F   I+G++G   +V    K +R+Y +          + Y VDH+    L D  G  V
Sbjct: 196 SDFHPSILGLTGTFDEVKNACKKYRVYFSTPP--NVKPGQDYLVDHSIFFYLMDPEGQFV 253

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             +    D  + ++KI   + 
Sbjct: 254 DALGRNYDEKTGVDKIVEHVK 274


>gi|293602908|ref|ZP_06685347.1| SCO1/SenC family protein [Achromobacter piechaudii ATCC 43553]
 gi|292818702|gb|EFF77744.1| SCO1/SenC family protein [Achromobacter piechaudii ATCC 43553]
          Length = 204

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 53/174 (30%), Positives = 82/174 (47%), Gaps = 5/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F    + G  +    + L   +G    LS    K  +VFFGFT C  VCPT+L+ L  
Sbjct: 35  PTFKGSDISGT-QLGRGMELTDTNGKTRQLSDFAGKVVVVFFGFTQCPDVCPTSLAELTE 93

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           ++K++ P    +    ITVDP+RDT EV+K++V  F  R +G++G P  + + A +F+ Y
Sbjct: 94  VMKKLGPDADRVQVLLITVDPERDTQEVLKQYVTAFDPRFLGLTGTPDQIKKAAASFKAY 153

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                 +       Y +DHT A  L D  G    +       D+    I  L+ 
Sbjct: 154 YAKAPTKD----GNYTMDHTAAFYLLDGKGESRVLANNTLGVDALTHDIKELLK 203


>gi|187479749|ref|YP_787774.1| electron transport protein [Bordetella avium 197N]
 gi|115424336|emb|CAJ50889.1| putative electron transport protein [Bordetella avium 197N]
          Length = 202

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 54/195 (27%), Positives = 89/195 (45%), Gaps = 7/195 (3%)

Query: 2   KALGIILGTILLAVLGSI--AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           +AL  I    L   L +   A   F    + G  +    + L   +G   +LS    K +
Sbjct: 10  RALQAIAALSLAGGLAACGDAPPPFKGSDITGT-QLGKKLALTDMNGQPRTLSDFAGKVA 68

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           ++FFGFT C  VCPT L+ +  +++ + P    +    +TVDP+RD+PEV+K++V  F  
Sbjct: 69  VLFFGFTQCPDVCPTALAEMAEVMQALGPDADRVQVLLVTVDPERDSPEVLKQYVSSFDK 128

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
           R + ++G P  + + A +F+ Y   V  +       Y +DHT A  L D  G    +   
Sbjct: 129 RFLALTGTPEQIKQAASSFKAYYAKVPTKD----GGYTMDHTAAFYLIDGKGESRVLANS 184

Query: 180 KDDSDSAIEKINRLI 194
                +    I  L+
Sbjct: 185 NLGVPALTNDIKLLL 199


>gi|255939269|ref|XP_002560404.1| Pc15g01890 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211585026|emb|CAP83075.1| Pc15g01890 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 306

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 89/205 (43%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G + Y       ++           G  +      L   DG +F+   
Sbjct: 92  WKAALLFVLTGAGMMLYFRVEKARLERKRMTEMSKGVGKPKVGGPFVLKDLDGKEFTAED 151

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDP---TGTLLNAYFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++++V        L    FIT DP RDTPEV+
Sbjct: 152 LKGKYSFVYFGFTHCPDICPDELDKMAEIIEKVKAATGDEKLFMPVFITCDPVRDTPEVL 211

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +++++ F   I+G++G    +  V K +R+Y +    +     E Y VDH+    L D  
Sbjct: 212 REYLKEFHPGIVGLTGTYEQIKHVCKQYRVYFST--PKDVKPGEDYLVDHSIYFYLMDPD 269

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
              V  I  +D  +SA + I   I 
Sbjct: 270 NDFVECIGRQDTPESASKVIMEHIN 294


>gi|328950508|ref|YP_004367843.1| electron transport protein SCO1/SenC [Marinithermus hydrothermalis
           DSM 14884]
 gi|328450832|gb|AEB11733.1| electron transport protein SCO1/SenC [Marinithermus hydrothermalis
           DSM 14884]
          Length = 196

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 86/203 (42%), Gaps = 16/203 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD-----GNRRFNSDVHLVAQDGTDFSLSSLY 55
           M+    +L   +LA+ G  AY + S K           R   D  L+  DG     S+  
Sbjct: 1   MRWRIALLVAGVLAIAGYAAYKALSPKPTFHGTMLSTPRPVPDFTLIDGDGRPRRFSAFR 60

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
            K  +VFFG+T C  VCP T+ +L    + +      L    I+VDP+ DTPE ++++V 
Sbjct: 61  GKTLLVFFGYTRCPDVCPLTMQKLALAYRALGEPE-DLQVVMISVDPETDTPERIQQYVT 119

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F  R +G++G P  + + A  F IY                VDHT  + L D  G +  
Sbjct: 120 GFHPRFVGLTGTPEAIAQAASAFFIYYR---------ARDQLVDHTATINLVDPQGRLRV 170

Query: 176 VIP-YKDDSDSAIEKINRLITYG 197
           V         +  E +  ++  G
Sbjct: 171 VYNEANLAPQTLAEDLKPILARG 193


>gi|323338842|gb|EGA80057.1| Sco1p [Saccharomyces cerevisiae Vin13]
          Length = 295

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 56/201 (27%), Positives = 87/201 (43%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              + LAV G+++Y     K               G        HL    G +F+  +L 
Sbjct: 76  AIALFLAVGGALSYFFNREKRRLETQKEAEANRGYGKPSLGGPFHLEDMYGNEFTEKNLL 135

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K SI++FGF+NC  +CP  L +L   L       G  L   FIT DP RD+P V+K+++
Sbjct: 136 GKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYL 195

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F   I+G++G   +V    K +R+Y +          + Y VDH+    L D  G  V
Sbjct: 196 SDFHPSILGLTGTFDEVKNACKKYRVYFSTPP--NVKPGQDYLVDHSIFFYLMDPEGQFV 253

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
             +    D  + ++KI   + 
Sbjct: 254 DALGRNYDEKTGVDKIVEHVK 274


>gi|319408811|emb|CBI82468.1| sco1/2 family protein [Bartonella schoenbuchensis R1]
          Length = 193

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 108/203 (53%), Gaps = 17/203 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  I G  ++ + G   Y ++ +K          D  L+  +G   + + +  KPS 
Sbjct: 1   MKNVIYIFGLTIIFLAGVFTYDAWKNK------PLGDDFTLIDSNGQTVTEADIRSKPSA 54

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFGFT C   CPTTL+ LDR L ++ P    L  +F+TVDP+RDTPEV++ ++  F++ 
Sbjct: 55  IFFGFTMCPESCPTTLTDLDRWLTEIGPNADKLGIWFVTVDPERDTPEVLRDYLSNFTNN 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IIGISGDP  V ++  +F I    V     G    Y  DHT A+ L    G + G+IPY 
Sbjct: 115 IIGISGDPEKVHKMVSSFNIVAEKVP----GTNGNYTYDHTAAIFLLKKGGKLAGIIPYN 170

Query: 181 DDS-------DSAIEKINRLITY 196
            +        D AI+++ +LI+ 
Sbjct: 171 VEENENQLKDDIAIKRLKKLISN 193


>gi|94496264|ref|ZP_01302842.1| Electron transport protein [Sphingomonas sp. SKA58]
 gi|94424443|gb|EAT09466.1| Electron transport protein [Sphingomonas sp. SKA58]
          Length = 203

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 90/206 (43%), Gaps = 14/206 (6%)

Query: 1   MKA-LGIILGTILLAVLGS--IAYVSFSSKFVD----GNRRFNSDVHLVAQDGTDFSLSS 53
           MK  +  +   ++LA   +  I +   + +                 L+ QDG   +  S
Sbjct: 1   MKVGIAALASVLVLAAATALTIGWSPMAPRPAPTGALEGAAVGGPFRLIDQDGRVVTSDS 60

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT----LLNAYFITVDPKRDTPEV 109
              +  +++FGFT C  +CPT + ++ + L+  +         +    +T+DP+RDTP++
Sbjct: 61  FRGRYRLMYFGFTYCPDICPTDVQKMSQALRLFEQRDPARAARIQPIMVTIDPERDTPKI 120

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           +K+FV  F  R+IG++G P  +    + F +Y +    ++ G    Y +DH+  + L   
Sbjct: 121 LKQFVSNFHPRLIGLTGPPAAITDTLRRFGVYASR---QQVGGASSYLMDHSALMYLMGP 177

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLIT 195
            G  +         D    +++  + 
Sbjct: 178 KGDPITFFARDATPDQIASELDTYVR 203


>gi|320169516|gb|EFW46415.1| mitochondrial metallochaperone Sco1 [Capsaspora owczarzaki ATCC
           30864]
          Length = 330

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/210 (22%), Positives = 90/210 (42%), Gaps = 18/210 (8%)

Query: 5   GIILGTILLAVLGSIAYV-----------SFSSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
            + LG + +A  G + Y                    G  +      LV  +G  ++   
Sbjct: 87  WVSLGLLAVAGAGLVMYFQSERANHRANLEAKRNRGLGVPKIGGPFTLVDTNGKRWTEED 146

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAY---FITVDPKRDTPEVM 110
           L  + ++++FGFT C  VCP  L ++  ++  +D T  +       FI+VDP RD  ++M
Sbjct: 147 LKGRWTLIYFGFTFCPDVCPDELDKMTEIVNTIDNTPDIGPVVTPLFISVDPMRDNAKIM 206

Query: 111 KKFV--QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +++    F  RI+G++G   +V +VA+ +R+Y +  + E     + Y VDHT      +
Sbjct: 207 GEYLAANAFHPRIVGLTGTTEEVHQVARAYRVYFSAGMPEN--PADDYLVDHTIIQYFMN 264

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
             G           +  A +++ + I    
Sbjct: 265 PEGKFATYYGQTTTAQDAAKRLIQSIREYR 294


>gi|118589269|ref|ZP_01546675.1| hypothetical protein SIAM614_06988 [Stappia aggregata IAM 12614]
 gi|118437969|gb|EAV44604.1| hypothetical protein SIAM614_06988 [Stappia aggregata IAM 12614]
          Length = 199

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 59/187 (31%), Positives = 93/187 (49%), Gaps = 9/187 (4%)

Query: 15  VLGSIAYVSFSSKFVDGN-----RRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCS 69
           + G + Y   +     G              LV+  G   +  +   KP+++FFGFT C 
Sbjct: 12  ISGVLVYQQTAGNKSTGGLIEPLAAIGGPFELVSGTGETVTDETFSTKPTVMFFGFTFCP 71

Query: 70  AVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPI 129
            VCPTTLS L   + ++ P    LN  F+TVDP+RDTPEVM+ +V  F  RI+ ++G   
Sbjct: 72  DVCPTTLSELQGWMAELGPDADKLNYAFVTVDPERDTPEVMRDYVWAFDKRIVPLTGTRE 131

Query: 130 DVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEK 189
            +  + K +R+Y   V  +       Y +DH+ A+ L       VG + Y +  ++A++K
Sbjct: 132 QIDAMLKAYRVYSKKVPLDD----GDYTMDHSAAIYLMSADNKFVGTVAYGEAEENALKK 187

Query: 190 INRLITY 196
           + RLI  
Sbjct: 188 LRRLIDN 194


>gi|19112079|ref|NP_595287.1| copper chaperone Sco1 [Schizosaccharomyces pombe 972h-]
 gi|8928327|sp|O42899|SCO1_SCHPO RecName: Full=Protein sco1
 gi|2959367|emb|CAA17921.1| copper chaperone Sco1 [Schizosaccharomyces pombe]
          Length = 263

 Score =  123 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 49/202 (24%), Positives = 86/202 (42%), Gaps = 14/202 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFV-----------DGNRRFNSDVHLVAQDGTDF 49
           M ++  +L     +V G  AY     K V            G  +      L+   G   
Sbjct: 53  MISIRALLLAAATSV-GLYAYFQHEKKKVLERQNDKVLATIGRPQLGGAFSLIDHHGNRV 111

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTPE 108
           + +    K S+++FGFT C  +CP  L ++   +  V+     +    FIT DP RD P+
Sbjct: 112 TDNDFKGKFSLIYFGFTRCPDICPDELDKMSAAIDIVNNVVGDVVYPIFITCDPARDPPQ 171

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            M ++++ F+ +I+G++G   ++  + K FR+Y +         ++ Y VDH+    L D
Sbjct: 172 EMAEYLEDFNPKIVGLTGSYEEIKDICKKFRVYFST-PKNIDPKKDDYLVDHSVFFYLMD 230

Query: 169 TAGSIVGVIPYKDDSDSAIEKI 190
             G  + V      S+     I
Sbjct: 231 PEGKFIEVFGRNSTSEDLARAI 252


>gi|225555995|gb|EEH04285.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR]
          Length = 320

 Score =  123 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +   +  I Y  +    ++           G  +      L   DG +F+   
Sbjct: 104 WKAAALFVATGVAMIFYFRYEKARLERKRVVEMSKGVGKPKVGGPFVLKDLDGNEFTEEK 163

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++  V       +     FIT DP RD+PEV+
Sbjct: 164 LKGKYSFVYFGFTHCPDICPDELDKMAEIIDLVKAKSNNKSVLRPVFITCDPARDSPEVL 223

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +K++  F   IIG++G    V  V K +R+Y +    +     E Y VDH+    L D  
Sbjct: 224 RKYLAEFHKGIIGLTGTYEQVKHVCKQYRVYFST--PQNVKPGEDYLVDHSIYFYLMDPD 281

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  V  I  +D +++A   I   I 
Sbjct: 282 GDFVECIGRQDTAETAASTIVDHIK 306


>gi|67459352|ref|YP_246976.1| Sco2 protein precursor [Rickettsia felis URRWXCal2]
 gi|75536222|sp|Q4UKW2|SCO22_RICFE RecName: Full=SCO2-like protein RF_0960
 gi|67004885|gb|AAY61811.1| Sco2 protein precursor [Rickettsia felis URRWXCal2]
          Length = 205

 Score =  123 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 50/205 (24%), Positives = 99/205 (48%), Gaps = 16/205 (7%)

Query: 1   MK----ALGIILGTILLAVLGSIAYV----------SFSSKFVDGNRRFNSDVHLVAQDG 46
           MK     + II+   LL  +G++  +          +      + N +   D  L+ Q+G
Sbjct: 1   MKMQSNVIKIIIVISLLIGVGALYLLLSLRTPEKPLAGQVNIYEDNVKIGGDFELIDQNG 60

Query: 47  TDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDT 106
             F+   L    S+++FGFT+C  +CPT+L+++  +++ ++     +   FIT+DPKRDT
Sbjct: 61  EIFNSDELKGNLSLIYFGFTSCPDICPTSLNKMTEIVEILNKHKIDILPVFITIDPKRDT 120

Query: 107 PEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLL 166
           P V+K++++ F  + IG++G+   +  V   F+++   V  +    +  Y +DH++   L
Sbjct: 121 PIVLKEYLKHFHPKFIGLTGNEQQIKGVTDKFKVFYARVNGDD--DDPNYMLDHSSFTYL 178

Query: 167 FDTAGSIVGVIPYKDDSDSAIEKIN 191
            D  G  +            +E + 
Sbjct: 179 IDANGKYLKHFYLDSSPKEIMEFLK 203


>gi|240278516|gb|EER42022.1| mitochondrial SCO1p [Ajellomyces capsulatus H143]
 gi|325090567|gb|EGC43877.1| conserved hypothetical protein [Ajellomyces capsulatus H88]
          Length = 316

 Score =  123 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +   +  I Y  +    ++           G  +      L   DG +F+   
Sbjct: 100 WKAAALFVATGVAMIFYFRYEKARLERKRVVEMSKGVGKPKVGGPFVLKDLDGNEFTEEK 159

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++  V       +     FIT DP RD+PEV+
Sbjct: 160 LKGKYSFVYFGFTHCPDICPDELDKMAEIIDLVKAKSNKESVLRPVFITCDPARDSPEVL 219

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +K++  F   IIG++G    V  V K +R+Y +    +     E Y VDH+    L D  
Sbjct: 220 RKYLAEFHKGIIGLTGTYEQVKHVCKQYRVYFST--PQNVKPGEDYLVDHSIYFYLMDPD 277

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  V  I  +D +++A   I   I 
Sbjct: 278 GDFVECIGRQDTAETAASTIVDHIK 302


>gi|221107318|ref|XP_002169657.1| PREDICTED: similar to SCO1-like, putative [Hydra magnipapillata]
          Length = 203

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 47/197 (23%), Positives = 80/197 (40%), Gaps = 8/197 (4%)

Query: 4   LGIILGTILLAVLGSIAYVSFSS-----KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           L I    I LAVL ++      +         G      D  L  Q+G   S      K 
Sbjct: 9   LAIFGFGIGLAVLFAMYQFQKPNSALLHNEESGIANIGGDFELTDQNGKLRSTKEFRGKL 68

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS 118
            +V+FG+T C  VCP  L  +   LK +      +   F++VDP+RDT E +K +   F 
Sbjct: 69  LMVYFGYTYCPDVCPMALEHITAALKGLGKDRDKVAVIFVSVDPERDTLETLKLYSSNFD 128

Query: 119 DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
             I+ ++G P  + +  + +R+YV     E       Y ++HT+ + L    G       
Sbjct: 129 PNIVMLTGSPAQLKKAMQQYRVYVKK---ENKPGMSDYLLNHTSVVYLMGADGKYRQGFA 185

Query: 179 YKDDSDSAIEKINRLIT 195
           +  + +     + + + 
Sbjct: 186 HSTNPEVIKSILLKALQ 202


>gi|239817348|ref|YP_002946258.1| electron transport protein SCO1/SenC [Variovorax paradoxus S110]
 gi|239803925|gb|ACS20992.1| electron transport protein SCO1/SenC [Variovorax paradoxus S110]
          Length = 209

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/182 (28%), Positives = 87/182 (47%), Gaps = 4/182 (2%)

Query: 14  AVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCP 73
               S A  SF++  + G   +  D  L   DG   +L+    K  ++FFG+  C  VCP
Sbjct: 31  LSACSEAKPSFNAVDITG-ADYARDFSLKDADGKLRTLADFKGKVVVLFFGYAQCPDVCP 89

Query: 74  TTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMR 133
           TT++ + ++ +Q+   G  L   F+TVDP RDTPEV+K ++  F    + +      + +
Sbjct: 90  TTMTEMAQVKQQLGSDGDKLQVLFVTVDPARDTPEVLKAYMGAFDPGFVALIPTADQLAQ 149

Query: 134 VAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
           VAK+F++Y   V  +       Y +DH+ A  ++DT G +     Y       +  +  L
Sbjct: 150 VAKDFKVYFKKVEGK---TPTSYSMDHSAASFVYDTDGRLRLYARYGAGVAPMVSDVKAL 206

Query: 194 IT 195
           + 
Sbjct: 207 LK 208


>gi|254419401|ref|ZP_05033125.1| SCO1/SenC superfamily [Brevundimonas sp. BAL3]
 gi|196185578|gb|EDX80554.1| SCO1/SenC superfamily [Brevundimonas sp. BAL3]
          Length = 236

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/188 (28%), Positives = 83/188 (44%), Gaps = 7/188 (3%)

Query: 12  LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAV 71
           +  V+ S    +       G      D  LV QDG     + L  K S+VFFGFT C   
Sbjct: 54  VTVVVVSGRGPAAGEVSSTGQPLVGGDFQLVNQDGAPVDQTMLNGKWSLVFFGFTYCPEF 113

Query: 72  CPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR--IIGISGDPI 129
           CPTTL+ +  + +++      L   F+++DP+RDTP  +K ++         IG++G P 
Sbjct: 114 CPTTLAEMAAVQQRLGDKADDLQIVFVSIDPERDTPRQLKDYLSSDGFPRGTIGLTGTPE 173

Query: 130 DVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEK 189
            V + AK +R Y   V     G  E Y ++H+  + L    G     + Y    D A + 
Sbjct: 174 QVAQAAKAYRAYYEKV-----GEGEGYTMNHSLTVYLMGPDGKFRTAVAYGLGPDKATKI 228

Query: 190 INRLITYG 197
           I   +  G
Sbjct: 229 IEDAMARG 236


>gi|84501219|ref|ZP_00999424.1| regulatory protein SenC [Oceanicola batsensis HTCC2597]
 gi|84390510|gb|EAQ02998.1| regulatory protein SenC [Oceanicola batsensis HTCC2597]
          Length = 208

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 47/191 (24%), Positives = 82/191 (42%), Gaps = 1/191 (0%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           L I +     +  G       +S    G  +      LV + G   +   +  +P++++F
Sbjct: 16  LSIGIWVFTTSASGDRFAQCRASAVAGGAGQIGGPFTLVDETGATVTQEDVIDQPALIYF 75

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           G+T C  +CP   +R    +  +D  G  +   FIT+DP+RDTPE +  F      R++G
Sbjct: 76  GYTYCPDICPYDAARNAEAVSILDDRGYSVKPVFITIDPERDTPEQLADFTDYLHPRMVG 135

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           ++G P  +   +K +R Y      E  G E+ Y VDH+T   L       V       ++
Sbjct: 136 LTGTPEQIAAASKAYRTYYRKQPTE-VGDEDYYLVDHSTFSYLTLPDEGFVEYFRRDIEA 194

Query: 184 DSAIEKINRLI 194
           +   + I   +
Sbjct: 195 EDMADTIACFL 205


>gi|312797381|ref|YP_004030303.1| SCO2 PROTEIN PRECURSOR [Burkholderia rhizoxinica HKI 454]
 gi|312169156|emb|CBW76159.1| SCO2 PROTEIN PRECURSOR [Burkholderia rhizoxinica HKI 454]
          Length = 227

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 4/181 (2%)

Query: 15  VLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPT 74
           + G     +F +  + G  +  +D  L   +G   +L+    K  ++FFG+ +C  VCPT
Sbjct: 49  LGGCGDKPAFKNVDITGASQLGTDFALADTNGHVRTLADFKGKVVVLFFGYLHCPDVCPT 108

Query: 75  TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMR 133
           T++ L + ++Q+      +   F+T+DP+RD+  ++ ++V  F    IG    +   +++
Sbjct: 109 TMAELAQAMQQLGDQAKRVQVLFVTLDPQRDSAPLLAQYVAAFHPSFIGLRPANETQLLK 168

Query: 134 VAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
           V K+FR+Y   V  +       Y VDHT A  +FD AG +             +  I  L
Sbjct: 169 VTKSFRVYSAKVPGKD---GADYTVDHTAASYVFDPAGKLRLYARDGQGPGPWVHDIKLL 225

Query: 194 I 194
           +
Sbjct: 226 L 226


>gi|84995506|ref|XP_952475.1| sco1/2-like protein [Theileria annulata strain Ankara]
 gi|65302636|emb|CAI74743.1| sco1/2-like protein, putative [Theileria annulata]
          Length = 219

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/172 (26%), Positives = 82/172 (47%), Gaps = 4/172 (2%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ 85
           ++   G  +      L+ QDG   S      K  +++FGF NC  +CP  + +  +++  
Sbjct: 51  TEERYGTPQLGGSFKLIDQDGVTRSSEEFKGKYMLIYFGFCNCPDICPEEMDKQTQVVNT 110

Query: 86  VDPTG-TLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
           +D     ++   FI+VDPKRD P V+K +V+ +  R++ ++G P  +  V + FR+Y N 
Sbjct: 111 LDKQFGPIIQPVFISVDPKRDVPRVLKNYVKDYHPRLVALTGTPEMIKDVTRKFRVYYN- 169

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
                   E+ Y +DH+    L D  G+ +       +S    + I+ +I  
Sbjct: 170 --EGIKATEQDYLIDHSIIHYLMDKDGNFLEFYGKNTNSQEMAKAISNVIKK 219


>gi|254428472|ref|ZP_05042179.1| SCO1/SenC superfamily [Alcanivorax sp. DG881]
 gi|196194641|gb|EDX89600.1| SCO1/SenC superfamily [Alcanivorax sp. DG881]
          Length = 209

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 80/172 (46%), Gaps = 5/172 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
               +  N R   D  L  Q+G  FS   L  + SI+FFG+T+C  +CP  L+++ ++ +
Sbjct: 41  QESDLPVNTRLGGDFTLTDQNGEPFSAEKLKGQVSILFFGYTHCPDICPAVLAQVAQVYR 100

Query: 85  QVDPTGTLLNA--YFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYV 142
            ++  G        FIT DP+RDT   +K+++  F   +IG++G    +  VA+ + +  
Sbjct: 101 HLEEEGVADQVQPVFITFDPERDTAAHLKEYLPWFKADMIGLTGSLEQIRAVAEQYGVVF 160

Query: 143 NNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
                ++   E+ Y   H+  + L D    +  + P     D  +  +  L+
Sbjct: 161 IK---DQEAGEQGYLFTHSDYIYLLDEQARVRKLYPADFKIDEVVTDVESLL 209


>gi|121602363|ref|YP_989215.1| SCO1/SenC family protein [Bartonella bacilliformis KC583]
 gi|120614540|gb|ABM45141.1| SCO1/SenC family protein [Bartonella bacilliformis KC583]
          Length = 192

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 58/190 (30%), Positives = 103/190 (54%), Gaps = 9/190 (4%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  ILG  ++ + G   Y +  +K          +  L + +G   + + +  +P++
Sbjct: 1   MKNVLYILGLSVVFLAGVFIYDALKNK------PLGDNFTLTSSNGEIVTEADIRSRPAV 54

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFG+T C   CPTTL+ L R L ++ P    L  +F+TVDP+ DTPE++++++  F+D+
Sbjct: 55  LFFGYTTCPESCPTTLADLSRWLTEIGPNADKLGIWFVTVDPEHDTPEILREYLSNFTDK 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           ++GISGDP  V  +  +F I    +       ++ Y  +HT+A+ L    G + G+IPY 
Sbjct: 115 VVGISGDPEKVHAMVNSFNIVAEKIPGTN---DDNYTYNHTSAIFLLKKGGKLAGIIPYN 171

Query: 181 DDSDSAIEKI 190
            + D   + I
Sbjct: 172 AEEDELKDDI 181


>gi|163735634|ref|ZP_02143065.1| SCO1/2 family protein [Roseobacter litoralis Och 149]
 gi|161391062|gb|EDQ15400.1| SCO1/2 family protein [Roseobacter litoralis Och 149]
          Length = 208

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 62/206 (30%), Positives = 92/206 (44%), Gaps = 14/206 (6%)

Query: 1   MKALGII------LGTILLAVLGSIAYVSFSSKFVDGNRRFNS----DVHLVAQDGTDFS 50
           M+   I+      +G + L +      V          +R  +    D  L   +G    
Sbjct: 1   MRRRAILGYGAAGVGAVALMLFVGWWQVDGPGGPEPVGQRPVALTEMDFRLTDHEGNAVG 60

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
             +L  +P++ FFGFT C  VCPTTLS +   L  +      +N  FITVDP+RDT E M
Sbjct: 61  PETLIGRPTMAFFGFTYCPDVCPTTLSDISGWLDDLGDEADEMNVVFITVDPERDTVETM 120

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            ++V  F   I G +G    + RVA  FR     V  E       Y ++HT ++ LF  +
Sbjct: 121 AEYVGYFHPGIRGWTGPEEQIARVADGFRATYERVPTE----SGDYTMNHTASVFLFAAS 176

Query: 171 GSIVGVIPYKDDSDSAIEKINRLITY 196
           G  V +I Y +  + A+ KI R +  
Sbjct: 177 GRFVTMIDYHEPREFAVPKIRRALAE 202


>gi|288818501|ref|YP_003432849.1| SCO1/SenC/PrrC family protein [Hydrogenobacter thermophilus TK-6]
 gi|288787901|dbj|BAI69648.1| SCO1/SenC/PrrC family protein [Hydrogenobacter thermophilus TK-6]
 gi|308752091|gb|ADO45574.1| electron transport protein SCO1/SenC [Hydrogenobacter thermophilus
           TK-6]
          Length = 196

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/200 (27%), Positives = 88/200 (44%), Gaps = 10/200 (5%)

Query: 1   MKALGIIL-GTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL--YIK 57
           MK L + +    LL    S         FV     +  D  L  Q+G   SLS      K
Sbjct: 1   MKKLALFITWLALLIFAPSCQKKHEFYGFVYDQPAY--DFKLTDQEGRQVSLSDYTRQGK 58

Query: 58  PSIVFFGFTNCSAVCPTTLSR-LDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
             ++FFG+T+C  VCPT L+     +    +     +   FI+VDP+RDTP V+K +V  
Sbjct: 59  IVVIFFGYTHCPDVCPTALTTLASMMKNLKEDERNKVQVLFISVDPERDTPSVLKGYVPF 118

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F    +G++G   ++ +VAK ++++   V   K      Y +DHT  + +      I  +
Sbjct: 119 FYPTFVGLTGSQDEIKKVAKEYKVFYRKV---KGESAAGYLIDHTATIYVVTPDMKIKLL 175

Query: 177 I-PYKDDSDSAIEKINRLIT 195
             P K   +   + +  L+ 
Sbjct: 176 YTPTKQSPEKMAKDMEYLLK 195


>gi|323310209|gb|EGA63401.1| Sco1p [Saccharomyces cerevisiae FostersO]
          Length = 295

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 56/198 (28%), Positives = 87/198 (43%), Gaps = 15/198 (7%)

Query: 11  ILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           + LAV G+++Y     K               G        HL    G +F+  +L  K 
Sbjct: 79  LFLAVGGALSYFFNREKRRLETQKEAEANRGYGKPSLGGPFHLEDMYGNEFTEKNLLGKF 138

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           SI++FGF+NC  +CP  L +L   L       G  L   FIT DP RD+P V+K+++  F
Sbjct: 139 SIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFITCDPARDSPAVLKEYLSDF 198

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
              I+G++G   +V    K +R+Y +          + Y VDH+    L D  G  V  +
Sbjct: 199 HPSILGLTGTFDEVKNACKKYRVYFSTPP--NVKPGQDYLVDHSIFFYLMDPEGQFVDAL 256

Query: 178 PYKDDSDSAIEKINRLIT 195
               D  + ++KI   + 
Sbjct: 257 GRNYDEKTGVDKIVEHVK 274


>gi|264680065|ref|YP_003279974.1| electron transporter SCO1/SenC [Comamonas testosteroni CNB-2]
 gi|262210580|gb|ACY34678.1| electron transport protein SCO1/SenC [Comamonas testosteroni CNB-2]
          Length = 204

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 56/173 (32%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
             F    V G   +  D+ L    G   SL     K   VFFG+T C  VCPTTL  L  
Sbjct: 35  PKFQGVDVTG-ADYAKDIPLTDVHGKKRSLKDFSGKVVAVFFGYTQCPDVCPTTLQELLE 93

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           + + +   G  L A F+++DP+RDTPEV+K ++  F +  +G+SG   ++  VAK+F+I+
Sbjct: 94  VKQALGADGDKLQAVFVSLDPERDTPEVLKAYLANFDESFVGLSGTVDEIAAVAKDFKIF 153

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              V  +   VE  Y +DH+    LFD  G +     Y        + +  L+
Sbjct: 154 FKKVPGK---VEGTYTLDHSAGTYLFDPQGRLRVYERYGAGPQLLTQDVKALL 203


>gi|330818381|ref|YP_004362086.1| hypothetical protein bgla_1g35270 [Burkholderia gladioli BSR3]
 gi|327370774|gb|AEA62130.1| hypothetical protein bgla_1g35270 [Burkholderia gladioli BSR3]
          Length = 204

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/179 (27%), Positives = 84/179 (46%), Gaps = 4/179 (2%)

Query: 17  GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTL 76
           G     +F +  + GN +F  D  L    G   +L+    +  ++FFG+T+C  VCPTTL
Sbjct: 28  GCDQQPAFQNLDITGNTQFGKDFSLPDSSGKLRTLADFKGRAVVLFFGYTHCPDVCPTTL 87

Query: 77  SRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII-GISGDPIDVMRVA 135
           + L + ++Q+ P    +    +T+DP+RDT  ++ ++V  F    I     D   + +VA
Sbjct: 88  AELAQAMQQLGPEAKRVQVLLVTLDPERDTAPLLAQYVAAFDPSFIALRPADDAQLRQVA 147

Query: 136 KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           K+FRIY      +       Y +DHT A  +FD  G +   +         +  +  L+
Sbjct: 148 KDFRIYYAKAAGK---TPGSYTMDHTAASYVFDPDGKLRLFVRDGQGPGPWVHDLKLLL 203


>gi|170578449|ref|XP_001894415.1| transcription initiation factor IIF, alpha subunit [Brugia malayi]
 gi|158599017|gb|EDP36747.1| transcription initiation factor IIF, alpha subunit, putative
           [Brugia malayi]
          Length = 804

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 84/195 (43%), Gaps = 10/195 (5%)

Query: 4   LGIILGTILLAVLGSIAYVSFSS-----KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           + + +  IL+ +L  +            K   G  R      LV  +G       L    
Sbjct: 104 IIVGVSVILVIILSGLREKKMRELESERKQTIGKARIGGPWELVDVNGELGGSERLKGNW 163

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVMKKFVQR 116
            +++FGFT+C  VCP ++ ++  +++ ++ +   +     FI+VDP+RDT E +KK+   
Sbjct: 164 LLLYFGFTHCPDVCPDSIEKMVEVVEILEKSEEKIRVIPVFISVDPERDTVERVKKYCAE 223

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS +I G +G    V +VAK FR+Y +            Y VDHT  + L D  G     
Sbjct: 224 FSPKIKGYTGSKEQVAKVAKAFRVYYSQGPKID---GNDYIVDHTVIMYLMDPDGDFHDY 280

Query: 177 IPYKDDSDSAIEKIN 191
                 +    + I 
Sbjct: 281 YGQNRSAQEIAKVIK 295


>gi|225850804|ref|YP_002731038.1| electron transport protein SCO1/SenC [Persephonella marina EX-H1]
 gi|225644916|gb|ACO03102.1| electron transport protein SCO1/SenC [Persephonella marina EX-H1]
          Length = 198

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 62/198 (31%), Positives = 103/198 (52%), Gaps = 9/198 (4%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK L I L ++L+ V  S++Y  +   ++    +   D  L   +G    LS    K  +
Sbjct: 1   MKKL-ITLLSVLIFVTLSLSYQFYGLPYL----QKIKDFTLTDHNGKKVKLSDFKDKIVL 55

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFG+T C  VCP T+ R+   L  +      +   FI+VDP+RDTPE +K++V+ +   
Sbjct: 56  VFFGYTFCPDVCPATMLRIKETLDNLGDYKKYVKVLFISVDPERDTPEKLKEYVKFYDKD 115

Query: 121 --IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI- 177
             IIG++G P ++ +VAK+FR +   V  +    + +Y +DHT  + L D  G +  +  
Sbjct: 116 GTIIGLTGKPEEIKKVAKSFRAFYEKVPVKD-NPDVEYLMDHTAFIYLLDNRGILKLIYT 174

Query: 178 PYKDDSDSAIEKINRLIT 195
           P KD+     E I +++ 
Sbjct: 175 PRKDNPKRIAEDIIQMVK 192


>gi|154276024|ref|XP_001538857.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150413930|gb|EDN09295.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 320

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +   +  I Y  +    ++           G  +      L   DG +F+   
Sbjct: 104 WKAAALFVATGVAMIFYFRYEKARLERKRVVEMSKGVGKPKVGGPFVLKDLDGNEFTEEK 163

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++  V       +     FIT DP RD+PEV+
Sbjct: 164 LKGKYSFVYFGFTHCPDICPDELDKMAEIIDLVKAKSNNKSVLRPVFITCDPARDSPEVL 223

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +K++  F   IIG++G    V  V K +R+Y +    +     E Y VDH+    L D  
Sbjct: 224 RKYLAEFHKGIIGLTGTYEQVKHVCKQYRVYFST--PQNVKPGEDYLVDHSIYFYLMDPD 281

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  V  I  +D +++A   I   I 
Sbjct: 282 GDFVECIGRQDTAETAASTIVDHIK 306


>gi|330845998|ref|XP_003294845.1| hypothetical protein DICPUDRAFT_159915 [Dictyostelium purpureum]
 gi|325074611|gb|EGC28631.1| hypothetical protein DICPUDRAFT_159915 [Dictyostelium purpureum]
          Length = 322

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 58/213 (27%), Positives = 98/213 (46%), Gaps = 23/213 (10%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD--------GNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           +L  +L    G + Y    +K           G         L+ ++G  F+   L  K 
Sbjct: 102 LLVALLSGTCGWLYYDHLMTKKRQRQNEIKTYGTSSVGGPFVLIDENGKPFTDLDLRGKY 161

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT--GTLLNAYFITVDPKRDTPEVMKKFVQR 116
            +++FGFT C  VCP  LS++ R++K ++    G  +   FIT+DP RDT E +K++++ 
Sbjct: 162 GLLYFGFTFCPDVCPAELSKMSRVVKNLENNGLGDSIVPVFITIDPWRDTVEQVKQYIEE 221

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F  +  G++G P  + ++AK +R++++      SG  + Y VDHT  + L    G  +  
Sbjct: 222 FHPKFKGLTGTPEQITKLAKAYRVFMSK-----SGKGDDYLVDHTIIVYLVGPNGKFIEF 276

Query: 177 IPYKDDSDSAIEKINRLI--------TYGNVVK 201
                DSD    KI   I          G +V+
Sbjct: 277 YNVNQDSDQVTNKIIERIAAKGKGGENKGEIVQ 309


>gi|157828753|ref|YP_001494995.1| sco2 protein precursor [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933480|ref|YP_001650269.1| cytochrome c oxidase Cu(A) center assembly protein [Rickettsia
           rickettsii str. Iowa]
 gi|157801234|gb|ABV76487.1| sco2 protein precursor [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908567|gb|ABY72863.1| cytochrome c oxidase Cu(A) center assembly protein [Rickettsia
           rickettsii str. Iowa]
          Length = 205

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/206 (23%), Positives = 98/206 (47%), Gaps = 16/206 (7%)

Query: 1   MK----ALGIILGTILLAVLGSIAYV----------SFSSKFVDGNRRFNSDVHLVAQDG 46
           MK     + II+   LL  +G++  +          +      + N +   D  L+ Q+G
Sbjct: 1   MKIQSNVIKIIIVISLLIGVGALYLLLSLRTPEKPLAGQVNIYEDNVKIGGDFELIDQNG 60

Query: 47  TDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDT 106
             F+   L    S+++FGFT+C  +CPT+L+++  +++ ++     +   FIT+DPKRDT
Sbjct: 61  EIFNSDKLKGHLSLIYFGFTSCPDICPTSLNKMTEIVEILNKHKIDILPVFITIDPKRDT 120

Query: 107 PEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLL 166
           P  +K++++ F  + IG++G+   +  V   F+++   V  +    +  Y +DH++   L
Sbjct: 121 PIALKEYLKHFHPKFIGLTGNEQQIKDVTDKFKVFYARVHGDD--DDPNYMLDHSSFTYL 178

Query: 167 FDTAGSIVGVIPYKDDSDSAIEKINR 192
            D  G  +            +E +  
Sbjct: 179 IDANGKYLKHFYLDSSPKEIMEFLRN 204


>gi|83955804|ref|ZP_00964346.1| SCO1/2 family protein [Sulfitobacter sp. NAS-14.1]
 gi|83839809|gb|EAP78986.1| SCO1/2 family protein [Sulfitobacter sp. NAS-14.1]
          Length = 208

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 63/191 (32%), Positives = 92/191 (48%), Gaps = 7/191 (3%)

Query: 9   GTILLAVLGSIAYVSFSSKFVDGNRRFNS---DVHLVAQDGTDFSLSSLYIKPSIVFFGF 65
              L+  +G        +    G R       D  L   +G +    +L  +P++VFFGF
Sbjct: 16  AVALMLGVGWWRADGPGAPKPAGQRPLPLSAMDFRLTDHEGNEVGPETLIGRPTMVFFGF 75

Query: 66  TNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGIS 125
           T C  VCPTTLS +   L+ +    T +N  FITVDP+RDT E M ++V  F   I G +
Sbjct: 76  TYCPDVCPTTLSDISGWLEDLGDEATQMNVVFITVDPERDTVEAMAEYVGYFHPAIRGWT 135

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
           G    V R A+ FR     V  +       Y ++HT ++ LFD  G +V +I Y +  + 
Sbjct: 136 GPANQVARAAEGFRASYERVPTK----GGDYTMNHTASVFLFDAKGELVTMIDYHEPREF 191

Query: 186 AIEKINRLITY 196
           A+ KI R +T 
Sbjct: 192 AVPKIRRALTE 202


>gi|84499305|ref|ZP_00997593.1| probable lipoprotein [Oceanicola batsensis HTCC2597]
 gi|84392449|gb|EAQ04660.1| probable lipoprotein [Oceanicola batsensis HTCC2597]
          Length = 190

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 47/167 (28%), Positives = 77/167 (46%), Gaps = 2/167 (1%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
            +          +D  L   DG   +      K ++VFFGFTNC  VCPTTL+ + + L 
Sbjct: 19  PNGTASAAPSVKADFELTGHDGVMRTEDDFKGKWTLVFFGFTNCPDVCPTTLAEIAQTLD 78

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            + P    +   FI+VD  RD P  + ++V +F   I+G++G P  +   A +F+I+   
Sbjct: 79  DLGPKAEAVQPLFISVDSDRDRPGDLAEYVPQFHPSILGLAGTPEQIKDAAASFKIFYER 138

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKIN 191
           V  +     + Y + HT+ + LFD  G  V +  Y   +      + 
Sbjct: 139 VPED--TAPDGYTMGHTSQVFLFDPDGGFVRLYGYGTPAPEITADLR 183


>gi|256077264|ref|XP_002574927.1| sco1-related [Schistosoma mansoni]
 gi|238660144|emb|CAZ31160.1| sco1-related [Schistosoma mansoni]
          Length = 234

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/206 (24%), Positives = 91/206 (44%), Gaps = 14/206 (6%)

Query: 1   MKAL-----GIILGTILLAVLGS---IAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLS 52
           M+ +      +I G+  +A +         +  S+   G      D +L+  +G    LS
Sbjct: 28  MRYIQWCSYIVIAGSATVAAVSLTRDFMKATELSEGKYGLPSIGGDFNLIDHNGNPCKLS 87

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ---VDPTGTLLNAYFITVDPKRDTPEV 109
               K  +++FGF  C  +CP  + RL  +  +   ++     L   F++VD +RDTP+V
Sbjct: 88  DFRGKWVLLYFGFCRCPDICPEQIERLVEVSDRIMLIEKPKYPLVPVFVSVDSERDTPDV 147

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           + K+V+ FS R+ G++G   ++ +V+K +RIY +    +    +  Y VDHT  + L D 
Sbjct: 148 LAKYVKDFSPRLTGLTGTKKEIDKVSKLYRIYYSPGPKD---ADGDYIVDHTIIMYLLDP 204

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLIT 195
            G               +  I   + 
Sbjct: 205 KGQFSDYYGQNKSVQEIVRNIKEKMN 230


>gi|85706990|ref|ZP_01038079.1| SCO1/2 family protein [Roseovarius sp. 217]
 gi|85668431|gb|EAQ23303.1| SCO1/2 family protein [Roseovarius sp. 217]
          Length = 208

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 63/193 (32%), Positives = 92/193 (47%), Gaps = 8/193 (4%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNS----DVHLVAQDGTDFSLSSLYIKPSIVFF 63
           +G + L +      V          +R       D  L   +G +    +L  +P++VFF
Sbjct: 14  VGAVALMLGVGWWRVDGPGAPKPAGQRPLPLSAMDFRLTDHEGNEVGPETLIGRPTMVFF 73

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           GFT C  VCPTTLS +   L+ +      +N  FITVDP+RDT E M ++V  F   I G
Sbjct: 74  GFTYCPDVCPTTLSDISGWLEDLGDEAARMNVVFITVDPERDTVEAMAEYVGYFHPAIRG 133

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
            +G    V R A+ FR     V  E       Y ++HT ++ LFD  G +V +I Y +  
Sbjct: 134 WTGPANQVARAAEGFRASYERVPTE----GGDYTMNHTASVFLFDAKGELVTMIDYHEPR 189

Query: 184 DSAIEKINRLITY 196
           + A+ KI R +T 
Sbjct: 190 EFAVPKIRRALTE 202


>gi|239832293|ref|ZP_04680622.1| SCO2-like protein [Ochrobactrum intermedium LMG 3301]
 gi|239824560|gb|EEQ96128.1| SCO2-like protein [Ochrobactrum intermedium LMG 3301]
          Length = 196

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 74/193 (38%), Positives = 108/193 (55%), Gaps = 4/193 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    I     + V+   A ++           F   ++LV  DG  F+ + L   P+ 
Sbjct: 1   MKKFLPIFIIAFIVVIVGAAGLNLFRDKQAAKEPFGGPLNLVTMDGKPFTENDLRAAPAA 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFGFT+C  VCPTTL  +D  LKQ+ P G+ + AYFITVDP+RDT EVMK +V   SDR
Sbjct: 61  IFFGFTHCPDVCPTTLYEMDGWLKQLGPEGSDIKAYFITVDPERDTQEVMKTYVGNVSDR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IIG++G P ++  V K++ +Y   V  E      +Y +DHT ++ L D  G     I Y+
Sbjct: 121 IIGVTGTPQNIADVVKSYHVYAKKVPGED----GEYTMDHTASVFLLDKGGRFRSTIAYQ 176

Query: 181 DDSDSAIEKINRL 193
           ++ D+A+EK+  L
Sbjct: 177 ENPDTALEKLKNL 189


>gi|260948896|ref|XP_002618745.1| hypothetical protein CLUG_02204 [Clavispora lusitaniae ATCC 42720]
 gi|238848617|gb|EEQ38081.1| hypothetical protein CLUG_02204 [Clavispora lusitaniae ATCC 42720]
          Length = 298

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 58/205 (28%), Positives = 95/205 (46%), Gaps = 17/205 (8%)

Query: 5   GIILGTILLAVLGSIAYVS-----------FSSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
              +  + +A  G   + +             SK   G      +  LV  +   F+  +
Sbjct: 74  WKAVVLLFVAGGGFTWWFTKEKEKLRIQKEVESKRGMGKPLIGGNFSLVDTNNQPFTQEN 133

Query: 54  LYI---KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL-NAYFITVDPKRDTPEV 109
           L     K SI++FGFT+C  VCP  L +L  +L+++     +     FIT DP RD+PE+
Sbjct: 134 LKNDQKKFSIIYFGFTHCPDVCPDELDKLGEMLEELKNHDNIELQPIFITCDPARDSPEI 193

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           + ++++ F   IIG++G    V  V K +R+Y +     K    + Y VDH+    L D+
Sbjct: 194 IAQYLEDFHPSIIGLTGTYEAVKNVCKKYRVYFSTPPDVK--PGQDYLVDHSIFFYLMDS 251

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLI 194
            G  V VI  + D+ S  EKI + +
Sbjct: 252 EGQFVDVIGREVDAKSGAEKIRKHV 276


>gi|256077262|ref|XP_002574926.1| sco1-related [Schistosoma mansoni]
 gi|238660143|emb|CAZ31159.1| sco1-related [Schistosoma mansoni]
          Length = 246

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/206 (24%), Positives = 91/206 (44%), Gaps = 14/206 (6%)

Query: 1   MKAL-----GIILGTILLAVLGS---IAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLS 52
           M+ +      +I G+  +A +         +  S+   G      D +L+  +G    LS
Sbjct: 40  MRYIQWCSYIVIAGSATVAAVSLTRDFMKATELSEGKYGLPSIGGDFNLIDHNGNPCKLS 99

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ---VDPTGTLLNAYFITVDPKRDTPEV 109
               K  +++FGF  C  +CP  + RL  +  +   ++     L   F++VD +RDTP+V
Sbjct: 100 DFRGKWVLLYFGFCRCPDICPEQIERLVEVSDRIMLIEKPKYPLVPVFVSVDSERDTPDV 159

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           + K+V+ FS R+ G++G   ++ +V+K +RIY +    +    +  Y VDHT  + L D 
Sbjct: 160 LAKYVKDFSPRLTGLTGTKKEIDKVSKLYRIYYSPGPKD---ADGDYIVDHTIIMYLLDP 216

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLIT 195
            G               +  I   + 
Sbjct: 217 KGQFSDYYGQNKSVQEIVRNIKEKMN 242


>gi|254453594|ref|ZP_05067031.1| electron transport protein SCO1/SenC [Octadecabacter antarcticus
           238]
 gi|198268000|gb|EDY92270.1| electron transport protein SCO1/SenC [Octadecabacter antarcticus
           238]
          Length = 222

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 14/203 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSS----------KFVDGNRRFNSDVHLVAQDGTDFSL 51
           K   I  G++++A+LG     +                           LV ++G   + 
Sbjct: 20  KTYAIAAGSVVVALLGGAFLATQFGGSDDVFANCRASQSAGGAIGGPFELVDENGVTVTD 79

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
           + +   P++++FG+T C  VCP    R  + +  +D  G  +   FI++DP+RDT +V++
Sbjct: 80  TDVITGPTLIYFGYTFCPDVCPLDNMRNAQAVDILDAQGVEVKPVFISIDPERDTVDVVR 139

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            F   F DR++G++G P  V   ++ +R Y     +E     E Y VDHTT   L     
Sbjct: 140 DFTDNFHDRMLGLTGSPEQVRAASQAYRTYYAKQDSED----EFYLVDHTTMSYLVFPEQ 195

Query: 172 SIVGVIPYKDDSDSAIEKINRLI 194
                       +   E ++  I
Sbjct: 196 GFQEFYRRDVTPEQMAESLSCFI 218


>gi|83956485|ref|ZP_00964903.1| probable lipoprotein [Sulfitobacter sp. NAS-14.1]
 gi|83839295|gb|EAP78485.1| probable lipoprotein [Sulfitobacter sp. NAS-14.1]
          Length = 188

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/173 (28%), Positives = 78/173 (45%), Gaps = 2/173 (1%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
               S   D    F +   L    G   +      +  +VFFGFTNC  VCPTTLS +  
Sbjct: 18  YRADSARTDAEPPFFAQFELTDHQGMVRTEEDFAGRWMLVFFGFTNCPDVCPTTLSEVAA 77

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           ++  +      +   FIT+DP+RDTP  + ++V  F   IIG +G P  +   ++ F I+
Sbjct: 78  VMDGLGDDAAKVQPIFITIDPERDTPPALAEYVPLFDAGIIGWTGTPEQIAATSETFPIF 137

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              V  E++   + Y + HT+ L LFD         PY   ++  +  +   I
Sbjct: 138 FERV--EEAAAPDGYTMGHTSHLFLFDPDAGFADSWPYGTSAEEILADLEERI 188


>gi|301771620|ref|XP_002921237.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Ailuropoda
           melanoleuca]
          Length = 323

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 90/204 (44%), Gaps = 12/204 (5%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L          + G   +    ++ ++       G         L    G   +    
Sbjct: 118 KSLAFTFAIGGALLAGMKYFKKEKTQKLEKERQRSLGKPLLGGPFSLTTHTGEPKTDKDY 177

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN--AYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  VCP  L ++ +++ ++D   TL N    FIT+DP+RDT E +  
Sbjct: 178 VGQWVLIYFGFTHCPDVCPEELEKMIQVVDEIDNIPTLPNLTPLFITIDPERDTKEAIAN 237

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS +++G++G   ++ +VA+ +R+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 238 YVKEFSPKLVGLTGSKEEIDQVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGQ 294

Query: 173 IVGVIPYKDDSDSAIEKINRLITY 196
            +        +      I   +  
Sbjct: 295 FLDYFGQNKKNAEIAGSIAAHMRE 318


>gi|312382271|gb|EFR27787.1| hypothetical protein AND_05116 [Anopheles darlingi]
          Length = 390

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 59/199 (29%), Positives = 92/199 (46%), Gaps = 15/199 (7%)

Query: 7   ILGTILLAVLGSIAYVSFSS--------KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
            + T  + VLG + YV            K   G         LV  +G     S    K 
Sbjct: 68  FIATAGIGVLGFMWYVKDEKEQALLRERKRQLGKAAIGGKWELVDSNGNPRKSSDFLGKW 127

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
            +++FGFT+C  +CP  L ++  ++   + D T   +   FITVDP+RDT E++ K+V+ 
Sbjct: 128 LLIYFGFTHCPDICPDELEKMAAVVDNLEKDETAEPVQPIFITVDPQRDTKEIVGKYVKE 187

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS R++G++G    V +V + FR+Y +    ++   +  Y VDHT  + L D  G  V  
Sbjct: 188 FSPRLLGLTGTVDQVAQVCRAFRVYFSAGPKDE---DNDYIVDHTIIMYLVDPNGEFVDY 244

Query: 177 IPYKDDSDSAIEKINRLIT 195
                D +S    I  LI 
Sbjct: 245 YGQNRDKESIKNSI--LIN 261


>gi|83955808|ref|ZP_00964350.1| probable lipoprotein [Sulfitobacter sp. NAS-14.1]
 gi|83839813|gb|EAP78990.1| probable lipoprotein [Sulfitobacter sp. NAS-14.1]
          Length = 191

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 47/192 (24%), Positives = 86/192 (44%), Gaps = 4/192 (2%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFV--DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
            ++ G      +  + +  + +     +  + F +   L    G   +      +  +VF
Sbjct: 2   WVLAGAAAFVFIWLLLWADYRADRAQTEDEQPFFAQFELTDHRGMVQTEEDFAGRWMLVF 61

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FGFTNC  VCPTTL+ +  ++  +      +   FI++DP+RDTP  +  FV RF   I+
Sbjct: 62  FGFTNCPDVCPTTLAEVAAVMDGLGEDAAKVQPIFISIDPERDTPMALADFVPRFDAGIM 121

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
           G++G    +   A+ F IY   +  +++   + Y + HT+ L LFD         PY   
Sbjct: 122 GLTGTSDQIAETAETFPIYYEQI--DEASAPDGYTMGHTSNLFLFDPQAGFANSWPYGTP 179

Query: 183 SDSAIEKINRLI 194
           ++  +  +   I
Sbjct: 180 AEEILADLRERI 191


>gi|197103694|ref|YP_002129071.1| uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of
           respiratory and photosynthetic systems [Phenylobacterium
           zucineum HLK1]
 gi|196477114|gb|ACG76642.1| uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of
           respiratory and photosynthetic systems [Phenylobacterium
           zucineum HLK1]
          Length = 203

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 53/172 (30%), Positives = 77/172 (44%), Gaps = 7/172 (4%)

Query: 28  FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD 87
             +          LV Q G       L  K S VFFGFT+C  VCPTTL  +  + + + 
Sbjct: 31  PEEQTAAVGGAFQLVDQTGATVDEDVLKGKWSAVFFGFTHCPDVCPTTLFEMAEVERLMG 90

Query: 88  PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD--RIIGISGDPIDVMRVAKNFRIYVNNV 145
                L   FI+VDP+RDT + +  +V+  +   R+IG++G P  V R AK + +Y    
Sbjct: 91  EKAGTLQTVFISVDPERDTVQQVAAYVKNDAFPRRLIGLTGTPEQVDRAAKAYHVYYQK- 149

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
               +G    Y V+H +   L    G  V V+PY    +    KI   +  G
Sbjct: 150 ----AGEGPDYQVNHASYTYLMSPKGRFVCVLPYDLGPEQVAAKIETAMRAG 197


>gi|299534105|ref|ZP_07047457.1| electron transport protein SCO1/SenC [Comamonas testosteroni S44]
 gi|298718014|gb|EFI59019.1| electron transport protein SCO1/SenC [Comamonas testosteroni S44]
          Length = 179

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 55/173 (31%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
             F    V G   +  D+ L    G   SL     K   VFFG+T C  VCPTTL  L  
Sbjct: 10  PKFQGVDVTG-ADYAKDIPLTDVHGKKRSLKDFSGKVVAVFFGYTQCPDVCPTTLQELLE 68

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           + + +   G  L A F+++DP+RDTPEV+K ++  F +  +G+SG   ++  VAK+F+I+
Sbjct: 69  VKQALGTDGDKLQAVFVSLDPERDTPEVLKAYLANFDESFVGLSGTADEIAAVAKDFKIF 128

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              V  +   V+  Y +DH+    LFD  G +     Y        + +  L+
Sbjct: 129 FKKVPGK---VDGTYTLDHSAGTYLFDPQGRLRVYERYGAGPQLLTQDVKALL 178


>gi|238650648|ref|YP_002916500.1| sco2 protein precursor [Rickettsia peacockii str. Rustic]
 gi|238624746|gb|ACR47452.1| sco2 protein precursor [Rickettsia peacockii str. Rustic]
          Length = 205

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 49/206 (23%), Positives = 98/206 (47%), Gaps = 16/206 (7%)

Query: 1   MK----ALGIILGTILLAVLGSIAYV----------SFSSKFVDGNRRFNSDVHLVAQDG 46
           MK     + II+   LL  +G++  +          +      + N +   D  L+ Q+G
Sbjct: 1   MKIQSNVIKIIIVISLLIGVGALYLLLSLRTPEKPLAGQVNIYEDNVKIGGDFELIDQNG 60

Query: 47  TDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDT 106
             F+   L    S+++FGFT+C  +CPT+L+++  +++ ++     +   FIT+DPKRDT
Sbjct: 61  EIFNSDKLKGNLSLIYFGFTSCPDICPTSLNKMTEIVEILNKHKIDILPVFITIDPKRDT 120

Query: 107 PEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLL 166
           P  +K++++ F  + IG++G+   +  V   F+++   V  +    +  Y +DH++   L
Sbjct: 121 PIALKEYLKHFHPKFIGLTGNEQQIKDVTDKFKVFYARVHGDD--DDPNYMLDHSSFTYL 178

Query: 167 FDTAGSIVGVIPYKDDSDSAIEKINR 192
            D  G  +            +E +  
Sbjct: 179 IDANGKYLKHFYLDSSPKEIMEFLRN 204


>gi|241959366|ref|XP_002422402.1| copper-binding protein of the mitochondrial inner membrane,
           precursor, putative [Candida dubliniensis CD36]
 gi|223645747|emb|CAX40409.1| copper-binding protein of the mitochondrial inner membrane,
           precursor, putative [Candida dubliniensis CD36]
          Length = 302

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 60/201 (29%), Positives = 87/201 (43%), Gaps = 18/201 (8%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              +LL V G  AY     K               G         L    G  F+  +L 
Sbjct: 80  AVLLLLTVGGFGAYYFQREKERLHKRREMEANKSIGTPLIGGPFTLQDTKGNKFTEQNLV 139

Query: 56  I----KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
                + SI++FGFT+C  VCP  L +L  +L ++   G  +   FIT DP RDTPEV+ 
Sbjct: 140 DPNFKRFSILYFGFTHCPDVCPEELDKLGDMLDKLAKDGVPIQPVFITCDPARDTPEVLD 199

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            ++  F   IIG++G    V    K FR+Y +     K    + Y VDH+    L D  G
Sbjct: 200 AYLNDFHPGIIGLTGTFEQVKNTCKKFRVYFSTPPDVK--PGQDYLVDHSIFFYLIDPEG 257

Query: 172 SIVGVIPYKDDSDSAIEKINR 192
           + V VI  + ++  +  KI +
Sbjct: 258 NFVDVIGRESEALESATKIAK 278


>gi|240850879|ref|YP_002972279.1| cytochrome-c oxidase assembly factor [Bartonella grahamii as4aup]
 gi|240268002|gb|ACS51590.1| cytochrome-c oxidase assembly factor [Bartonella grahamii as4aup]
          Length = 193

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 108/201 (53%), Gaps = 17/201 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  ILG  ++ + G   Y + ++K          +  L   +G + + + +  KPSI
Sbjct: 1   MKNVIRILGLTIIFLAGIFIYDALTNK------PLGDNFTLTDSNGKNITEADIRSKPSI 54

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT C  +CPTTL  LDR L  + P    L  +F+TVDP+RDTPEV+ +++  F+++
Sbjct: 55  VFFGFTMCPEICPTTLMNLDRWLTALGPNADKLGIWFVTVDPERDTPEVLHEYLSNFNNK 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+GISGDP  V ++  +F I    V     G +  Y  +HT A+ L    G + GVI Y 
Sbjct: 115 IMGISGDPDKVHKMVNSFNIVAEKVP----GTDGNYTYNHTAAIFLLKKGGKLAGVIRYD 170

Query: 181 DDS-------DSAIEKINRLI 194
                     + AIE++ +LI
Sbjct: 171 TKESDSELKDEIAIERLKKLI 191


>gi|84503208|ref|ZP_01001293.1| probable lipoprotein [Oceanicola batsensis HTCC2597]
 gi|84686774|ref|ZP_01014661.1| probable lipoprotein [Maritimibacter alkaliphilus HTCC2654]
 gi|114762623|ref|ZP_01442067.1| hypothetical protein 1100011001314_R2601_07223 [Pelagibaca
           bermudensis HTCC2601]
 gi|84388449|gb|EAQ01398.1| probable lipoprotein [Oceanicola batsensis HTCC2597]
 gi|84665205|gb|EAQ11684.1| probable lipoprotein [Rhodobacterales bacterium HTCC2654]
 gi|114544878|gb|EAU47883.1| hypothetical protein R2601_07223 [Roseovarius sp. HTCC2601]
          Length = 188

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 50/190 (26%), Positives = 89/190 (46%), Gaps = 4/190 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFV--DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFG 64
           + G      +  + +  + +     +    F +D  L    G   +      +  +VFFG
Sbjct: 1   MAGAAAFVFIWLLLWSDYRADLARTESEPPFLADFELTDHRGMVQTDEDFAGRWMLVFFG 60

Query: 65  FTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGI 124
           FTNC  VCPTTLS +  +++ +     ++   FIT+DP+RDTP  + ++V  F   IIG+
Sbjct: 61  FTNCPDVCPTTLSEVAAVMEGLGDEAAMVQPIFITIDPERDTPTALAEYVPLFDAGIIGL 120

Query: 125 SGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSD 184
           +G P  +   ++ F I+   +  E++     Y + HT+ L LFDT        PY   ++
Sbjct: 121 TGTPEQIAATSETFPIFFERI--EQATAPGGYTMGHTSHLFLFDTQAGFADSWPYGTPAE 178

Query: 185 SAIEKINRLI 194
             +  + + I
Sbjct: 179 EILADLRQRI 188


>gi|307199277|gb|EFN79930.1| SCO1 protein-like protein, mitochondrial [Harpegnathos saltator]
          Length = 249

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 53/201 (26%), Positives = 90/201 (44%), Gaps = 17/201 (8%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
           L    L   G + Y+ +  K  D           G  +      L+   G          
Sbjct: 32  LTISSLIGTGFLLYMYYLRKEKDLALARERKRHLGKAKIGGSFELIDTQGRTVKSDDFLG 91

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
           +  +++FGFT+C  +CP  + ++  ++ +        +   FI+VDP RDTP V+ K+++
Sbjct: 92  QWILIYFGFTHCPDICPDEIEKMTNVVNKLEKEYNFKIQPIFISVDPDRDTPAVVDKYLK 151

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            FSD+IIG++G    V +V K +R+Y ++   ++   ++ Y VDHT  + L D  G  V 
Sbjct: 152 EFSDKIIGLTGSIDQVAKVCKAYRVYFSSGPKDQ---DDDYIVDHTIIIYLVDPEGLFVD 208

Query: 176 VIPYKDDSDSAIEKINRLITY 196
                 D D  I  I  L+  
Sbjct: 209 YYGQTHDVDRIITSI--LMNK 227


>gi|84685780|ref|ZP_01013676.1| regulatory protein SenC [Maritimibacter alkaliphilus HTCC2654]
 gi|84665873|gb|EAQ12347.1| regulatory protein SenC [Rhodobacterales bacterium HTCC2654]
          Length = 206

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/169 (28%), Positives = 75/169 (44%), Gaps = 3/169 (1%)

Query: 30  DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT 89
            G         LV +DG   +   ++ KP++++FG+T C  VCP   +R    L  V   
Sbjct: 41  SGTSTIGGPFELVDEDGQTVTDQDVFTKPTLLYFGYTFCPDVCPLDNARNAEALDLVQER 100

Query: 90  GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
           G      FI++DP RDTPE +K F     D +IG++G P  V   ++ ++ Y      + 
Sbjct: 101 GYDAQMAFISIDPDRDTPEQLKDFTSFLHDDMIGLTGSPEQVKAASQAYKTYYKK---QD 157

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
            G +E Y VDH+T   L       V      D  +   E ++  I   +
Sbjct: 158 EGDDEYYLVDHSTFTYLVLPETGFVEFFKRDDSPEKIAESMSCFIDASS 206


>gi|307321439|ref|ZP_07600836.1| electron transport protein SCO1/SenC [Sinorhizobium meliloti AK83]
 gi|306892898|gb|EFN23687.1| electron transport protein SCO1/SenC [Sinorhizobium meliloti AK83]
          Length = 202

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 52/186 (27%), Positives = 84/186 (45%), Gaps = 2/186 (1%)

Query: 11  ILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSA 70
                L   A       F           +L+A DG   + +    K  +VFFG+T C  
Sbjct: 16  AFFYGLVCAAVFVTMPAFAASTATVGGPFNLIAPDGAVVTDARFRGKWMLVFFGYTYCPD 75

Query: 71  VCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPID 130
           +CPTTLS +   L ++ P    +   FITVDP+RDTPEVM ++      RI+G++GD   
Sbjct: 76  LCPTTLSEIAIALDRLGPEAARVQPIFITVDPERDTPEVMGQYTGAIDRRILGLTGDKQQ 135

Query: 131 VMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
           +  V++ +  Y      +       Y VDH+T + + + +G  V  +      D+  + +
Sbjct: 136 IAAVSQKYGAYSERHPPDP--GTGDYVVDHSTYIYIMNPSGKFVRGLQAGTPGDAMADTL 193

Query: 191 NRLITY 196
            RL+  
Sbjct: 194 RRLMRQ 199


>gi|221114913|ref|XP_002156667.1| PREDICTED: similar to GK24460 [Hydra magnipapillata]
          Length = 250

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 47/204 (23%), Positives = 92/204 (45%), Gaps = 16/204 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
           LG +L+A  G + YV +                 G         L+   G   +    + 
Sbjct: 49  LGVLLVAGGGIMQYVKWLKDEKKKEQEKLQKMSIGKASIGGSFELMDTQGNLVTNKDFFG 108

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG--TLLNAYFITVDPKRDTPEVMKKFV 114
           K  +++FGF +C  +CP  L ++  ++++++      L+   +ITVDP RD+PE +K+++
Sbjct: 109 KWLLIYFGFCHCPDICPDQLEKMTTIIEKIESIQGLPLIQPIYITVDPHRDSPENIKQYL 168

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           + F  R IG++G    + +V K +R+Y +    ++   ++ Y VDHT  + L +  G+ V
Sbjct: 169 KDFHKRFIGLTGTDDQIKKVCKAYRVYFSAGPKDE---DDDYIVDHTIIMYLINPEGNFV 225

Query: 175 GVIPYKDDSDSAIEKINRLITYGN 198
                    +     I  ++    
Sbjct: 226 EYFGQNRTINEITGAITTIMMQKR 249


>gi|168034160|ref|XP_001769581.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162679123|gb|EDQ65574.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 175

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 45/172 (26%), Positives = 83/172 (48%), Gaps = 7/172 (4%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G         L+ QDG   +        ++++FGFT C  +CP  L++L   + +++   
Sbjct: 8   GKAAIGGPFKLLNQDGKVVTDRDFVGNWTLIYFGFTYCPDICPDELTKLAEAVDKIEKKA 67

Query: 91  T-LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
              +   FI++DP+RDT E ++++++ +  R +G++G   D+ +VA+ +R+Y      E 
Sbjct: 68  GLQVLPVFISIDPERDTVEQIREYLKEYHPRFVGLTGTVEDIRQVAREYRVYYMKTEDE- 126

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK 201
                 Y VDH+    L D   + V       D+DS  + +   I   NV+K
Sbjct: 127 ---GTDYLVDHSIITYLMDPEMNFVKFFGKNYDADSLADGVITEIN--NVLK 173


>gi|15892818|ref|NP_360532.1| sco2 protein precursor [Rickettsia conorii str. Malish 7]
 gi|34581474|ref|ZP_00142954.1| sco2 protein precursor [Rickettsia sibirica 246]
 gi|20455251|sp|Q92H76|SCO22_RICCN RecName: Full=SCO2-like protein RC0895
 gi|15620001|gb|AAL03433.1| sco2 protein precursor [Rickettsia conorii str. Malish 7]
 gi|28262859|gb|EAA26363.1| sco2 protein precursor [Rickettsia sibirica 246]
          Length = 205

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 49/206 (23%), Positives = 98/206 (47%), Gaps = 16/206 (7%)

Query: 1   MK----ALGIILGTILLAVLGSIAYV----------SFSSKFVDGNRRFNSDVHLVAQDG 46
           MK     + II+   LL  +G++  +          +      + N +   D  L+ Q+G
Sbjct: 1   MKIQSNVIKIIIVISLLIGVGALYLLLSLRTPEKPLAGQVNIYEDNVKIGGDFELIDQNG 60

Query: 47  TDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDT 106
             F+   L    S+++FGFT+C  +CPT+L+++  +++ ++     +   FIT+DPKRDT
Sbjct: 61  EIFNSDKLKGNLSLIYFGFTSCPDICPTSLNKMTEIVEILNKHKIDILPVFITIDPKRDT 120

Query: 107 PEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLL 166
           P  +K++++ F  + IG++G+   +  V   F+++   V  +    +  Y +DH++   L
Sbjct: 121 PIALKEYLKHFHPKFIGLTGNEQQIKDVTDKFKVFYARVHGDD--DDPNYMLDHSSFTYL 178

Query: 167 FDTAGSIVGVIPYKDDSDSAIEKINR 192
            D  G  +            +E +  
Sbjct: 179 IDANGKYLKHFYLDSSPKEMMEFLRN 204


>gi|253998916|ref|YP_003050979.1| electron transport protein SCO1/SenC [Methylovorus sp. SIP3-4]
 gi|253985595|gb|ACT50452.1| electron transport protein SCO1/SenC [Methylovorus sp. SIP3-4]
          Length = 191

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 45/163 (27%), Positives = 73/163 (44%), Gaps = 7/163 (4%)

Query: 36  NSDV----HLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT 91
            +D     HL    G   SL     K  ++FFG+T+C  VCPTT+S + + +K +     
Sbjct: 32  GADFASGLHLTDHHGKPASLQDFKGKVVVLFFGYTHCPDVCPTTMSDMAQTMKLLGKDAD 91

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSG 151
            +   F+T+DP RDTP+V+  +V  F  R IG+ G   ++   A +F+I       +   
Sbjct: 92  QVQVLFVTLDPARDTPDVLANYVPYFDPRFIGLYGTEAEIAGTAHHFKISATKQPPDAR- 150

Query: 152 VEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
               Y +DH+    ++D  G I     Y          +  L+
Sbjct: 151 --GNYSIDHSAGTYVYDKQGKIRLYFNYGASPAMMAHDLRLLM 191


>gi|196007026|ref|XP_002113379.1| hypothetical protein TRIADDRAFT_27323 [Trichoplax adhaerens]
 gi|190583783|gb|EDV23853.1| hypothetical protein TRIADDRAFT_27323 [Trichoplax adhaerens]
          Length = 234

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 52/207 (25%), Positives = 89/207 (42%), Gaps = 18/207 (8%)

Query: 8   LGTILLAVLGSIAYVSF-----------SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           L  ILLA     AYV +                 G      +  L    G   +  S   
Sbjct: 29  LAAILLAGGLVAAYVRWEKGNKREEIRKQKSRTIGIASLGGEFTLTDHTGKVKTNESFLG 88

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLD---RLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           +  I++FGFT+C  +CP  L +L    +++  +      L   F++VDP+RDTP+ M ++
Sbjct: 89  QWIIIYFGFTHCPDICPDELDKLTAAIKIVDDLKKVPYKLQPLFVSVDPERDTPKQMAEY 148

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++ F  R+IG++G    V +V K +R+Y +    +    +  Y VDH+  + L D  G+ 
Sbjct: 149 IKDFHPRLIGLTGTKEQVDKVTKAYRVYYSFGPKD---SDNDYIVDHSIIMYLIDPEGNF 205

Query: 174 VGVIPYKDDSDSAIE-KINRLITYGNV 199
                    +       +N ++ Y  V
Sbjct: 206 KEYYGQNRSAKEIAASAVNHMLKYKAV 232


>gi|156408590|ref|XP_001641939.1| predicted protein [Nematostella vectensis]
 gi|156229080|gb|EDO49876.1| predicted protein [Nematostella vectensis]
          Length = 211

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 46/212 (21%), Positives = 82/212 (38%), Gaps = 17/212 (8%)

Query: 4   LGIILGTILLAVLGSIAYV------------SFSSKFVDGNRRFNSDVHLVAQDGTDFSL 51
           +      + L   G+I Y                 K   G         L+   G   + 
Sbjct: 3   ITWTSFAVFLLAGGAIVYYVRTLKEEKEKKKEKEKKRSIGKVALGGPFDLIDHHGKPKTD 62

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEV 109
                K  +++FGFT+C  +CP  L ++   +           L   FI+VDPKRDT E 
Sbjct: 63  KDFRGKWLLLYFGFTHCPDICPDELEKMAEAIDLTTKGKVSEELQPLFISVDPKRDTVEA 122

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           + ++V+ F  +++G++G    V  V K +R+Y +   A++   +  Y VDHT    L   
Sbjct: 123 VAEYVKEFHPKLLGLTGPVEKVQEVCKAYRVYFSAGPADE---DNDYIVDHTIIQYLVSP 179

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLITYGNVVK 201
            G  +       +++     I   +    + +
Sbjct: 180 DGEFMEYFGQNKNAEEIAASITNHMLKYKLSR 211


>gi|86136728|ref|ZP_01055306.1| regulatory protein SenC [Roseobacter sp. MED193]
 gi|85826052|gb|EAQ46249.1| regulatory protein SenC [Roseobacter sp. MED193]
          Length = 205

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 85/208 (40%), Gaps = 16/208 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTD 48
           M  L  IL  + +A L    ++       D            G         L+   G  
Sbjct: 1   MARLYSILAVLFVAALAGGTWLLTRGGDADQFAQCRGSAIASGGDAIGGPFELINSKGET 60

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPE 108
            +   ++ +PS+V+FG+T C  VCP  +SR    +  +   G      FI++DP+RDTPE
Sbjct: 61  VTDKDVFTEPSLVYFGYTFCPDVCPLDVSRNAEAVDVLAERGISTTPVFISIDPERDTPE 120

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
           V+  F     +++IG++G    V   ++ ++ Y         G E+ Y VDH+T   L  
Sbjct: 121 VVGDFAYNMHEKMIGLTGSLEQVKAASRAYKTYFKRQP----GDEDYYLVDHSTFAYLVL 176

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
                V      +  +   +K++  +  
Sbjct: 177 PEIGFVDFFRRDETPEQVADKVSCFVEN 204


>gi|296282781|ref|ZP_06860779.1| electron transport protein SCO1/SenC [Citromicrobium bathyomarinum
           JL354]
          Length = 195

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 60/196 (30%), Positives = 95/196 (48%), Gaps = 9/196 (4%)

Query: 6   IILGTILLAVLGSIAYVSFSSKFVDGNRR-----FNSDVHLVAQDGTDFSLSSLYIKPSI 60
           + L   L+A +G  A      +                  L A DG+  +  +L  KP  
Sbjct: 3   VWLFVALVAGMGLFALFGPDRQPAADQPTGYADTVGGAFSLTAADGSTVTDQTLKGKPFA 62

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFGFT C  VCPTTL+ L +L KQ+   G      F++VDP  D+PE + ++V  F   
Sbjct: 63  IFFGFTRCPDVCPTTLASLAKLRKQMGEDGDKFRIVFVSVDPGYDSPEDIGRYVDLFGTP 122

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IIG++G   ++ RV K +  +   V  E     + Y +DHT ++ L D  G +  +I Y 
Sbjct: 123 IIGLTGSDEEIARVTKAYHAFYKKVPTE----GDDYTIDHTASVYLMDADGKLQSIIDYH 178

Query: 181 DDSDSAIEKINRLITY 196
           +D  +++ K+ RL+  
Sbjct: 179 EDPKTSLAKLERLVDK 194


>gi|71907104|ref|YP_284691.1| electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
 gi|71846725|gb|AAZ46221.1| Electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
          Length = 192

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 51/176 (28%), Positives = 85/176 (48%), Gaps = 4/176 (2%)

Query: 20  AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRL 79
           A  +F +  + G   F     L   DG   SL+    +  +VFFG+T+C  +CPTTL+RL
Sbjct: 20  APEAFHNTDLTG-ATFGRGFELTDHDGRPRSLADFKGRAVVVFFGYTSCPDICPTTLARL 78

Query: 80  DRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
             ++  +      +   FIT+DP+RD+ E +K FV  F    IG+ GD   +  V + FR
Sbjct: 79  AGVMTALGEDAGRVQVLFITLDPERDSSERLKTFVPWFHPSFIGLRGDVGQIKAVTEEFR 138

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           ++      +    E  Y +DH+T   ++D AG +   +      +  +  I +L+ 
Sbjct: 139 VFGARRPVD---GELGYVIDHSTGAYVYDPAGRLRLYVKDTASVEDIVADIRQLLA 191


>gi|163747586|ref|ZP_02154934.1| probable lipoprotein [Oceanibulbus indolifex HEL-45]
 gi|161379111|gb|EDQ03532.1| probable lipoprotein [Oceanibulbus indolifex HEL-45]
          Length = 191

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 52/191 (27%), Positives = 95/191 (49%), Gaps = 8/191 (4%)

Query: 10  TILLAVLGSIAYVSFSSKFVDGNR------RFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
            ++ A + +  +++  ++     R       F +D  L    G   +      +  +VFF
Sbjct: 1   MVVTAAVSATLWMTERNQGPVAARVDPEAESFTADFELTDHTGMVQTDEDFRGRWMLVFF 60

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           GF NC  VCP  L+ + +++ ++   G+ +   FITVDP+RDTP  +  +V +F   I+G
Sbjct: 61  GFANCPDVCPMGLATIAQVMDELGTQGSAVQPLFITVDPERDTPSALANYVPQFGQGILG 120

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           +SG P  + R A+ F+IY   +  E++   + Y + HT++ LLFD  G  V +  Y ++ 
Sbjct: 121 LSGPPDQIERTAETFKIYYQKI--EEASAPDGYTMGHTSSFLLFDPEGEFVRIYEYDEEP 178

Query: 184 DSAIEKINRLI 194
              +  +   I
Sbjct: 179 GLIVTDLRERI 189


>gi|329847557|ref|ZP_08262585.1| SCO1/SenC family protein [Asticcacaulis biprosthecum C19]
 gi|328842620|gb|EGF92189.1| SCO1/SenC family protein [Asticcacaulis biprosthecum C19]
          Length = 204

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 55/207 (26%), Positives = 84/207 (40%), Gaps = 17/207 (8%)

Query: 1   MKALGI-ILGTILLAVLGSIAYVSF---------SSKFVDGNRRFNSDVHLVAQDGTDFS 50
           M    + I+G   LA++G      +         +S  +D ++       L  Q+G   +
Sbjct: 1   MTKFRLAIIGAAFLALIGLAGLNYYLNLNGAQRNASVDLDPSKLPGGAFTLTDQNGQVVT 60

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
            ++L  K + VFFG+T C   CP TL  L ++  Q+          FI+VDP RDTP  +
Sbjct: 61  EAALNGKWTAVFFGYTYCPDFCPLTLQALAQVQTQLGGKAKDFQIVFISVDPARDTPASL 120

Query: 111 KKFVQ--RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
           K ++         IG++G P  V  V K +R   + V     G  + Y   HTTA+ L D
Sbjct: 121 KAYLDSGGMPKGAIGLTGTPDQVASVVKAYRTTASKV-----GEGDAYTYQHTTAVYLMD 175

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLIT 195
             G       Y          I   + 
Sbjct: 176 PRGRYNSSYAYGLSPAEMAGMIKDAMA 202


>gi|288942574|ref|YP_003444814.1| electron transport protein SCO1/SenC [Allochromatium vinosum DSM
           180]
 gi|288897946|gb|ADC63782.1| electron transport protein SCO1/SenC [Allochromatium vinosum DSM
           180]
          Length = 203

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 48/202 (23%), Positives = 87/202 (43%), Gaps = 11/202 (5%)

Query: 1   MKA--LGIILGTILLAVLGSIAYVSFSSKFVDGN-----RRFNSDVHLVAQDGTDFSLSS 53
           MK   + I+L   + A + S      +S+               D  L +  G    LS 
Sbjct: 1   MKRSSIAILLAAAVSAGILSCLEPGPASESSQAPLELATPPTGGDFTLDSAAG-PVRLSD 59

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKK 112
           L  +  +++FG+T C  +CPT L  + + L+             F++VDP+RD PE + +
Sbjct: 60  LRGQAVLIYFGYTACPDICPTNLVSIAKALRSLHPAELDRTRVLFVSVDPERDDPEHLAR 119

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V  F   ++G++G P  + +VAK +      V  E +G    Y +DH+    + D  G 
Sbjct: 120 YVAYFHPNVLGLTGTPEQLAQVAKRYGAAYQRV--EDTGSAMGYLIDHSAFTAVVDPNGR 177

Query: 173 IVGVIPYKDDSDSAIEKINRLI 194
           +V  + +    ++    I   +
Sbjct: 178 LVQTLGHASPPETIRAAIRTAL 199


>gi|149204604|ref|ZP_01881570.1| probable lipoprotein [Roseovarius sp. TM1035]
 gi|149142103|gb|EDM30152.1| probable lipoprotein [Roseovarius sp. TM1035]
          Length = 188

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 49/190 (25%), Positives = 84/190 (44%), Gaps = 4/190 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSK--FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFG 64
           + G   L  +  + +  + +     +    F +   L    G   +      +  +VFFG
Sbjct: 1   MAGVAALVFIWLLLWADYRADISQAETEPPFLAQFELTDHMGMIRTEEDFAGRWMLVFFG 60

Query: 65  FTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGI 124
           F NC  VCPTTL+ +  ++  +      +   FI++DP+RDTP  +  FV RF   IIG+
Sbjct: 61  FANCPDVCPTTLAEVAAVMDGLGEDAAKVQPIFISIDPERDTPMALADFVPRFDAGIIGL 120

Query: 125 SGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSD 184
           +G    +   A+ F IY   +  E++   + Y + HT+ L LFD         PY   ++
Sbjct: 121 TGTSDQIAETAETFPIYFERI--EEASAPDGYTMGHTSHLFLFDPQAGFADSWPYGTPAE 178

Query: 185 SAIEKINRLI 194
             +  +   I
Sbjct: 179 EILADLRERI 188


>gi|71907209|ref|YP_284796.1| electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
 gi|71846830|gb|AAZ46326.1| Electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
          Length = 200

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 51/199 (25%), Positives = 92/199 (46%), Gaps = 7/199 (3%)

Query: 2   KALGIILGTILLAVLG-SIAYVSFSSKFVDGNRRF--NSDVHLVAQDGTDFSLSSLYIKP 58
           + L +I   + L V G ++ +     +            D  L +  G   SL     K 
Sbjct: 4   RILMVIAALLALVVAGVAVFWQPEMPERPIPAAVIAAGGDFTLQSASG-PVSLKDYRGKL 62

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPEVMKKFVQRF 117
            +++FG+T C  +CPT+L+     LKQ+ P     +   F++VDPKRDTP+ +K++V+ F
Sbjct: 63  VLLYFGYTFCPDICPTSLAATSEGLKQLKPEELAQVAMIFVSVDPKRDTPDRLKEYVEFF 122

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
              I+G++G P ++  +AK + ++      +       Y VDH+    +    G +VG I
Sbjct: 123 HPAIVGVTGTPENIAEIAKRYGVFYA--EQKVETAGGGYVVDHSADTFIVAPDGQLVGKI 180

Query: 178 PYKDDSDSAIEKINRLITY 196
            +    D  +  I + +  
Sbjct: 181 AHATPPDQVVVAIRKHLKQ 199


>gi|254573052|ref|XP_002493635.1| Copper-binding protein of the mitochondrial inner membrane [Pichia
           pastoris GS115]
 gi|238033434|emb|CAY71456.1| Copper-binding protein of the mitochondrial inner membrane [Pichia
           pastoris GS115]
 gi|328354537|emb|CCA40934.1| Protein SCO1, mitochondrial [Pichia pastoris CBS 7435]
          Length = 304

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 55/197 (27%), Positives = 92/197 (46%), Gaps = 16/197 (8%)

Query: 9   GTILLAVLGSIAYVSFSSKFVD-------------GNRRFNSDVHLVAQDGTDFSLSSLY 55
             +L AV+G++    F  +                G         L+  +G  F+   L 
Sbjct: 85  AVVLFAVVGTVVTFFFKKEKKRLELQKEADQNRGMGKPLVGGPFDLIDTNGEQFTQEKLK 144

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K S+++FGFT+C  +CP  L +L  +L ++       +   FIT DP RD+P ++K+++
Sbjct: 145 DKFSLIYFGFTHCPDICPDELDKLGLMLDELKSKYNIQIQPIFITCDPARDSPAIIKEYL 204

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           + F   IIG++G    +    KNFR+Y +     K    + Y VDH+    L D  G  +
Sbjct: 205 KDFHPDIIGLTGTYDKIKECCKNFRVYFSTPRDVK--AGQDYLVDHSIFFYLMDKEGEFI 262

Query: 175 GVIPYKDDSDSAIEKIN 191
            V+  + D+  A+EKI 
Sbjct: 263 DVLGRQYDASGAVEKIK 279


>gi|66813090|ref|XP_640724.1| hypothetical protein DDB_G0281505 [Dictyostelium discoideum AX4]
 gi|60468732|gb|EAL66734.1| hypothetical protein DDB_G0281505 [Dictyostelium discoideum AX4]
          Length = 337

 Score =  121 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 96/205 (46%), Gaps = 15/205 (7%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVD--------GNRRFNSDVHLVAQDGTDFSLSSL 54
               +   ++   +G + Y    +K  +        G+        L+ ++G  F+   L
Sbjct: 113 TWASLTVALISGGIGWLYYDHLMTKKRERQNEIKTYGSSSVGGPFVLIDENGKPFTDLDL 172

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT--GTLLNAYFITVDPKRDTPEVMKK 112
             K  +++FGFT C  VCP  L ++ +++K ++    G  +   FIT+DP RDT E +K 
Sbjct: 173 KGKYGLLYFGFTYCPDVCPAELYKMTKVIKNLESNGLGDSIVPVFITIDPWRDTIEQVKS 232

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +++ F  +  G++G P  + +VAK++R++++      SG  + Y VDHT  + L    G 
Sbjct: 233 YIEEFHPKFKGLTGTPEQITKVAKSYRVFMSK-----SGKGDDYLVDHTIIVYLVGPDGK 287

Query: 173 IVGVIPYKDDSDSAIEKINRLITYG 197
            +       DSD    KI   I  G
Sbjct: 288 FIEFYNVNQDSDIITNKIITRIANG 312


>gi|307188591|gb|EFN73319.1| SCO1 protein-like protein, mitochondrial [Camponotus floridanus]
          Length = 200

 Score =  121 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 83/167 (49%), Gaps = 6/167 (3%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPT 89
           G  +      L+  +G          K  +++FGFT+C  VCP  + ++  ++ +     
Sbjct: 16  GKAKIGGKFELIDTEGKTVKSDDFLGKWLMIYFGFTHCPDVCPDEIEKMTNVVNKLEKEH 75

Query: 90  GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
              +   FI+VDP RDTP V+ K+++ FSD+IIG++G+   + +V K +R+Y +N   ++
Sbjct: 76  NIQMQPIFISVDPDRDTPTVVGKYLKEFSDKIIGLTGNVEQIGKVCKAYRVYYSNGPKDQ 135

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
              +E Y VDHT  + L D  G  V       D D  I  I  LI  
Sbjct: 136 ---DEDYIVDHTIIIYLVDPEGMFVDYYGQTHDVDKIITSI--LINK 177


>gi|153009090|ref|YP_001370305.1| electron transport protein SCO1/SenC [Ochrobactrum anthropi ATCC
           49188]
 gi|151560978|gb|ABS14476.1| electron transport protein SCO1/SenC [Ochrobactrum anthropi ATCC
           49188]
          Length = 196

 Score =  121 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 75/193 (38%), Positives = 108/193 (55%), Gaps = 4/193 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    I     + V+   A ++           F   ++LV  DGT F+ + L   P+ 
Sbjct: 1   MKKFLPIFIIAFIVVIVGAAGLNLFRDKEAAKEPFGGPLNLVTMDGTPFTENDLRAAPAA 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFGFT+C  VCPTTL  LD  LKQ+ P  + + AYFITVDP+RDT EVMK +V   SDR
Sbjct: 61  IFFGFTHCPDVCPTTLYELDGWLKQLGPEASDIKAYFITVDPERDTQEVMKTYVGNVSDR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IIGI+G P ++  + K++ +Y   V  E      +Y +DHT ++ L D  G     I Y+
Sbjct: 121 IIGITGTPQNIADMVKSYHVYAKKVPGED----GEYTMDHTASVFLLDKGGRFRSTIAYQ 176

Query: 181 DDSDSAIEKINRL 193
           ++ D+A+EK+  L
Sbjct: 177 ENPDTALEKLKNL 189


>gi|145234192|ref|XP_001400467.1| protein SCO1 [Aspergillus niger CBS 513.88]
 gi|134057411|emb|CAK47749.1| unnamed protein product [Aspergillus niger]
          Length = 297

 Score =  121 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 58/205 (28%), Positives = 87/205 (42%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +L   G I Y     + ++           G  +      L   DG +F+   
Sbjct: 83  WKAALLFVLTGGGMIIYFRVEKERLERKRIAEMSKGVGKPKVGGLFTLKDLDGKEFTAED 142

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S V+FGFT+C  +CP  L ++  ++ +V       N     FIT DP RDTPEV+
Sbjct: 143 LKGKYSFVYFGFTHCPDICPDELDKMAEIIDKVKEATKGENIFLPVFITCDPARDTPEVL 202

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           + +++ F   IIG++G   +V  V K +R+Y +          E Y VDH+    L D  
Sbjct: 203 RTYLKEFHPGIIGLTGTYDEVKHVCKQYRVYFST--PRDIKPGEDYLVDHSIYFYLMDPD 260

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
              V  I  +D  +SA   I   I 
Sbjct: 261 NDFVECIGRQDTPESATRTIMEHIN 285


>gi|311103447|ref|YP_003976300.1| electron transporter SCO1/SenC [Achromobacter xylosoxidans A8]
 gi|310758136|gb|ADP13585.1| electron transport protein SCO1/SenC [Achromobacter xylosoxidans
           A8]
          Length = 201

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 84/174 (48%), Gaps = 5/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
             F    + G  +    + LV  +G    LS    K  +VFFGFT C  VCPT+L+ L  
Sbjct: 32  PVFKGSDISGT-QLGRGMELVDYNGKTRQLSDFAGKVVVVFFGFTQCPDVCPTSLAELTE 90

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           ++K++ P    +    ITVDP+RDTPEV+K++V  F  R +G++G P  V + A +F+ Y
Sbjct: 91  VMKKLGPDADRVQVLLITVDPERDTPEVLKQYVTAFDPRFLGLTGTPDQVKKAAASFKAY 150

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                 +       Y +DHT A  L D  G    +       D+  + I  L+ 
Sbjct: 151 YAKAPTKD----GNYTMDHTAAFYLLDGKGESRVLANNNIGVDALTQDIKALLK 200


>gi|254486522|ref|ZP_05099727.1| SenC protein [Roseobacter sp. GAI101]
 gi|214043391|gb|EEB84029.1| SenC protein [Roseobacter sp. GAI101]
          Length = 205

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 49/209 (23%), Positives = 82/209 (39%), Gaps = 16/209 (7%)

Query: 1   MKALGIILGTILLAVLGSIA------------YVSFSSKFVDGNRRFNSDVHLVAQDGTD 48
           M+    I   ++     ++             Y    +  V G         LV  +G  
Sbjct: 1   MRRFYAIAAVVVAIGFLAVMLFMGNRPEEADKYAQCKNATVAGGADLGGPFELVNAEGKT 60

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPE 108
            + + +  +PS+++FG+T C  VCP  + R    +  +   G  +   FI++DP RDTPE
Sbjct: 61  VTDADVITEPSLIYFGYTFCPDVCPLDVDRNASAVDVLADRGMSVTPVFISIDPARDTPE 120

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
           V+ +F      ++IG++G P  V   +  +R Y     A+     E Y VDH+T   L  
Sbjct: 121 VVGEFAANMHPKMIGLTGSPEQVAAASAAYRTYYKAHEADD----EYYLVDHSTFSYLVM 176

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITYG 197
                V         +   +KI   I   
Sbjct: 177 PDEGFVDFFRRDVTPEKMADKIACYIENQ 205


>gi|157964726|ref|YP_001499550.1| Sco2 protein precursor [Rickettsia massiliae MTU5]
 gi|157844502|gb|ABV85003.1| Sco2 protein precursor [Rickettsia massiliae MTU5]
          Length = 210

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 95/199 (47%), Gaps = 12/199 (6%)

Query: 4   LGIILGTILLAVLGSIAYV----------SFSSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
           + II+   LL  +G++  +          +      + N +   D  L+ Q+G  F+   
Sbjct: 13  IKIIIVISLLIGVGALYLLLSLRTPEKPLAGQVNIYEDNVKIGGDFELIDQNGEIFNSDK 72

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L    S+++FGFT+C  +CPT+L+++  +++ ++     +   FIT+DP RDTP  +K++
Sbjct: 73  LKGNLSLIYFGFTSCPDICPTSLNKMTEIVEILNKHKIDILPVFITIDPTRDTPVALKEY 132

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++ F  + IG++G+   +  V   F+++   V  +    +  Y +DH++   L D  G  
Sbjct: 133 LKHFHPKFIGLTGNEQQIKDVTDKFKVFYARVHGDD--DDPNYMLDHSSFTYLIDANGKY 190

Query: 174 VGVIPYKDDSDSAIEKINR 192
           +            +E +  
Sbjct: 191 LKHFYLDSSPKEIMEFLRN 209


>gi|150864872|ref|XP_001383869.2| Putative cytochrome C oxidase assembly protein [Scheffersomyces
           stipitis CBS 6054]
 gi|149386128|gb|ABN65840.2| Putative cytochrome C oxidase assembly protein [Scheffersomyces
           stipitis CBS 6054]
          Length = 297

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 87/173 (50%), Gaps = 5/173 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI---KPSIVFFGFTNCSAVCPTTLSRLDR 81
            SK   G         L+   G  F+  +L     K SI++FGFT+C  VCP  L +L  
Sbjct: 105 DSKRSIGKPLIGGPFSLIDTKGQPFTHKNLVNDNKKFSIIYFGFTHCPDVCPDELDKLGD 164

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           +L+++  +   +   FIT DP RD+PE+++++++ F   IIG++G   +V    K +R+Y
Sbjct: 165 MLEELKKSKIEMQPIFITCDPARDSPEIVEQYLEDFHPDIIGLTGTYDEVKNCCKKYRVY 224

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            +          + Y VDH+    + D+ G  V VI  +  +   +EKI + I
Sbjct: 225 FST--PADIKPGQDYLVDHSIFFYVMDSEGQFVDVIGREATAAEGVEKIKKQI 275


>gi|307307364|ref|ZP_07587100.1| electron transport protein SCO1/SenC [Sinorhizobium meliloti
           BL225C]
 gi|306901878|gb|EFN32478.1| electron transport protein SCO1/SenC [Sinorhizobium meliloti
           BL225C]
          Length = 202

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/186 (27%), Positives = 83/186 (44%), Gaps = 2/186 (1%)

Query: 11  ILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSA 70
                L   A       F           +L+A DG   + +    K  +VFFG+T C  
Sbjct: 16  AFFYGLVCAAVFVTMPAFAASPATVGGPFNLIAPDGAVVTDARFRGKWMLVFFGYTYCPD 75

Query: 71  VCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPID 130
           +CPTTLS +   L ++ P    +   FITVDP+RDTPEVM ++      RI+G++GD   
Sbjct: 76  LCPTTLSEIAIALDRLGPEAARVQPIFITVDPERDTPEVMGQYTGAIDRRILGLTGDKQQ 135

Query: 131 VMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
           +  V+  +  Y      +       Y VDH+T + + + +G  V  +      D+  + +
Sbjct: 136 IAAVSHKYGAYSERHPPDP--GTGDYVVDHSTYIYIMNPSGKFVRGLQAGTPGDAMADTL 193

Query: 191 NRLITY 196
            RL+  
Sbjct: 194 QRLMRQ 199


>gi|328873636|gb|EGG22003.1| hypothetical protein DFA_01892 [Dictyostelium fasciculatum]
          Length = 328

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 47/205 (22%), Positives = 84/205 (40%), Gaps = 15/205 (7%)

Query: 3   ALGIILGTILLAVLGSIAYV--------SFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
               +   +    LG + Y                 G         L+ ++G   S    
Sbjct: 101 TFASLFAALFFGGLGWLYYDHLMVQKREKIKQIETYGTSSIGGGFSLIDENGKAVSDLDF 160

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG--TLLNAYFITVDPKRDTPEVMKK 112
             K   ++FGFT C   CP  L ++  +L  ++       +   FIT+DP RDT E +K+
Sbjct: 161 RGKYMFLYFGFTYCPDACPAELDKMTIVLNNLEKHNLLDSIVPVFITIDPWRDTVEQIKQ 220

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           ++  F  + +G++G P  + ++AK +R++++      +G  + Y VDHT    L    G 
Sbjct: 221 YIHEFHPKFVGLTGTPEQITKLAKGYRVFISK-----AGKGDSYLVDHTIIEYLIGPDGK 275

Query: 173 IVGVIPYKDDSDSAIEKINRLITYG 197
            +       ++D   EKI   +  G
Sbjct: 276 FIEFYGSNLNADQVTEKILERMAQG 300


>gi|319764146|ref|YP_004128083.1| electron transport protein sco1/senc [Alicycliphilus denitrificans
           BC]
 gi|330826497|ref|YP_004389800.1| electron transport protein SCO1/SenC [Alicycliphilus denitrificans
           K601]
 gi|317118707|gb|ADV01196.1| electron transport protein SCO1/SenC [Alicycliphilus denitrificans
           BC]
 gi|329311869|gb|AEB86284.1| electron transport protein SCO1/SenC [Alicycliphilus denitrificans
           K601]
          Length = 187

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 54/191 (28%), Positives = 87/191 (45%), Gaps = 4/191 (2%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           +G   +    +     F    + G   +  D+ L   +G   SL     K  +VFFG+T 
Sbjct: 1   MGAAGIFSACTPKGPKFQGVDLTG-AEYARDLPLPDHNGQLRSLKDFAGKVVVVFFGYTQ 59

Query: 68  CSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGD 127
           C  VCPT++S L  + + +   G  L   F+TVDP+RDTPE++K ++  F    + + G 
Sbjct: 60  CPDVCPTSMSELAEVKRALGADGDKLQGIFVTVDPERDTPEMLKAYMASFDPGFLALRGT 119

Query: 128 PIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAI 187
           P  +  VAK+F+IY   V          Y +DH+    ++DTAG +     Y   + S  
Sbjct: 120 PEQLAAVAKDFKIYYKRV---DGQTPTSYTMDHSAGSYVYDTAGRLRVYHRYGSGAQSLA 176

Query: 188 EKINRLITYGN 198
             +  L+    
Sbjct: 177 ADVRALLDEAR 187


>gi|296421332|ref|XP_002840219.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636433|emb|CAZ84410.1| unnamed protein product [Tuber melanosporum]
          Length = 281

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 47/200 (23%), Positives = 85/200 (42%), Gaps = 15/200 (7%)

Query: 9   GTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
           G + LA    +     + K               G  +    ++L+  +G +        
Sbjct: 75  GILFLAAGAGLTIYFRNEKARIERKRVAEMSKGVGRPKVGGPLNLLDHNGKERKDEEWRG 134

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
           K  +V+FGFT+C  +CP  L ++  +        G +++  FIT DP RDTP VMK ++ 
Sbjct: 135 KHMLVYFGFTHCPDICPEELDKMASMTDLVKKEHGDVMSPLFITCDPARDTPPVMKGYLA 194

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F   ++G++G    + +  K++R+Y +     +    + Y VDH+    L D  G  V 
Sbjct: 195 EFHPDLVGLTGTYDQIKQTCKSYRVYFSTPP--EIKPGQDYLVDHSIYFYLMDPEGDFVE 252

Query: 176 VIPYKDDSDSAIEKINRLIT 195
            +  +   + A + I   I 
Sbjct: 253 ALGRQHTPEQAAKIIGDHIK 272


>gi|326427755|gb|EGD73325.1| SCO1 protein [Salpingoeca sp. ATCC 50818]
          Length = 297

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 81/196 (41%), Gaps = 17/196 (8%)

Query: 9   GTILLAVLGSIAYVSFS------------SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
              +LA+ G   Y   S            +    G         LV   G   +      
Sbjct: 94  LVAMLALGGGAVYYFQSARQQAEQERLKRTTKAAGRPALGGPYELVDTKGNKATNEDFLG 153

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT--GTLLNAYFITVDPKRDTPEVMKKFV 114
           K  +++FGFT C  VCP  L ++  ++  +D       +   FI+VDP RDTP+ +  +V
Sbjct: 154 KWHLLYFGFTFCPDVCPEELEKMAEIVDAIDKKKGKDSITPIFISVDPDRDTPDKVAAYV 213

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           ++F  +++G++G    +  + K FR+Y +         EE Y VDH+    L    G+ V
Sbjct: 214 KQFHPKMVGLTGTHDQIKHICKQFRVYYSRP---NPDGEEDYLVDHSIIQYLMAPDGTFV 270

Query: 175 GVIPYKDDSDSAIEKI 190
                   ++ A + I
Sbjct: 271 AYYGQNTTAEQATKSI 286


>gi|164658381|ref|XP_001730316.1| hypothetical protein MGL_2698 [Malassezia globosa CBS 7966]
 gi|159104211|gb|EDP43102.1| hypothetical protein MGL_2698 [Malassezia globosa CBS 7966]
          Length = 255

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/203 (24%), Positives = 84/203 (41%), Gaps = 16/203 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGTDFSLSSL 54
              + LA   ++ Y     K              V G  R      LV+  G  F+   L
Sbjct: 3   AAALFLATGFALYYYFQHEKAKLAESKKKKQEDQVIGRPRIGGPFSLVSSTGHPFTDKDL 62

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPEVMKKF 113
               S+++FGFTNC  +CP  L ++  ++ +V  T  T++N  FIT DP RD    + ++
Sbjct: 63  LGSFSLIYFGFTNCPDICPEELDKMSSVVNEVAKTHGTVINPVFITCDPARDRVPYVAEY 122

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           +  F  R+IG++G    + +  K++R+Y +            Y VDH+    L D  G  
Sbjct: 123 IADFHPRMIGLTGTYDAIKQACKSYRVYFSTPPGADPTS--DYLVDHSIFFYLMDPEGKF 180

Query: 174 VGVIPYKDDSDSAIEKINRLITY 196
           +         +   +K+   I  
Sbjct: 181 IDAFGKSSTMEEVRDKVLDYIAR 203


>gi|159045971|ref|YP_001534765.1| regulatory protein SenC [Dinoroseobacter shibae DFL 12]
 gi|157913731|gb|ABV95164.1| regulatory protein SenC [Dinoroseobacter shibae DFL 12]
          Length = 206

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/206 (24%), Positives = 89/206 (43%), Gaps = 16/206 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKF------------VDGNRRFNSDVHLVAQDGTD 48
           MK  G     ++ A++G   Y++F +                G+        LV++ G  
Sbjct: 1   MKLYGATAIALVTAMIGGTVYMAFFNSPDDPLAQCRGGVVATGSASIGGPFELVSETGET 60

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPE 108
            + + +  +PS+V+FG+T C  VCP  ++R    +  +   G  +   FI+VDP RDTPE
Sbjct: 61  VTEAEVLTRPSLVYFGYTFCPDVCPMDVARNAEAVDLLQERGYDVQPVFISVDPDRDTPE 120

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
           V++ F       ++G++G    V   ++ ++ Y       + G EE Y VDH+T   L  
Sbjct: 121 VVEWFTDAMHPDMLGLTGSLEQVAAASRAYKTYYRK----QEGDEEYYLVDHSTFTYLML 176

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLI 194
                      +D      E++   +
Sbjct: 177 PGSGFADFFRREDSPMQMAERVACFL 202


>gi|62290309|ref|YP_222102.1| SCO1/SenC family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700233|ref|YP_414807.1| electron transport protein SCO1/SenC [Brucella melitensis biovar
           Abortus 2308]
 gi|189024543|ref|YP_001935311.1| Electron transport protein SCO1/SenC [Brucella abortus S19]
 gi|237815816|ref|ZP_04594813.1| SCO1/SenC family protein [Brucella abortus str. 2308 A]
 gi|254689611|ref|ZP_05152865.1| Electron transport protein SCO1/SenC [Brucella abortus bv. 6 str.
           870]
 gi|254697753|ref|ZP_05159581.1| Electron transport protein SCO1/SenC [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730642|ref|ZP_05189220.1| Electron transport protein SCO1/SenC [Brucella abortus bv. 4 str.
           292]
 gi|256257860|ref|ZP_05463396.1| Electron transport protein SCO1/SenC [Brucella abortus bv. 9 str.
           C68]
 gi|260546852|ref|ZP_05822591.1| electron transporter SCO1/SenC [Brucella abortus NCTC 8038]
 gi|260755138|ref|ZP_05867486.1| electron transporter SCO1/SenC [Brucella abortus bv. 6 str. 870]
 gi|260758357|ref|ZP_05870705.1| electron transporter SCO1/SenC [Brucella abortus bv. 4 str. 292]
 gi|260762183|ref|ZP_05874526.1| electron transporter SCO1/SenC [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884150|ref|ZP_05895764.1| electron transporter SCO1/SenC [Brucella abortus bv. 9 str. C68]
 gi|297248696|ref|ZP_06932414.1| electron transporter [Brucella abortus bv. 5 str. B3196]
 gi|62196441|gb|AAX74741.1| SCO1/SenC family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616334|emb|CAJ11391.1| Electron transport protein SCO1/SenC [Brucella melitensis biovar
           Abortus 2308]
 gi|189020115|gb|ACD72837.1| Electron transport protein SCO1/SenC [Brucella abortus S19]
 gi|237789114|gb|EEP63325.1| SCO1/SenC family protein [Brucella abortus str. 2308 A]
 gi|260095902|gb|EEW79779.1| electron transporter SCO1/SenC [Brucella abortus NCTC 8038]
 gi|260668675|gb|EEX55615.1| electron transporter SCO1/SenC [Brucella abortus bv. 4 str. 292]
 gi|260672615|gb|EEX59436.1| electron transporter SCO1/SenC [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675246|gb|EEX62067.1| electron transporter SCO1/SenC [Brucella abortus bv. 6 str. 870]
 gi|260873678|gb|EEX80747.1| electron transporter SCO1/SenC [Brucella abortus bv. 9 str. C68]
 gi|297175865|gb|EFH35212.1| electron transporter [Brucella abortus bv. 5 str. B3196]
          Length = 195

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 73/193 (37%), Positives = 105/193 (54%), Gaps = 5/193 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    I   + + V+   A  +F          F    +LV  DG  FS   L   P++
Sbjct: 1   MKKFLPIFIVVFIIVIIGAAGFNFVRDKQAAKEPFGGSFNLVTMDG-AFSEKDLRATPAV 59

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  LD  LKQ+ P    + AYF+TVDP+RDT +VM  +V   +DR
Sbjct: 60  VFFGFTHCPDVCPTTLYELDGWLKQLGPEAGDIKAYFVTVDPERDTQDVMNTYVSNVTDR 119

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+GI+G P ++  + K++ +Y   V  E       Y +DHT ++ L D  G   G I Y+
Sbjct: 120 IMGITGTPDNIAEMVKSYHVYARKVPIED----GDYTMDHTASIFLLDKGGRFRGTIAYQ 175

Query: 181 DDSDSAIEKINRL 193
           ++ D+A+EK+  L
Sbjct: 176 ENPDTALEKLKNL 188


>gi|332107470|gb|EGJ08694.1| electron transport protein sco1/senc [Rubrivivax benzoatilyticus
           JA2]
          Length = 203

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/173 (30%), Positives = 84/173 (48%), Gaps = 4/173 (2%)

Query: 24  FSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLL 83
           F    + G   +  +++L   DG   SL     K ++VFFG+T C  VCPTT+  L  + 
Sbjct: 32  FDGVDITG-ADYAKELNLPDADGRRRSLQDFRGKVTVVFFGYTQCPDVCPTTMVELAEVK 90

Query: 84  KQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVN 143
           +Q+ P G  +   F++VDP+RDTPE++K +V  F    + + G P +    AK F+++ N
Sbjct: 91  RQLGPDGERIQGVFVSVDPERDTPEMLKAYVANFDPGFVALRGTPEETKAAAKQFKVFYN 150

Query: 144 NVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            V  +       Y +DHT    +FDT G +     Y    D     +  L+  
Sbjct: 151 KVAGQ---TPTSYTIDHTAGSYVFDTQGRVRVFTRYGAGIDKLRHDLKILLDE 200


>gi|149759315|ref|XP_001490396.1| PREDICTED: similar to cytochrome oxidase deficient homolog 2 [Equus
           caballus]
          Length = 266

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 94/205 (45%), Gaps = 15/205 (7%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF----------NSDVHLVAQDGTDFSLS 52
              +++  +  A LG     + + K     +R             D  L+   G     +
Sbjct: 58  RTRLLITALFGAGLGGAWLAARAKKEQWRQQRRTEALRQAAVGQGDFSLLDHRGQARCKA 117

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVM 110
               +  +++FGFT+C  +CP  L +L ++++  + +P   L+   FITVDP+RD+ E M
Sbjct: 118 DFRGQWVLMYFGFTHCPDICPDELEKLVQVVQQLEAEPGLPLVQPIFITVDPERDSVEAM 177

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            ++VQ F  R++G++G    + + + N+R+Y +    ++   ++ Y VDH+ A+ L +  
Sbjct: 178 ARYVQDFHPRLLGLTGSAEQIAQASHNYRVYYSAGPKDE---DQDYIVDHSIAIYLLNPD 234

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G           ++   + +   + 
Sbjct: 235 GLFTDYYGRARSAEQIADSVRHHMA 259


>gi|154331958|ref|XP_001561796.1| cytochrome c oxidase assembly factor [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134059116|emb|CAM41591.1| putative cytochrome c oxidase assembly factor [Leishmania
           braziliensis MHOM/BR/75/M2904]
          Length = 298

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 86/211 (40%), Gaps = 16/211 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGT 47
           +K  G + G  LL +         + +                G         LV   G 
Sbjct: 79  LKKYGALGGFALLCIATLWYGSRQAKQRYFGAEGSARVSVETRGRPALGGPFVLVNTKGY 138

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRD 105
             S +      +  +FGFT+C  +CP  L+R+  ++  V            F++ DP+RD
Sbjct: 139 PMSQAEFLGSWAFFYFGFTHCPEICPVELNRMSHVVDAVHAARPQERIAPLFVSCDPRRD 198

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALL 165
           + E + +++  F    IG+ G P  V    +++RIY + +  E+   +E Y +DH+ A+ 
Sbjct: 199 SLEAIDEYLSVFHPDFIGLVGTPKQVNDACRSYRIYYS-IPTEEDTQQEDYLIDHSIAIF 257

Query: 166 LFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           LFD  G  V     + D     EK+   ++ 
Sbjct: 258 LFDPQGRFVDFFGNRYDEREITEKVLHYMSE 288


>gi|188991734|ref|YP_001903744.1| putative copper chaperone [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167733494|emb|CAP51697.1| putative copper chaperone [Xanthomonas campestris pv. campestris]
          Length = 203

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/199 (26%), Positives = 93/199 (46%), Gaps = 9/199 (4%)

Query: 1   MKALGI----ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           +K LGI    +     +A  G  A     +     +     D +L   +GT   L S   
Sbjct: 8   LKRLGIRGIVLGMACAIAGCGQWASSFSPTGTDLSSMGRGVDFYLKDTEGTPRPLRSFRG 67

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           K  ++FFGFTNC  VCPTTL+R  ++ + +      +   F T+DP+RD P V++ +V+ 
Sbjct: 68  KVLVLFFGFTNCPDVCPTTLARAAQVKRALGADAAQVQFAFATLDPQRDVPNVLRTYVKA 127

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F    IG++G   ++   A N ++    V   K+     Y +DH+T   +FD  G +   
Sbjct: 128 FDPDFIGLTGSEGEIRVAADNLKVVYAKVPMGKT-----YTIDHSTRSFVFDREGKLRVG 182

Query: 177 IPYKDDSDSAIEKINRLIT 195
           + ++   ++    I +++ 
Sbjct: 183 LTHEQTVETVAADIRQVLA 201


>gi|331247143|ref|XP_003336201.1| h-sco1 [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|309315191|gb|EFP91782.1| h-sco1 [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 300

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 20/208 (9%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD--------------GNRRFNSDVHLVA-QDGTDFSL 51
           ++   L    G   Y  F ++ +               G  +      LV  QDG  F+ 
Sbjct: 83  VVSLALFIATGVGIYFYFKNEKLRVEEKKREERASKSVGKVKIGGPFELVNAQDGKPFTE 142

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK---QVDPTGTLLNAYFITVDPKRDTPE 108
             L  K S+++FGFTNC  +CP  L ++  ++    +       +   FI+VDP RDTPE
Sbjct: 143 KDLLGKFSLIYFGFTNCPDICPEELDKMCAVINRIAEDKNIKIPIQPIFISVDPNRDTPE 202

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            + K+++ F  ++IG++GD   + ++ K +R+Y +          E Y VDH+    L  
Sbjct: 203 AISKYLEEFDHKMIGLTGDYDSIKKMCKVYRVYFSTPP--NVKPGEDYLVDHSIFFYLMA 260

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G+ V         D    K++  +T 
Sbjct: 261 PNGNFVDAFGKIFSKDEVYTKVHSYMTE 288


>gi|260177177|gb|ACX33901.1| putative electron transport protein SCO1/SenC [uncultured
           prokaryote AT3]
          Length = 191

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 83/191 (43%), Gaps = 7/191 (3%)

Query: 7   ILGTILLAVLGSIAY---VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           +L   L++ +         +F  + V G   +  D  L    G   +      K  ++FF
Sbjct: 1   MLALCLVSGIAIGVEKVVPAFHGQDVTG-ADYGRDFRLQDASGQWRTPKDYRGKLVLMFF 59

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           GFT C  VCPT L  + RL+  +      +   F+T+DP RDT  +++ +V  F+   +G
Sbjct: 60  GFTQCPDVCPTELQSMARLMDALGKDAARIQVLFVTLDPARDTAAMIQSYVSAFNPGFVG 119

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           + GD      VAK F++Y   V         +Y +DH+  + + D  G +   I      
Sbjct: 120 LRGDEAATATVAKEFKVYYRKVPG---SAPGRYSLDHSAFIYVLDGNGVLRLRITPDLGI 176

Query: 184 DSAIEKINRLI 194
           ++    + RL+
Sbjct: 177 EAMKSDLLRLL 187


>gi|289548694|ref|YP_003473682.1| electron transporter SCO1/SenC [Thermocrinis albus DSM 14484]
 gi|289182311|gb|ADC89555.1| electron transport protein SCO1/SenC [Thermocrinis albus DSM 14484]
          Length = 194

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/199 (26%), Positives = 88/199 (44%), Gaps = 10/199 (5%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL--YIKP 58
           M++L + +  +L  ++ S         ++     +  D  L +QDG    LS        
Sbjct: 1   MRSL-LAVWIVLALLVSSCKKEHKFYGYLYDKPAY--DFELTSQDGNRVRLSQFLKDGGV 57

Query: 59  SIVFFGFTNCSAVCPTT-LSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
            ++FFG+T+C  VCPT   +    +    +     +   F++VDP+RDTP V+K +V  F
Sbjct: 58  VLLFFGYTHCPDVCPTALSTMAKVMKNLSEKEREKVKVLFVSVDPERDTPAVLKNYVPFF 117

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
               +G++G P ++ +VAK + +Y   V   K      Y VDHT  + L      I  + 
Sbjct: 118 YPTFVGLTGTPDEIAKVAKEYNVYYRKV---KEETAAGYLVDHTATIYLITPDMKIKLLY 174

Query: 178 PYK-DDSDSAIEKINRLIT 195
                D     E I  L++
Sbjct: 175 TTNRQDPQKIAEDIRYLLS 193


>gi|156074025|gb|ABU46288.1| mitochondrial SCO1p [Paracoccidioides brasiliensis]
          Length = 304

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 89/205 (43%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +   +  I Y  +  + ++           G  +      L   DG +F+   
Sbjct: 88  WKAAVLFVATGVTMIFYFRYEKERLNRKRIAEMSKGVGRPKVGGPFVLKDLDGNEFTDEQ 147

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S ++FGFT+C  +CP  L ++  ++  V    +  +     FIT DP RD+PEV+
Sbjct: 148 LKGKYSFIYFGFTHCPDICPDELDKMAEIIDLVKSRSSNKSVLRPIFITCDPARDSPEVL 207

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +K++  F   IIG++G    V  V K +R+Y +    E     E Y VDH+    L D  
Sbjct: 208 RKYLAEFHKGIIGLTGTYEQVKHVCKQYRVYFST--PENVKPGEDYLVDHSIYFYLMDPD 265

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  +  I  +D +++A   I   I 
Sbjct: 266 GDFIECIGRQDTAETAANTILAHIK 290


>gi|254694101|ref|ZP_05155929.1| Electron transport protein SCO1/SenC [Brucella abortus bv. 3 str.
           Tulya]
 gi|261214399|ref|ZP_05928680.1| electron transporter SCO1/SenC [Brucella abortus bv. 3 str. Tulya]
 gi|260916006|gb|EEX82867.1| electron transporter SCO1/SenC [Brucella abortus bv. 3 str. Tulya]
          Length = 195

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 72/193 (37%), Positives = 105/193 (54%), Gaps = 5/193 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    I   + + V+   A  +F          F    +LV  DG  FS   L   P++
Sbjct: 1   MKKFLPIFIVVFIIVIIGAAGFNFVRDKQAAKEPFGGSFNLVTMDG-AFSEKDLRATPAV 59

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  LD  LK++ P    + AYF+TVDP+RDT +VM  +V   +DR
Sbjct: 60  VFFGFTHCPDVCPTTLYELDGWLKRLGPEAGDIKAYFVTVDPERDTQDVMNTYVSNVTDR 119

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+GI+G P ++  + K++ +Y   V  E       Y +DHT ++ L D  G   G I Y+
Sbjct: 120 IMGITGTPDNIAEMVKSYHVYARKVPIED----GDYTMDHTASIFLLDKGGRFRGTIAYQ 175

Query: 181 DDSDSAIEKINRL 193
           ++ D+A+EK+  L
Sbjct: 176 ENPDTALEKLKNL 188


>gi|261331408|emb|CBH14402.1| cytochrome c oxidase assembly factor, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 271

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 89/205 (43%), Gaps = 16/205 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGN-------------RRFNSDVHLVAQDGT 47
           ++   +  G  +L           + K   G+                     LV  DG 
Sbjct: 52  LRKYSVFAGMTVLCAATLWYGSEKAKKRYFGSQGSARVSVETRGRPALGGPFVLVNTDGE 111

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRD 105
             S +      +  +FGFT+C  +CP  L+R+ +++   +       +   F++ DP+RD
Sbjct: 112 PVSQAEFLGSWAFFYFGFTHCPEICPVELNRMSKVIDAVRTKRPNQKIVPLFVSCDPRRD 171

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALL 165
           + E + +++  F +  +G+ G P  V    K++RIY + + +E++  +  Y +DH+ A+ 
Sbjct: 172 SLEAIAEYLSVFHESFVGLVGTPKQVSDACKSYRIYYS-LPSEEAAEQNDYLIDHSIAIF 230

Query: 166 LFDTAGSIVGVIPYKDDSDSAIEKI 190
           LFD  G  V     + D +   E++
Sbjct: 231 LFDPKGRFVDFFGSRYDENEITERV 255


>gi|149235279|ref|XP_001523518.1| protein SCO1, mitochondrial precursor [Lodderomyces elongisporus
           NRRL YB-4239]
 gi|146452927|gb|EDK47183.1| protein SCO1, mitochondrial precursor [Lodderomyces elongisporus
           NRRL YB-4239]
          Length = 307

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 52/199 (26%), Positives = 88/199 (44%), Gaps = 20/199 (10%)

Query: 9   GTILLAVLGSIAYVSFSS-------------KFVDGNRRFNSDVHLVAQDGTDFSLSSLY 55
             +LL ++G +    F +                 G         L   +G  F+  +L 
Sbjct: 86  AVVLLMLVGGVGTYFFQNEKARLHQAREMEQNRKIGKPLIGGAFTLEDTNGEKFTQENLI 145

Query: 56  I----KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
                + SI++FGFT+C  VCP  L +L  +L  +      +   FIT DP RD+ E++ 
Sbjct: 146 DPNEKRFSILYFGFTHCPDVCPEELDKLGEMLDILQKNNVEMQPVFITCDPARDSKEMLA 205

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            +++ F + IIG++G    V    K +R+Y    L  +    + Y VDH+    + D  G
Sbjct: 206 AYLKDFHEGIIGLTGTYEQVKNTCKKYRVYF---LTPEHAPGQDYLVDHSIFFYVLDPEG 262

Query: 172 SIVGVIPYKDDSDSAIEKI 190
           + V VI  + ++  + EKI
Sbjct: 263 NFVDVIGREANAADSAEKI 281


>gi|226289323|gb|EEH44835.1| mitochondrial metallochaperone Sco1 [Paracoccidioides brasiliensis
           Pb18]
          Length = 316

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 89/205 (43%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +   +  I Y  +  + ++           G  +      L   DG +F+   
Sbjct: 100 WKAAVLFVATGVTMIFYFRYEKERLNRKRIAEMSKGVGRPKVGGPFVLKDLDGNEFTDEQ 159

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA---YFITVDPKRDTPEVM 110
           L  K S ++FGFT+C  +CP  L ++  ++  V    +  +     FIT DP RD+PEV+
Sbjct: 160 LKGKYSFIYFGFTHCPDICPDELDKMAEIIDLVKSRSSNKSVLRPIFITCDPARDSPEVL 219

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +K++  F   IIG++G    V  V K +R+Y +    E     E Y VDH+    L D  
Sbjct: 220 RKYLAEFHKGIIGLTGTYEQVKHVCKQYRVYFST--PENVKPGEDYLVDHSIYFYLMDPD 277

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  +  I  +D +++A   I   I 
Sbjct: 278 GDFIECIGRQDTAETAANTILAHIK 302


>gi|255582652|ref|XP_002532105.1| Protein sco1, putative [Ricinus communis]
 gi|223528208|gb|EEF30267.1| Protein sco1, putative [Ricinus communis]
          Length = 292

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/175 (25%), Positives = 83/175 (47%), Gaps = 5/175 (2%)

Query: 23  SFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRL 82
           +       G        +L+  DG + +      K +I++FGFT+C  +CP  L +L   
Sbjct: 117 AVKEGPSAGKAAIGGPFNLINHDGKNVTEKDFMGKWTILYFGFTHCPDICPDELQKLVAA 176

Query: 83  LKQVDPTGTLLNA-YFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           + ++     L     FI+VDP+RDT E ++++VQ F  +++G++G+P ++ + A+ +R+Y
Sbjct: 177 IDKIKEKAGLEVVPVFISVDPERDTVEQVREYVQEFHPKLVGLTGNPEEIKKAARAYRVY 236

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
                 E       Y VDH+  + L       V      +D DS  + + + I  
Sbjct: 237 YMKTTEED----SDYLVDHSIVMYLMGPNMDYVKFFGKNNDVDSLTDGVIKEIKQ 287


>gi|225439390|ref|XP_002263427.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|296083175|emb|CBI22811.3| unnamed protein product [Vitis vinifera]
          Length = 302

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/209 (22%), Positives = 87/209 (41%), Gaps = 21/209 (10%)

Query: 5   GIILGTILLAVLGSIAYVSFSSK----------------FVDGNRRFNSDVHLVAQDGTD 48
            +    ++    G + Y     K                   G        +L+  +G +
Sbjct: 95  WLSFLLLIFTGAGLVFYYDNEKKRHIEEINASSTAVKEGPSAGKAAIGGPFNLINDEGKN 154

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTP 107
            +    + K ++++FGFT+C  +CP  L ++   + ++    G  +   FI+VDP+RDT 
Sbjct: 155 VTEKDFFGKWTLIYFGFTHCPDICPDELIKVADAVDKIKAKIGVDIVPVFISVDPERDTV 214

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E + ++V+ F   +IG++G+P +V + A+ +R+Y      E       Y VDH+  + L 
Sbjct: 215 EQVHEYVKEFHPNLIGLTGNPDEVRKAARAYRVYYMKTEEE----GSDYLVDHSIMMYLM 270

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITY 196
                 V      +D DS    I   +  
Sbjct: 271 GPKMDFVKNFGKNNDVDSLANGIMEAMKK 299


>gi|269925633|ref|YP_003322256.1| electron transport protein SCO1/SenC [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789293|gb|ACZ41434.1| electron transport protein SCO1/SenC [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 219

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/171 (25%), Positives = 87/171 (50%), Gaps = 4/171 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
                        +  L + +G + SL  L  K  ++FFG+T+C  +CPTTL++  ++ +
Sbjct: 53  GEGTRIDPPAPLKNFTLPSSNGGELSLHDLRGKYVLLFFGYTHCPDLCPTTLAQFRQIKQ 112

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
           Q+      ++  F++VDP RDTP V++++V+ F    IG+SGD   +  +  ++ +Y   
Sbjct: 113 QLGSKAKDVSFVFVSVDPDRDTPAVLRRYVRSFDPSFIGLSGDHKVLDAIKSDYGLYYQL 172

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                      Y V+H++++ L D  G ++ V  Y  +++     + R+++
Sbjct: 173 ----NKDEGANYTVNHSSSIYLIDPDGRLIMVYSYGTNTEVITRDLERMLS 219


>gi|255083689|ref|XP_002508419.1| predicted protein [Micromonas sp. RCC299]
 gi|226523696|gb|ACO69677.1| predicted protein [Micromonas sp. RCC299]
          Length = 274

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/201 (21%), Positives = 84/201 (41%), Gaps = 15/201 (7%)

Query: 8   LGTILLAVLGSIAYV---------SFSSKFVDGNRRFNSDV---HLVAQDGTDFSLSSLY 55
           L  +     G + +          S  +    G            L  ++G  +    L 
Sbjct: 74  LAAMCATGGGLLWWYDAERRRRLESIRAGPSSGKASIGGAFGNMKLANENGRAWRTDELK 133

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
            K ++++FGFT C  +CP  L ++   +  V+  G  +   F+++DP+RD+   +K++V+
Sbjct: 134 GKFALLYFGFTMCPDICPDELEKMAECVDLVEKAGKSIVPVFVSIDPERDSVRRVKEYVK 193

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F  +++G++G        AK +R+Y +    E     + Y VDH+  + L D AG  V 
Sbjct: 194 EFHPKLLGVTGSVEACKAAAKQYRVYYHKTGDED---GDDYLVDHSIIMYLVDPAGEFVT 250

Query: 176 VIPYKDDSDSAIEKINRLITY 196
                 ++    E I   +  
Sbjct: 251 FYGKNYEAAPMAEAILEQMKR 271


>gi|71745126|ref|XP_827193.1| cytochrome c oxidase assembly factor [Trypanosoma brucei TREU927]
 gi|70831358|gb|EAN76863.1| cytochrome c oxidase assembly factor, putative [Trypanosoma brucei]
          Length = 271

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 88/205 (42%), Gaps = 16/205 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGN-------------RRFNSDVHLVAQDGT 47
           ++   +  G  +L           + K   G+                     LV  DG 
Sbjct: 52  LRKYSVFAGMTVLCAATLWYGSEKAKKRYFGSQGSARVSVETRGRPALGGPFVLVNTDGE 111

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAY--FITVDPKRD 105
             S +      +  +FGFT+C  +CP  L+R+ +++  V            F++ DP+RD
Sbjct: 112 PVSQAEFLGSWAFFYFGFTHCPEICPVELNRMSKVIDAVRAKRPNQKIVPLFVSCDPRRD 171

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALL 165
           + E + +++  F +  +G+ G P  V    K++RIY + + +E++  +  Y +DH+ A+ 
Sbjct: 172 SLEAIAEYLSVFHESFVGLVGTPKQVSDACKSYRIYYS-LPSEEAAEQNDYLIDHSIAIF 230

Query: 166 LFDTAGSIVGVIPYKDDSDSAIEKI 190
           LFD  G  V     + D +   E++
Sbjct: 231 LFDPKGRFVDFFGSRYDENEITERV 255


>gi|315497268|ref|YP_004086072.1| electron transport protein sco1/senc [Asticcacaulis excentricus CB
           48]
 gi|315415280|gb|ADU11921.1| electron transport protein SCO1/SenC [Asticcacaulis excentricus CB
           48]
          Length = 203

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 58/206 (28%), Positives = 93/206 (45%), Gaps = 16/206 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSS---------KFVDGNRRFNSDVHLVAQDGTDFSL 51
           M    + +  +L+  LG++A   +SS         + +D          L  Q G   + 
Sbjct: 1   MNRTRLTIIAVLVIGLGALAVAMWSSMLGQKPVASRSIDSAYSIGGPFALTDQYGKPQTE 60

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
           + L  K + VFFGFT C  +CP TL  LD+  KQ+   G  L   FITVDP+RDTP VMK
Sbjct: 61  AILKGKWTAVFFGFTYCPDICPLTLQSLDQTRKQLGKDGDNLQFVFITVDPERDTPGVMK 120

Query: 112 KFVQ--RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
            ++    F   +IG++G P  +   A+ +R           G  + Y + HT+ + L + 
Sbjct: 121 AYLDSGGFPKGVIGLTGTPEQIAAAARAYRATYKK-----EGEGKDYTMSHTSVVYLMNP 175

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLIT 195
            G     + +    + A E + + + 
Sbjct: 176 RGEFAEPLAHGLPPEKAAEVVRQAMK 201


>gi|73968827|ref|XP_538308.2| PREDICTED: similar to cytochrome oxidase deficient homolog 2 [Canis
           familiaris]
          Length = 390

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 90/205 (43%), Gaps = 15/205 (7%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF----------NSDVHLVAQDGTDFSLS 52
              +++  +  A LG     +   K     +R             D  L+   G     +
Sbjct: 182 RTRLLVTALFGAGLGGAWLAARKEKEQRQQQRRTEALRQAAVGQGDFSLLDHRGHTRCKA 241

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVM 110
               +  +++FGFT+C  +CP  L +L ++++  + +P    +   FITVDP+RDT   M
Sbjct: 242 DFRGQWVLLYFGFTHCPDICPDELEKLVQVVRDLEAEPGLPPVQPVFITVDPERDTVAAM 301

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            ++VQ F  R++G++G    V +V++++R+Y      ++   ++ Y VDH+ A+ L    
Sbjct: 302 ARYVQDFHPRLLGLTGSAEQVAQVSRSYRVYYRAGPKDE---DQDYIVDHSIAIYLLSPD 358

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G           +      + R + 
Sbjct: 359 GLFTDYYGRAASAQQIANSVRRHMA 383


>gi|195472831|ref|XP_002088702.1| GE18713 [Drosophila yakuba]
 gi|194174803|gb|EDW88414.1| GE18713 [Drosophila yakuba]
          Length = 251

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 93/205 (45%), Gaps = 14/205 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD--------GNRRFNSDVHLVAQDGTDFSLSS 53
           K+L +I G +    +G + YV    +           G         LV   G       
Sbjct: 40  KSLAVI-GALGAGGVGFMLYVKSEKEEARMKERQRQLGKAAIGGSWELVDSQGAVRKSED 98

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL--NAYFITVDPKRDTPEVMK 111
              K  +++FGFT+C  +CP  L ++  ++ +V+ +         FITVDP+RD+ EV+ 
Sbjct: 99  FLGKWLLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAVQPIFITVDPERDSKEVVA 158

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
           K+V+ FS +++G++G    + +V K FR+Y +    ++   +  Y VDHT  + L +  G
Sbjct: 159 KYVKEFSPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDE---DNDYIVDHTIIMYLVNPDG 215

Query: 172 SIVGVIPYKDDSDSAIEKINRLITY 196
             V     K D D  +  I   I  
Sbjct: 216 EFVDYYGQKLDKDQCVASILVNIAK 240


>gi|89094187|ref|ZP_01167129.1| Electron transport protein [Oceanospirillum sp. MED92]
 gi|89081442|gb|EAR60672.1| Electron transport protein [Oceanospirillum sp. MED92]
          Length = 196

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/199 (22%), Positives = 85/199 (42%), Gaps = 8/199 (4%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGN----RRFNSDVHLVAQDGTDFSLSSLYI 56
           MKAL  +L   L+ ++G         + V+       +   D  L +Q G    L     
Sbjct: 1   MKALRNLLLLTLMMLIGVAVAFYLRPQPVEQRIALGEKLGGDFTLQSQHGE-LKLEDYRG 59

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRL-LKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
           K  + F G+ +C  +CPT L+   +   +  +     ++  F++VDP RD+ E + K+  
Sbjct: 60  KVVLFFIGYASCPDICPTALAVASQGLHELNEAEQNQVSGIFMSVDPDRDSTEKLAKYAG 119

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F     G + D   + +V K +  +   V  + S +   Y VDH++ L + D  G++  
Sbjct: 120 FFHPNFTGATADRETIDKVVKQYGAFYRMVDMDNSAMG--YAVDHSSRLYVIDKEGNLAK 177

Query: 176 VIPYKDDSDSAIEKINRLI 194
            + +  +      +I  L+
Sbjct: 178 ALVHATNPKELAAEIRNLL 196


>gi|83952897|ref|ZP_00961626.1| SCO1/2 family protein [Roseovarius nubinhibens ISM]
 gi|83835688|gb|EAP74988.1| SCO1/2 family protein [Roseovarius nubinhibens ISM]
          Length = 208

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 61/206 (29%), Positives = 91/206 (44%), Gaps = 14/206 (6%)

Query: 1   MKALGII------LGTILLAVLGSIAYVSFSSKFVDGNRRFNS----DVHLVAQDGTDFS 50
           M+   I+      +G + L +      V          +R  +    D  L   +G    
Sbjct: 1   MRRRAILGYGAAGVGAVALMLFVGWWQVDGPGGPEPVGQRPVALTEMDFRLTDHEGNAVG 60

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
             +L  +P++ FFGFT C  VCPTTLS +   L  +      +N  FITVDP+RDT   M
Sbjct: 61  RETLIGRPTMAFFGFTYCPDVCPTTLSDISGWLDDLGDEADKMNVVFITVDPERDTVAAM 120

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            ++V  F   I G +G    + RVA  FR     V  E       Y ++HT ++ LF  +
Sbjct: 121 AEYVSYFHPAIRGWTGPEEQIARVADGFRATYEQVPTE----SGDYTMNHTASVFLFAAS 176

Query: 171 GSIVGVIPYKDDSDSAIEKINRLITY 196
           G  V +I Y +  + A+ KI R +  
Sbjct: 177 GRFVTMIDYHEAREYAVPKIRRALAE 202


>gi|156060859|ref|XP_001596352.1| hypothetical protein SS1G_02572 [Sclerotinia sclerotiorum 1980]
 gi|154699976|gb|EDN99714.1| hypothetical protein SS1G_02572 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 213

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/170 (28%), Positives = 79/170 (46%), Gaps = 8/170 (4%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G  +      LV   G  FS  ++  K S+V+FGFT+C  +CP  L ++ +++  ++ + 
Sbjct: 41  GRPKVGGPFELVDHKGEKFSSENMKGKYSLVYFGFTHCPDICPEELDKMAQMIDLINNSP 100

Query: 91  TLLN------AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
           T  +        FIT DP RDTP V+  ++  F   IIG++G    +  + K +R+Y + 
Sbjct: 101 TRTSSTPSLLPIFITCDPARDTPAVLATYLAEFHPSIIGLTGTWEQIKDICKKYRVYFST 160

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              E     + Y VDH+    L D  G  V  I  +   + A   I   I
Sbjct: 161 --PEGVQKGQDYLVDHSIYFYLMDPEGDFVEAIGRQHSPEQAARIIGEHI 208


>gi|90419252|ref|ZP_01227162.1| putative electron transport protein scoI/senC [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336189|gb|EAS49930.1| putative electron transport protein scoI/senC [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 206

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 54/197 (27%), Positives = 90/197 (45%), Gaps = 10/197 (5%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFV------DGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
            +++  + +     +  +  S +         G      +  LV  +G          +P
Sbjct: 13  AVVVLCLFVGATAGVTIMRASGQAPLPGEASSGIANIGGEFSLVDHEGRRREWRDFRGEP 72

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS 118
             +FFGFTNC  +CPTTL  L  LL  + P G  L    I+ DP+RDTPE + ++++ F 
Sbjct: 73  VALFFGFTNCPDICPTTLGELSVLLDDLGPQGDDLQVLLISGDPERDTPERLNEYLKSFD 132

Query: 119 DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
            +I+G++G   +V      F+ Y   V  E      +Y VDH+  + LFD  GS  G + 
Sbjct: 133 PQIVGLTGTEAEVDEAFSAFKAYRALVPLEN----GEYTVDHSAGVYLFDRDGSFYGTLD 188

Query: 179 YKDDSDSAIEKINRLIT 195
             +  +   +K+ RL+ 
Sbjct: 189 IHESPEVQRQKVERLLA 205


>gi|238028694|ref|YP_002912925.1| hypothetical protein bglu_1g31580 [Burkholderia glumae BGR1]
 gi|237877888|gb|ACR30221.1| Hypothetical protein bglu_1g31580 [Burkholderia glumae BGR1]
          Length = 203

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/174 (27%), Positives = 82/174 (47%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + GN +F  D  L    G   +L+    +  ++ FG+T+C  VCPTTL+ L +
Sbjct: 32  PAFENLDITGNTQFGQDFALPDTTGRTRTLADYKGRAVVLVFGYTHCPDVCPTTLAELAQ 91

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII-GISGDPIDVMRVAKNFRI 140
             +Q+   G  +    +TVDP+RDT  ++ ++V  F    +         + +VAK+FRI
Sbjct: 92  ARQQLGAEGKRVQVLLVTVDPERDTAPLIAQYVAAFDPSFVALRPAGEAQLKQVAKDFRI 151

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           Y      +     + Y +DHT A  +FD AG +   +         +  +  L+
Sbjct: 152 YYAKSPGK---TPDGYTMDHTAASYVFDPAGKLRLFVRDGQGPAPWVHDLRLLL 202


>gi|295661887|ref|XP_002791498.1| mitochondrial metallochaperone Sco1 [Paracoccidioides brasiliensis
           Pb01]
 gi|226280055|gb|EEH35621.1| mitochondrial metallochaperone Sco1 [Paracoccidioides brasiliensis
           Pb01]
          Length = 316

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 88/205 (42%), Gaps = 16/205 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSS 53
                  +   +  I Y S+  + ++           G  +      L   DG  F+   
Sbjct: 100 WKAAILFIATGVTMIFYFSYEKERLNRKRIVEMSKGVGRPKVGGPFVLKDLDGNVFTDEQ 159

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTL---LNAYFITVDPKRDTPEVM 110
           L  K S ++FGFT+C  +CP  L ++  ++  V    +        FIT DP RD+PEV+
Sbjct: 160 LKGKYSFIYFGFTHCPDICPDELDKMAEIIDLVKSRSSNKSVFRPIFITCDPARDSPEVL 219

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +K++  F   IIG++G    V  V K +R+Y +    +     E Y VDH+    L D  
Sbjct: 220 RKYLAEFHKGIIGLTGTYEQVKHVCKQYRVYFST--PDNVKPGEDYLVDHSIYFYLMDPD 277

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G  +  I  +D +++A   I   I 
Sbjct: 278 GDFIECIGRQDTAETAANTILAHIK 302


>gi|261856973|ref|YP_003264256.1| electron transporter SCO1/SenC [Halothiobacillus neapolitanus c2]
 gi|261837442|gb|ACX97209.1| electron transport protein SCO1/SenC [Halothiobacillus neapolitanus
           c2]
          Length = 211

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/194 (25%), Positives = 86/194 (44%), Gaps = 1/194 (0%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           L +IL  +++   G        +             +L  +     +         +++F
Sbjct: 15  LTLILSWLVIFASGCSKQPVHWNATDITGIMAPLTFNLTDEHDRAVTGKDYRGHIVLLYF 74

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           G+T C  VCP TL+RL   L  +      +   F++VDP RDTP V+ K+V+ FS RIIG
Sbjct: 75  GYTFCPDVCPQTLTRLATALNSLGKQADDVQVLFVSVDPNRDTPAVLDKYVRYFSPRIIG 134

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           ++G    +  V K +R+  +            Y V+H+ ++ +FD  G+   +I  ++ S
Sbjct: 135 LTGTQSQLKAVTKRYRVAYS-YGKGYPDKNSYYEVNHSASIYVFDPKGNARLLIDQQETS 193

Query: 184 DSAIEKINRLITYG 197
           D     + +LI   
Sbjct: 194 DQIAADLKQLIFES 207


>gi|311268420|ref|XP_003132044.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Sus scrofa]
          Length = 305

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/201 (24%), Positives = 89/201 (44%), Gaps = 10/201 (4%)

Query: 3   ALGIILGTILLAVL-----GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           A+   +G  LLA +          +    +   G         L    G   +      +
Sbjct: 103 AITFAIGGALLAGMKYLKKEKTEKLEKERQRSIGKPLLGGPFSLTTHTGEPKTDKDYLGQ 162

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
             +++FGFT+C  +CP  L ++ +++ ++D  PT   L   FIT+DP+RDT E +  +V+
Sbjct: 163 WVLIYFGFTHCPDICPEELEKMIQVVDEIDSIPTLPNLTPLFITIDPERDTEEAIANYVK 222

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            FS ++IG++G    + +VA+ FR+Y +    ++   +E Y VDHT  + L    G  + 
Sbjct: 223 EFSPKLIGLTGTKEAIDQVARAFRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGEFID 279

Query: 176 VIPYKDDSDSAIEKINRLITY 196
                  +      I   +  
Sbjct: 280 YFGQNKKNGEIAGSIAAHMRN 300


>gi|73955918|ref|XP_546624.2| PREDICTED: similar to cytochrome oxidase deficient homolog 1 [Canis
           familiaris]
          Length = 394

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/204 (23%), Positives = 90/204 (44%), Gaps = 12/204 (5%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L          + G   +    ++ ++       G         L    G   +    
Sbjct: 189 KSLAFTFAIGGALLAGMKYFKKEKTRKLEKERQRSLGKPLLGGPFSLTTHTGEPKTDRDY 248

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  VCP  L ++ +++ ++D  PT   L   FIT+DP+RDT E +  
Sbjct: 249 VGQWVLIYFGFTHCPDVCPEELEKMIQVVDEIDSIPTLPNLTPLFITIDPERDTKEAIAN 308

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS ++IG++G   ++ +VA+ +R+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 309 YVKEFSPKLIGLTGTKEEIDQVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGQ 365

Query: 173 IVGVIPYKDDSDSAIEKINRLITY 196
            +        +      I   +  
Sbjct: 366 FLDYFGQNKKNAEIAGCIAAHMRE 389


>gi|19920710|ref|NP_608884.1| CG8885 [Drosophila melanogaster]
 gi|195342594|ref|XP_002037885.1| GM18054 [Drosophila sechellia]
 gi|7296911|gb|AAF52184.1| CG8885 [Drosophila melanogaster]
 gi|19527985|gb|AAL90107.1| AT19154p [Drosophila melanogaster]
 gi|194132735|gb|EDW54303.1| GM18054 [Drosophila sechellia]
 gi|220949658|gb|ACL87372.1| CG8885-PA [synthetic construct]
 gi|220958966|gb|ACL92026.1| CG8885-PA [synthetic construct]
          Length = 251

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/200 (25%), Positives = 88/200 (44%), Gaps = 13/200 (6%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD--------GNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           ++G +    +G + YV                G         LV   G          K 
Sbjct: 44  VIGALGAGGVGFMLYVKSEKDEARMKERQRQLGKAAIGGSWELVDSQGAVRKSEDFLGKW 103

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL--NAYFITVDPKRDTPEVMKKFVQR 116
            +++FGFT+C  +CP  L ++  ++ +V+ +         FITVDP+RD+ EV+ K+V+ 
Sbjct: 104 LLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAVQPIFITVDPERDSKEVVAKYVKE 163

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS +++G++G    + +V K FR+Y +    ++   +  Y VDHT  + L +  G  V  
Sbjct: 164 FSPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDE---DNDYIVDHTIIMYLVNPDGEFVDY 220

Query: 177 IPYKDDSDSAIEKINRLITY 196
                D D  +  I   I  
Sbjct: 221 YGQNRDKDQCVASILVNIAK 240


>gi|82701326|ref|YP_410892.1| electron transport protein SCO1/SenC [Nitrosospira multiformis ATCC
           25196]
 gi|82409391|gb|ABB73500.1| Electron transport protein SCO1/SenC [Nitrosospira multiformis ATCC
           25196]
          Length = 205

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/174 (27%), Positives = 83/174 (47%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F S  + G   F  D +L   +G   +L+    +   VFFG+T+C   CP T+  L  
Sbjct: 33  PAFLSTDITG-ADFGKDFNLTDHNGKMRTLADFKGQVVTVFFGYTHCPDACPATMGNLAA 91

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
            +  +    + +   FITVDP+RD PEV+K ++  F+   +G+ GD   + +  K F + 
Sbjct: 92  AMDMLGADASRVQVLFITVDPERDRPEVLKAYLSAFNPSFLGLYGDERAIKKTTKEFNVV 151

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                 ++ G  +   VDH+T   ++DT G +   +     +D     I++L+ 
Sbjct: 152 YQK---QQGGAHQHDSVDHSTGTYIYDTKGKLRLYVSNDKGADVFAHDISQLLK 202


>gi|190345581|gb|EDK37492.2| hypothetical protein PGUG_01590 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 315

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 57/203 (28%), Positives = 94/203 (46%), Gaps = 18/203 (8%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              +L+A+ G + +     K               G         L+  +G  F+ ++L 
Sbjct: 93  AVVLLVALGGGVTWWFAKEKERLRIQKEVESKRGHGKPLIGGPFDLIDTEGNQFTDANLK 152

Query: 56  I---KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPEVMK 111
               K SI++FGFT+C  VCP  L +L  +L+++       L   FIT DP RDTP+++K
Sbjct: 153 NDEKKFSIIYFGFTHCPDVCPDELDKLGEMLEELKNENGIELQPIFITCDPARDTPDIIK 212

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            ++Q F   IIG++G    +    K +R+Y +     K    + Y VDH+    L D+ G
Sbjct: 213 LYLQDFHPSIIGLTGTYEKIKSACKKYRVYFSTPPDVK--PGQDYLVDHSIFFYLMDSEG 270

Query: 172 SIVGVIPYKDDSDSAIEKINRLI 194
             V VI  +  +   +EKI + +
Sbjct: 271 GFVDVIGREATAKEGVEKIKKHV 293


>gi|329115691|ref|ZP_08244413.1| SCO2-like protein [Acetobacter pomorum DM001]
 gi|326695119|gb|EGE46838.1| SCO2-like protein [Acetobacter pomorum DM001]
          Length = 221

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 94/193 (48%), Gaps = 6/193 (3%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K +  ++G I   ++ +    +  +       +      L  ++G   S +    + +++
Sbjct: 27  KTILPVMGIIFALLIAATGLRAVLTSHSHT--QIGGPYALTDENGHVVSQTDFQGRYTLI 84

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           +FG+T+C  VCP TL+ +   L +  P G  +   FI+VDP RDTP V+K+++QRFS RI
Sbjct: 85  YFGYTHCVDVCPLTLATVSAALDEFGPLGQNITPVFISVDPARDTPAVVKEYIQRFSPRI 144

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           +G++G    +  +   F +        ++     Y +DH++ L L D    + G+IP   
Sbjct: 145 VGLTGTEAQLQPIMAAFHVSARY----RTSNGAGYLMDHSSLLYLMDGQNHLAGMIPVDS 200

Query: 182 DSDSAIEKINRLI 194
            +     ++ +L+
Sbjct: 201 SAHHIALELKQLL 213


>gi|260221389|emb|CBA29902.1| hypothetical protein Csp_A14480 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 177

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/175 (28%), Positives = 84/175 (48%), Gaps = 4/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
             F S  + G   +  D  L    G   SL+    K  ++FFGFT C  VCPT++S +  
Sbjct: 6   PKFDSTDITG-ADYAKDFQLKDHGGNMRSLADFRDKIVVIFFGFTQCPDVCPTSMSTMSG 64

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           + + +   G  L   FITVDP+RDTP ++ ++++ F    + +  +P  +  +A +F++Y
Sbjct: 65  VKELLGDLGNRLQVLFITVDPERDTPRLLSEYMRNFDPTFLALRPEPAQLQGLADSFKVY 124

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
              V  +       Y +DH+    +FDT G +     Y  ++      I +L+ Y
Sbjct: 125 YRKVPGK---TPTSYTMDHSAGKYIFDTTGKVRLFSSYGTEAKVIASDIKKLLAY 176


>gi|294789623|ref|ZP_06754857.1| antioxidant, AhpC/TSA family [Simonsiella muelleri ATCC 29453]
 gi|294482424|gb|EFG30117.1| antioxidant, AhpC/TSA family [Simonsiella muelleri ATCC 29453]
          Length = 219

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 54/222 (24%), Positives = 92/222 (41%), Gaps = 29/222 (13%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRR------------------------FN 36
           M+   +++G   + +       + S      +                            
Sbjct: 1   MQIRLLLIGATAILLAACQESTTQSPTNNTPSAPAASNTIASASSSGSLKSVDIRKDDIG 60

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAY 96
            D  L   +G  FSLSSL  K  I+ FGFTNC  VCPT L      +KQ+   G  +   
Sbjct: 61  GDFTLTDGNGKPFSLSSLKGKVVILSFGFTNCPDVCPTELFTYSEAIKQLGEQGKDVAVV 120

Query: 97  FITVDPKRDTPEVMKKFVQRFSDRIIGISGDP--IDVMRVAKNFRIYVNNVLAEKSGVEE 154
           F++VDP+RDTP+++ ++ ++F+   IG++      D+  V + +RI       +    + 
Sbjct: 121 FVSVDPERDTPDLIGRYTKQFNPNFIGLTDTNQGADIAVVKQQYRIVSAKTEVK---SDT 177

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            Y VDH++   L D  G     +PY  +S      + +L+  
Sbjct: 178 LYNVDHSSGAYLIDKKGEAALFVPYGTESPQIAADVKKLLDE 219


>gi|163782661|ref|ZP_02177658.1| hypothetical protein HG1285_17295 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882234|gb|EDP75741.1| hypothetical protein HG1285_17295 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 194

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/199 (25%), Positives = 88/199 (44%), Gaps = 10/199 (5%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLV---AQDGTDFSLSSLYIK 57
           M+ALG++    ++    +          +        +  L            LS    K
Sbjct: 1   MRALGLVFTIFVMLFSVACEKKEEFHGTLYDKP--AKEFCLTGWKDGKEKKVCLSDFKGK 58

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
             ++FFG+T+C  VCP  L  L + +    +     +   FI+VDP+RDTPE  +K+ + 
Sbjct: 59  VVLLFFGYTHCPDVCPAALQVLAKTMNLIPEEKREKVQVIFISVDPERDTPEKAQKYTEY 118

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F    IG++G P ++ +VAK++  +   V +E    +  Y VDHT  + L D  G++  +
Sbjct: 119 FYPTFIGVTGSPEEIKKVAKDYMAFYKKVESE---SKTGYLVDHTAYIYLIDPEGNLKLL 175

Query: 177 IPYK-DDSDSAIEKINRLI 194
            P      +   E I + +
Sbjct: 176 YPSTRQKPELMAEDIEKFL 194


>gi|317403861|gb|EFV84335.1| electron transporter SCO1/SenC [Achromobacter xylosoxidans C54]
          Length = 205

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 41/158 (25%), Positives = 74/158 (46%), Gaps = 5/158 (3%)

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAY 96
            D  L   +G    L+    K  ++FFGFT C  +CPT L+R   +   +      L   
Sbjct: 53  GDFQLKDTEGRQRQLADYRGKTVMLFFGFTQCPDICPTALTRALEIKSLLGADAAKLQVL 112

Query: 97  FITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           FITVDP+RDTPE+++ +++ F    +G+ GD       A++F+++   V          Y
Sbjct: 113 FITVDPERDTPEILQAYMRAFDPAFVGLRGDAEQTRAAAQSFKVFYQKVP-----TGSSY 167

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            +DHT    + D  G +   + ++  ++     +  ++
Sbjct: 168 TMDHTALTYIIDAQGKLRLALRHQQSAEECAADLRTVL 205


>gi|115754589|ref|XP_797763.2| PREDICTED: similar to SCO cytochrome oxidase deficient homolog 1
           (yeast) [Strongylocentrotus purpuratus]
 gi|115939390|ref|XP_001185698.1| PREDICTED: similar to SCO cytochrome oxidase deficient homolog 1
           (yeast) [Strongylocentrotus purpuratus]
          Length = 313

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/203 (21%), Positives = 84/203 (41%), Gaps = 18/203 (8%)

Query: 9   GTILLAVLGSIAYVSFSS-------------KFVDGNRRFNSDVHLVAQDGTDFSLSSLY 55
              ++A +G  A  +F S                 G         L+   G   +     
Sbjct: 106 SLAVVAGIGGAALYAFKSAKEKKDLQIQAERNKAVGKAAIGGPFDLIDTSGKRKTNKDYL 165

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKF 113
            +  +++FGFT+C  +CP  L ++   + +V+  P    +   FI++DP+RD  E M  +
Sbjct: 166 GQWVLLYFGFTHCPDICPDELEKMILAVNKVNSSPNCDKVVPVFISIDPERDDVETMAAY 225

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           V+ F   ++G++G   ++  V++NFR+Y +    ++   +  Y VDHT  + L    GS 
Sbjct: 226 VKEFDPNLVGLTGSKENIDEVSRNFRVYYSMGPKDE---DNDYIVDHTIIMYLLGPDGSF 282

Query: 174 VGVIPYKDDSDSAIEKINRLITY 196
           +         +     I   +  
Sbjct: 283 IDYYGQNKTDEQVAGGIAAQMRK 305


>gi|115614628|ref|XP_001199811.1| PREDICTED: similar to SCO cytochrome oxidase deficient homolog 1
           (yeast) [Strongylocentrotus purpuratus]
 gi|115620320|ref|XP_001199433.1| PREDICTED: similar to SCO cytochrome oxidase deficient homolog 1
           (yeast) [Strongylocentrotus purpuratus]
          Length = 313

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/203 (21%), Positives = 84/203 (41%), Gaps = 18/203 (8%)

Query: 9   GTILLAVLGSIAYVSFSS-------------KFVDGNRRFNSDVHLVAQDGTDFSLSSLY 55
              ++A +G  A  +F S                 G         L+   G   +     
Sbjct: 106 SLAVVAGIGGAALYAFKSAKEKKDLQIQAERNKAVGKAAIGGPFDLIDTSGKRKTNKDYL 165

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKF 113
            +  +++FGFT+C  +CP  L ++   + +V+  P    +   FI++DP+RD  E M  +
Sbjct: 166 GQWVLLYFGFTHCPDICPDELEKMILAVNKVNSSPNCDKVVPVFISIDPERDDVETMAAY 225

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           V+ F   ++G++G   ++  V++NFR+Y +    ++   +  Y VDHT  + L    GS 
Sbjct: 226 VKEFDPNLVGLTGSKENIDEVSRNFRVYYSMGPKDE---DNDYIVDHTIIMYLLGPDGSF 282

Query: 174 VGVIPYKDDSDSAIEKINRLITY 196
           +         +     I   +  
Sbjct: 283 IDYYGQNKTDEQVAGGIAAQMRK 305


>gi|312081102|ref|XP_003142884.1| hypothetical protein LOAG_07303 [Loa loa]
 gi|307761953|gb|EFO21187.1| hypothetical protein LOAG_07303 [Loa loa]
          Length = 797

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 86/195 (44%), Gaps = 10/195 (5%)

Query: 4   LGIILGTILLAVLGSIAYVSFSS-----KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           + + +  IL+ +L  +            K   G  R      LV  DG       L    
Sbjct: 102 IIVGVSVILVIILSGLREKKMRELESERKKTIGKARIGGTWELVGMDGELGGSEQLKGNW 161

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVMKKFVQR 116
            +++FGFT+C  VCP ++ ++  +++ ++ +   +     FI+VDP+RDT E +K++   
Sbjct: 162 LLLYFGFTHCPDVCPDSIEKMVEVVEILEKSEEKIKVIPVFISVDPERDTIERVKEYCAE 221

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS +I G +G    V +VAK FR+Y +          + Y VDHT  + L D  G+    
Sbjct: 222 FSPKIKGYTGSKEQVAKVAKAFRVYYSQGPKID---GKDYIVDHTVIMYLMDPDGNFHDY 278

Query: 177 IPYKDDSDSAIEKIN 191
                 +    + I 
Sbjct: 279 YGQNRSAQEIAKVIK 293


>gi|195576646|ref|XP_002078186.1| GD22674 [Drosophila simulans]
 gi|194190195|gb|EDX03771.1| GD22674 [Drosophila simulans]
          Length = 251

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 51/200 (25%), Positives = 88/200 (44%), Gaps = 13/200 (6%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD--------GNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           ++G +    +G + YV                G         LV   G          K 
Sbjct: 44  VIGALGAGGVGFMLYVKSEKDEARMKERQRQLGKAAIGGSWELVDSQGAVRKSEDFLGKW 103

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL--NAYFITVDPKRDTPEVMKKFVQR 116
            +++FGFT+C  +CP  L ++  ++ +V+ +         FITVDP+RD+ EV+ K+V+ 
Sbjct: 104 LLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAVQPIFITVDPERDSKEVVAKYVKE 163

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS +++G++G    + +V K FR+Y +    ++   +  Y VDHT  + L +  G  V  
Sbjct: 164 FSPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDE---DNDYIVDHTIIMYLVNPNGEFVDY 220

Query: 177 IPYKDDSDSAIEKINRLITY 196
                D D  +  I   I  
Sbjct: 221 YGQNRDKDQCVASILVNIAK 240


>gi|83942003|ref|ZP_00954465.1| regulatory protein SenC [Sulfitobacter sp. EE-36]
 gi|83847823|gb|EAP85698.1| regulatory protein SenC [Sulfitobacter sp. EE-36]
          Length = 203

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/200 (26%), Positives = 83/200 (41%), Gaps = 14/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIA----------YVSFSSKFVDGNRRFNSDVHLVAQDGTDFS 50
           M A+G +L  +    +  +           Y    +  V G         LV   G   +
Sbjct: 1   MLAIGAVLVVLAFLAVSLMLVYRTDGDSDKYAQCKNSAVAGGAELGGPFELVNAQGQTVT 60

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
            + +  +PS+V+FG+T C  VCP  + R  R + +++  G  +   FI+VDP RDTPEV+
Sbjct: 61  DADVITEPSLVYFGYTFCPDVCPLDVDRNARAVDELEARGMSVTPVFISVDPARDTPEVV 120

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
             F      ++IG++G P  V   +  +R Y      E     E Y VDH+T   L    
Sbjct: 121 GDFAANMHPKMIGLTGSPAQVKAASDAYRTYYKAHEDE----GEDYLVDHSTFSYLVMPG 176

Query: 171 GSIVGVIPYKDDSDSAIEKI 190
              V         +   +K+
Sbjct: 177 EGFVDFFRRDVPPEQLADKV 196


>gi|281208590|gb|EFA82766.1| hypothetical protein PPL_04461 [Polysphondylium pallidum PN500]
          Length = 343

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 84/206 (40%), Gaps = 16/206 (7%)

Query: 3   ALGIILGTILLAVLGSIAYV--------SFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
               ++  +     G + Y                 G+        LV ++G   S    
Sbjct: 114 TFASLMVALFFGGAGWLYYDHLMVQKREKIKQIETYGSSSIGGPFSLVDENGKPISDLDF 173

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG--TLLNAYFITVDPKRDTPEVMKK 112
             K  +++FGFT C   CP  L ++  +L  ++       +   FIT+DP RDT E +  
Sbjct: 174 RGKYILLYFGFTYCPDACPAELDKMTVVLNNLEKYKLLDSIVPVFITIDPWRDTVEQINT 233

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +++ F  +  G++G P  + ++AK++R++++      +G  + Y VDHT    L    G 
Sbjct: 234 YIKEFHPKFRGLTGTPEQITKLAKSYRVFISK-----AGKGDSYLVDHTIIEYLIGPDGK 288

Query: 173 IVGVIPYKDDSDSAI-EKINRLITYG 197
            +        +D    + + R+   G
Sbjct: 289 FIEFYGSNLTADQVTMKVVERMANKG 314


>gi|322816025|gb|EFZ24481.1| cytochrome c oxidase assembly factor, putative [Trypanosoma cruzi]
          Length = 253

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 87/206 (42%), Gaps = 17/206 (8%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD--------------GNRRFNSDVHLVAQDGTDFSLS 52
           +L  + +   G++ Y S  +K                 G         LV  DG   + +
Sbjct: 39  MLAALAVLSAGTLWYGSRQAKKRYFGSAGSARVNVETRGRPALGGPFVLVKTDGEPVTQA 98

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVM 110
                 +  +FGFT+C  +CP  L+R+ +++  V            F++ DP+RD+ E +
Sbjct: 99  EFLGSWTFFYFGFTHCPEICPVELNRMSKVVDAVRARRPKDRILPLFVSCDPRRDSLEAI 158

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            +++  F    +G+ G P  V    K++RIY + + + ++     Y +DH+ A+ LFD  
Sbjct: 159 AEYISAFHPDFVGLVGTPKQVNDACKSYRIYYS-LPSAEAAETNDYLIDHSIAIFLFDPK 217

Query: 171 GSIVGVIPYKDDSDSAIEKINRLITY 196
           G  V     + D     E++   +  
Sbjct: 218 GRFVDFFGNRYDESEITERVLHYMEQ 243


>gi|71423965|ref|XP_812634.1| cytochrome c oxidase assembly factor [Trypanosoma cruzi strain CL
           Brener]
 gi|70877440|gb|EAN90783.1| cytochrome c oxidase assembly factor, putative [Trypanosoma cruzi]
          Length = 270

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 87/206 (42%), Gaps = 17/206 (8%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD--------------GNRRFNSDVHLVAQDGTDFSLS 52
           +L  + +   G++ Y S  +K                 G         LV  DG   + +
Sbjct: 56  MLAALAVLSAGTLWYGSRQAKKRYFGSAGSARVNVETRGRPALGGPFVLVKTDGEPVTQA 115

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVM 110
                 +  +FGFT+C  +CP  L+R+ +++  V            F++ DP+RD+ E +
Sbjct: 116 EFLGSWTFFYFGFTHCPEICPVELNRMSKVVDAVRARRPKDRILPLFVSCDPRRDSLEAI 175

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            +++  F    +G+ G P  V    K++RIY + + + ++     Y +DH+ A+ LFD  
Sbjct: 176 AEYISAFHPDFVGLVGTPKQVNDACKSYRIYYS-LPSAEAAETNDYLIDHSIAIFLFDPK 234

Query: 171 GSIVGVIPYKDDSDSAIEKINRLITY 196
           G  V     + D     E++   +  
Sbjct: 235 GRFVDFFGNRYDESEITERVLHYMEQ 260


>gi|71406641|ref|XP_805842.1| cytochrome c oxidase assembly factor [Trypanosoma cruzi strain CL
           Brener]
 gi|70869406|gb|EAN83991.1| cytochrome c oxidase assembly factor, putative [Trypanosoma cruzi]
          Length = 270

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 87/206 (42%), Gaps = 17/206 (8%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD--------------GNRRFNSDVHLVAQDGTDFSLS 52
           +L  + +   G++ Y S  +K                 G         LV  DG   + +
Sbjct: 56  MLAALAVLSAGTLWYGSRQAKKRYFGSVGSARVNVETRGRPALGGPFVLVKTDGEPVTQA 115

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAY--FITVDPKRDTPEVM 110
                 +  +FGFT+C  +CP  L+R+ +++  V            F++ DP+RD+ E +
Sbjct: 116 EFLGSWTFFYFGFTHCPEICPVELNRMSKVVDAVRARRPKDRILPLFVSCDPRRDSLEAI 175

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            +++  F    +G+ G P  V    K++RIY + + + ++     Y +DH+ A+ LFD  
Sbjct: 176 AEYISAFHPDFVGLVGTPKQVNDACKSYRIYYS-LPSAEAAETNDYLIDHSIAIFLFDPK 234

Query: 171 GSIVGVIPYKDDSDSAIEKINRLITY 196
           G  V     + D     E++   +  
Sbjct: 235 GRFVDFFGNRYDESEITERVLHYMEQ 260


>gi|118594502|ref|ZP_01551849.1| hypothetical protein MB2181_02500 [Methylophilales bacterium
           HTCC2181]
 gi|118440280|gb|EAV46907.1| hypothetical protein MB2181_02500 [Methylophilales bacterium
           HTCC2181]
          Length = 191

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 51/192 (26%), Positives = 87/192 (45%), Gaps = 6/192 (3%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K +  I+ ++L       A   F+   +      N    L++  G     +        +
Sbjct: 3   KNIFFIIFSLLSLSCSKNAEFQFNGSDIS-QANLNPSFELLSHTGEIRKNTDFRGSVVAI 61

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFGFT+C  +CPTT+  L  + + +   G  L   FIT+DP+RD   ++  +V  F    
Sbjct: 62  FFGFTHCPDICPTTMQELKYIRESLGKQGDDLQVLFITLDPERDGQSLLSSYVPSFDKSF 121

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           IG++G   D+  VA  ++I+   V     G  + Y +DH++ + L D  G I    PY  
Sbjct: 122 IGLTGSQEDIDSVASQYKIFHMKV-----GDGDSYTIDHSSGIYLIDKVGKIRVRHPYGS 176

Query: 182 DSDSAIEKINRL 193
           + ++ I+ I  L
Sbjct: 177 EVENIIKDIQYL 188


>gi|18398306|ref|NP_566339.1| electron transport SCO1/SenC family protein [Arabidopsis thaliana]
 gi|17979327|gb|AAL49889.1| putative SCO1 protein [Arabidopsis thaliana]
 gi|20465763|gb|AAM20370.1| putative SCO1 protein [Arabidopsis thaliana]
 gi|21553398|gb|AAM62491.1| putative SCO1 protein [Arabidopsis thaliana]
          Length = 334

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/211 (22%), Positives = 87/211 (41%), Gaps = 21/211 (9%)

Query: 5   GIILGTILLAVLGSIAYVSFSSK----------------FVDGNRRFNSDVHLVAQDGTD 48
            +    +     G + Y     K                   G         L+  DG  
Sbjct: 127 WMSFFLLFATGAGLVYYYDTQKKRHIEDINKNSIAVKEGPSAGKAAIGGPFSLIRDDGKR 186

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTP 107
            +  +L  K +I++FGFT+C  +CP  L +L   + ++     +     FI+VDP+RDT 
Sbjct: 187 VTEKNLMGKWTILYFGFTHCPDICPDELIKLAAAIDKIKENSGVDVVPVFISVDPERDTV 246

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           + + ++V+ F  ++IG++G P ++  VA+++R+Y      E       Y VDH+  + L 
Sbjct: 247 QQVHEYVKEFHPKLIGLTGSPEEIKSVARSYRVYYMKTEEED----SDYLVDHSIVMYLM 302

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
               + V       D DS  + + + I    
Sbjct: 303 SPEMNFVKFYGKNHDVDSLTDGVVKEIRQYR 333


>gi|303287308|ref|XP_003062943.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226455579|gb|EEH52882.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 288

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/177 (24%), Positives = 81/177 (45%), Gaps = 5/177 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLV--AQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRL 79
            +       G         L    ++G  FS +SL  K ++++FGFT C  +CP  L ++
Sbjct: 112 AAIKEGPSAGKASIGGHFTLKCANENGKAFSTTSLRGKFALLYFGFTMCPDICPDELEKM 171

Query: 80  DRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
              +  V   G  +   F+++DP+RDT + +K++V+ F  ++IG++G        AK +R
Sbjct: 172 AECVDHVAAAGKEIVPVFVSIDPERDTVKRVKEYVKEFHPKLIGLTGSVDACKNAAKKYR 231

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           +Y +    E    +  Y VDH+  + L D  G  V       ++ +  + I   +  
Sbjct: 232 VYYHKTGEED---DADYLVDHSIIMYLVDDNGDFVTFYGKNFEAKAMADAILEQMKR 285


>gi|160897129|ref|YP_001562711.1| electron transport protein SCO1/SenC [Delftia acidovorans SPH-1]
 gi|160362713|gb|ABX34326.1| electron transport protein SCO1/SenC [Delftia acidovorans SPH-1]
          Length = 204

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 59/194 (30%), Positives = 91/194 (46%), Gaps = 4/194 (2%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFG 64
            +  G + L+     A  SF    V G   +  D+ L   DG   S+     K  +VFFG
Sbjct: 14  AMAWGALALSGCSREAKTSFQGVDVTG-AEYAKDIPLRDVDGKQRSIKDFAGKVVVVFFG 72

Query: 65  FTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGI 124
           +T C  VCPTTL  L  + +Q+   G  L   F+T+DP+RDTPEV+K ++  F    +G+
Sbjct: 73  YTQCPDVCPTTLQELVEVKQQLGADGDRLQGVFVTLDPERDTPEVLKAYLGNFDPGFVGL 132

Query: 125 SGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSD 184
            G P +   VAK+F+++   V  +    E  Y +DH+    ++DTAG +     Y     
Sbjct: 133 HGTPDETAAVAKDFKLFYKKVPGK---TEGAYTLDHSAGSYVYDTAGRLRVYERYGGGPQ 189

Query: 185 SAIEKINRLITYGN 198
                +  L+    
Sbjct: 190 VLGADVKALLQEKR 203


>gi|317403156|gb|EFV83682.1| SCO1/SenC/PrrC family protein [Achromobacter xylosoxidans C54]
          Length = 201

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 54/174 (31%), Positives = 83/174 (47%), Gaps = 5/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
             F    + G  +    + L   +G   +L     K  +VFFGFT C  VCPT+L+ L  
Sbjct: 32  PQFKGSDISGT-QLGRGLELSDYNGKTRTLQDFAGKAVVVFFGFTQCPDVCPTSLAELTE 90

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           ++K++ P    +    ITVDP+RDTPEV+K++V  F  R +G++G P  V + A +F+ Y
Sbjct: 91  VMKKLGPDAERVQVLLITVDPERDTPEVLKQYVTAFDPRFLGLTGTPDQVKKAAASFKAY 150

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                 +       Y +DHT A  L D  G    +       D+ +  I  L+ 
Sbjct: 151 YAKAPTKD----GNYTMDHTAAFYLLDGKGESRVLANNNIGVDALVHDIQALLK 200


>gi|194856385|ref|XP_001968739.1| GG24334 [Drosophila erecta]
 gi|190660606|gb|EDV57798.1| GG24334 [Drosophila erecta]
          Length = 251

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/200 (26%), Positives = 89/200 (44%), Gaps = 13/200 (6%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVD--------GNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           ++G + +  +G + YV                G         LV   G          K 
Sbjct: 44  VIGALGVGGVGFMLYVKSEKDEARMKERQRQLGKAAIGGSWELVDSQGAVRKSEDFLGKW 103

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL--NAYFITVDPKRDTPEVMKKFVQR 116
            +++FGFT+C  +CP  L ++  ++ +V+ +         FITVDP+RD+ EV+ K+V+ 
Sbjct: 104 LLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAVQPIFITVDPERDSKEVVAKYVKE 163

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS +++G++G    + +V K FR+Y +    +K   +  Y VDHT  + L +  G  V  
Sbjct: 164 FSPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDK---DNDYIVDHTIIMYLVNPDGEFVDY 220

Query: 177 IPYKDDSDSAIEKINRLITY 196
                D D  +  I   I  
Sbjct: 221 YGQSRDKDQCVASILVNIAK 240


>gi|297261377|ref|XP_001116350.2| PREDICTED: protein SCO2 homolog, mitochondrial-like isoform 1
           [Macaca mulatta]
          Length = 266

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 92/206 (44%), Gaps = 14/206 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF---------NSDVHLVAQDGTDFSL 51
           ++   +I       + G+   +    + +   +R            D HL+   G     
Sbjct: 57  LRTRLLITALFGAGLGGAWLALRAEKERLQQQKRIEALRQAAVGQGDFHLLDHKGQGRCK 116

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEV 109
           +    +  +++FGFT+C  +CP  L +L ++++  + +P    +   FITVDP+RD  E 
Sbjct: 117 ADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPGLPPVQPVFITVDPERDDVEA 176

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           M ++VQ F  R++G++G    + +   ++R+Y +    ++   ++ Y VDH+  + L + 
Sbjct: 177 MARYVQDFHPRLLGLTGSTEQIAQATHSYRVYYSAGPKDE---DQDYIVDHSITIYLLNP 233

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLIT 195
            G           ++   + + R + 
Sbjct: 234 DGLFTDYYGRSKSAEQISDSVRRHMA 259


>gi|297261375|ref|XP_002798471.1| PREDICTED: protein SCO2 homolog, mitochondrial-like isoform 2
           [Macaca mulatta]
          Length = 332

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 92/206 (44%), Gaps = 14/206 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF---------NSDVHLVAQDGTDFSL 51
           ++   +I       + G+   +    + +   +R            D HL+   G     
Sbjct: 123 LRTRLLITALFGAGLGGAWLALRAEKERLQQQKRIEALRQAAVGQGDFHLLDHKGQGRCK 182

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEV 109
           +    +  +++FGFT+C  +CP  L +L ++++  + +P    +   FITVDP+RD  E 
Sbjct: 183 ADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPGLPPVQPVFITVDPERDDVEA 242

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           M ++VQ F  R++G++G    + +   ++R+Y +    ++   ++ Y VDH+  + L + 
Sbjct: 243 MARYVQDFHPRLLGLTGSTEQIAQATHSYRVYYSAGPKDE---DQDYIVDHSITIYLLNP 299

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLIT 195
            G           ++   + + R + 
Sbjct: 300 DGLFTDYYGRSKSAEQISDSVRRHMA 325


>gi|269836274|ref|YP_003318502.1| electron transport protein SCO1/SenC [Sphaerobacter thermophilus
           DSM 20745]
 gi|269785537|gb|ACZ37680.1| electron transport protein SCO1/SenC [Sphaerobacter thermophilus
           DSM 20745]
          Length = 203

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 57/206 (27%), Positives = 96/206 (46%), Gaps = 13/206 (6%)

Query: 1   MKALGIILGTILLAVLGSIA------YVSFSSKFVDGNRRFNS----DVHLVAQDGTDFS 50
           M+   I+    L+ V G+ A      ++ F    + G+         D  L+  DG++  
Sbjct: 1   MRRWIILTVAALVLVGGATAGAFAAGWLPFGGGSLHGSAIDPPLPIVDAPLIGADGSEVR 60

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
           L+    K  +++FG+T C  VCPTTL+ + R LK++      +    ITVDP RDTPE+ 
Sbjct: 61  LADFRGKVVVLYFGYTYCPDVCPTTLANVARALKELGKRAEDVQVVMITVDPDRDTPEIT 120

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +++V RF    +G+ GD   +  VA    +Y      ++ G    Y VDHT  +L+ D  
Sbjct: 121 QEYVSRFDPSFVGLGGDVERIREVATGMGVYFEK---QERGSAGGYLVDHTATVLVLDRN 177

Query: 171 GSIVGVIPYKDDSDSAIEKINRLITY 196
           G +  ++PY    +     +   +  
Sbjct: 178 GDLRLMLPYGLTGEQIANDLRWALKQ 203


>gi|94501586|ref|ZP_01308103.1| Sco1/SenC family protein [Oceanobacter sp. RED65]
 gi|94426269|gb|EAT11260.1| Sco1/SenC family protein [Oceanobacter sp. RED65]
          Length = 182

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/193 (25%), Positives = 90/193 (46%), Gaps = 11/193 (5%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           M+ L      ++L  L + +     S           D  L  QD    +      + S+
Sbjct: 1   MRYLT----YLVLFTLVACSQPMPESYQPLPKAVEILDFSLTNQDSETVTKEDFIGQWSL 56

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT C  VCPTTL+ ++R+ K V+          I+VDP+RDTP+ +K +++ F+ +
Sbjct: 57  VFFGFTYCPDVCPTTLAEMNRIAKNVEKD--NFQVVMISVDPERDTPKQLKSYLEYFNPK 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
             G +G   ++ ++++   ++            + Y +DH++ ++L +  G   G I   
Sbjct: 115 FQGWTGALNEIEQLSRQLHVFFQKQP-----HGDSYLMDHSSQIILVNPQGEYQGFITEP 169

Query: 181 DDSDSAIEKINRL 193
            D+    + IN+L
Sbjct: 170 FDTQKVSDFINQL 182


>gi|167585380|ref|ZP_02377768.1| electron transport protein SCO1/SenC [Burkholderia ubonensis Bu]
          Length = 205

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 53/175 (30%), Positives = 84/175 (48%), Gaps = 5/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
             F +  + GN +F SD  L    G   +L     K  ++FFG+T+C  VCPTT++ L  
Sbjct: 33  PKFQNLDITGNTQFGSDFALPDTAGKMRTLGDFKGKAVVMFFGYTHCPDVCPTTMAELSE 92

Query: 82  LLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG-ISGDPIDVMRVAKNFR 139
            LKQ+ P     +   F+T+DP+RDT  ++ ++V  F    IG    D   + +V K+FR
Sbjct: 93  ALKQLGPDAAKRVQVLFVTIDPERDTAALLGQYVPAFDPSFIGLRPADEAQLKKVTKDFR 152

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +Y   V  +       Y +DHT A  +FDT G +   +         +  +  L+
Sbjct: 153 VYYAKVPGK---APGSYTMDHTAASYVFDTNGKLRLFVRDGQGPGPWLHDLKLLL 204


>gi|127511050|ref|YP_001092247.1| electron transport protein SCO1/SenC [Shewanella loihica PV-4]
 gi|126636345|gb|ABO21988.1| electron transport protein SCO1/SenC [Shewanella loihica PV-4]
          Length = 211

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 55/196 (28%), Positives = 90/196 (45%), Gaps = 16/196 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK---------FVDGNRRFNSDVHLVAQDGTDFSL 51
           MK L I+L   + + LG+IA V+F+ +         +    +R  S   L  Q+G  F+ 
Sbjct: 1   MKPLWIVLTLFIFSGLGAIAAVNFTGQATPPELLTSYRYPQQRPLSPFELTDQNGKAFTN 60

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
           + L  K S+ F G+T+C  VCPTTL +L    +Q+      L   F++VDP RDT   +K
Sbjct: 61  ARLKDKWSLFFVGYTSCPDVCPTTLGKLAAAYQQL-EGVVDLQVVFLSVDPARDTQVKLK 119

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            ++  F+   I ++     ++ + +        V     G  E Y VDH+ +++L    G
Sbjct: 120 DYINFFNPNFIAVTAPHSQLLPLTRELGFVYTMV-----GEGENYQVDHSASMVLISPDG 174

Query: 172 -SIVGVIPYKDDSDSA 186
             +  V P   D    
Sbjct: 175 TRVATVKPTSLDPRQL 190


>gi|146419920|ref|XP_001485919.1| hypothetical protein PGUG_01590 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 315

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 57/203 (28%), Positives = 94/203 (46%), Gaps = 18/203 (8%)

Query: 8   LGTILLAVLGSIAYVSFSSKFV------------DGNRRFNSDVHLVAQDGTDFSLSSLY 55
              +L+A+ G + +     K               G         L+  +G  F+ ++L 
Sbjct: 93  AVVLLVALGGGVTWWFAKEKERLRIQKEVESKRGHGKPLIGGPFDLIDTEGNQFTDANLK 152

Query: 56  I---KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPEVMK 111
               K SI++FGFT+C  VCP  L +L  +L+++       L   FIT DP RDTP+++K
Sbjct: 153 NDEKKFSIIYFGFTHCPDVCPDELDKLGEMLEELKNENGIELQPIFITCDPARDTPDIIK 212

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            ++Q F   IIG++G    +    K +R+Y +     K    + Y VDH+    L D+ G
Sbjct: 213 LYLQDFHPSIIGLTGTYEKIKLACKKYRVYFSTPPDVK--PGQDYLVDHSIFFYLMDSEG 270

Query: 172 SIVGVIPYKDDSDSAIEKINRLI 194
             V VI  +  +   +EKI + +
Sbjct: 271 GFVDVIGREATAKEGVEKIKKHV 293


>gi|290563162|ref|NP_001166845.1| SCO cytochrome oxidase deficient homolog 1 [Rattus norvegicus]
 gi|149052964|gb|EDM04781.1| similar to SCO cytochrome oxidase deficient homolog 1 (yeast)
           (predicted) [Rattus norvegicus]
          Length = 284

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 88/198 (44%), Gaps = 12/198 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L +        + G   +     + ++       G         L   +G   +    
Sbjct: 79  KSLALTFAIGGSLLAGMKYFKKEKIEKLEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDF 138

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L ++  +++++D  P+   L   FIT+DP+RDT E +  
Sbjct: 139 LGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIAT 198

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS +++G++G   ++  VA+ +R+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 199 YVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGE 255

Query: 173 IVGVIPYKDDSDSAIEKI 190
            +               I
Sbjct: 256 FLDYFGQNKKKAEIAGSI 273


>gi|74228413|dbj|BAE24044.1| unnamed protein product [Mus musculus]
          Length = 282

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 88/198 (44%), Gaps = 12/198 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L +        + G   +     + ++       G         L   +G   +    
Sbjct: 77  KSLALTFAIGGSLLAGMKYFKKEKIEKLEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDY 136

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L ++  +++++D  P+   L   FIT+DP+RDT E +  
Sbjct: 137 LGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIAT 196

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS +++G++G   ++  VA+ +R+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 197 YVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGE 253

Query: 173 IVGVIPYKDDSDSAIEKI 190
            +               I
Sbjct: 254 FLDYFGQNKKKAEIAGSI 271


>gi|90991710|ref|NP_001035115.1| protein SCO1 homolog, mitochondrial precursor [Mus musculus]
 gi|81862458|sp|Q5SUC9|SCO1_MOUSE RecName: Full=Protein SCO1 homolog, mitochondrial; Flags: Precursor
 gi|56237911|emb|CAI25980.1| SCO cytochrome oxidase deficient homolog 1 (yeast) [Mus musculus]
 gi|187953083|gb|AAI39010.1| SCO cytochrome oxidase deficient homolog 1 (yeast) [Mus musculus]
 gi|187954157|gb|AAI39009.1| SCO cytochrome oxidase deficient homolog 1 (yeast) [Mus musculus]
          Length = 284

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 88/198 (44%), Gaps = 12/198 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L +        + G   +     + ++       G         L   +G   +    
Sbjct: 79  KSLALTFAIGGSLLAGMKYFKKEKIEKLEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDY 138

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L ++  +++++D  P+   L   FIT+DP+RDT E +  
Sbjct: 139 LGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIAT 198

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS +++G++G   ++  VA+ +R+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 199 YVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGE 255

Query: 173 IVGVIPYKDDSDSAIEKI 190
            +               I
Sbjct: 256 FLDYFGQNKKKAEIAGSI 273


>gi|319899143|ref|YP_004159236.1| sco1/2 family protein [Bartonella clarridgeiae 73]
 gi|319403107|emb|CBI76665.1| sco1/2 family protein [Bartonella clarridgeiae 73]
          Length = 197

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 69/204 (33%), Positives = 109/204 (53%), Gaps = 16/204 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  ILG  ++ +     Y +F +K          +  L A +G   + + +  K S+
Sbjct: 1   MKNIIRILGLTIVFLASVFTYDTFRNK------PLGENFTLTASNGKIVTEADIRSKSSV 54

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFG+T C   CPTTL  L+R L  + P    LN +F+TVDP+RDTPEV+++++  F+D+
Sbjct: 55  IFFGYTMCPDTCPTTLVDLNRWLTAIGPNVDKLNVWFVTVDPERDTPEVLREYLSNFTDK 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IIGISGDP  V ++  +F I    V       ++ Y  +HT A+ L    G + GVIPY 
Sbjct: 115 IIGISGDPNAVHKMVSSFNIVAEKVPGTD---DDNYTYNHTAAIFLLKKGGKLAGVIPYN 171

Query: 181 DDS-------DSAIEKINRLITYG 197
            +        D AI ++ +L++  
Sbjct: 172 VEENNNKLKDDIAITRLKKLVSNS 195


>gi|163742583|ref|ZP_02149969.1| regulatory protein SenC [Phaeobacter gallaeciensis 2.10]
 gi|161384168|gb|EDQ08551.1| regulatory protein SenC [Phaeobacter gallaeciensis 2.10]
          Length = 206

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 45/172 (26%), Positives = 78/172 (45%), Gaps = 4/172 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           +S+   G+        L+   G   +   +  KPS+V+FG+T C  VCP  ++R    + 
Sbjct: 38  ASQIAGGSDTIGGPFELLNAKGETVTEKDVITKPSLVYFGYTFCPDVCPLDVARNAEAID 97

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            +D  G  +   FI++DP RDTPEV+  F     +R+IG++G    V   ++ ++ Y   
Sbjct: 98  LLDERGQDVTPVFISIDPDRDTPEVVGDFAANLHERMIGLTGSHEQVKAASRAYKTYYKK 157

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
               + G E+ Y VDH+T   L       V      +  +   +K+   +  
Sbjct: 158 ----QDGDEDYYLVDHSTFSYLVLPEQGFVEFFRRDETPEQIADKVGCFLEN 205


>gi|291405027|ref|XP_002719016.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Oryctolagus
           cuniculus]
          Length = 376

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 89/198 (44%), Gaps = 12/198 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSS-------KFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L +        + G   +    +       +   G         LV   G   +    
Sbjct: 171 KSLAVTFAIGGALLAGMKYFKKEKTEKLEKERQRSIGKPLLGGPFSLVTHTGEPKTDKDF 230

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN--AYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L ++ +++ ++D   +L N    FIT+DP+RDT E +  
Sbjct: 231 LGQWVLIYFGFTHCPDICPEELEKMMQVVDEIDDIPSLPNLTPLFITIDPERDTKEAIAN 290

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS ++IG++G   ++ +VA+ +R+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 291 YVKEFSPKLIGLTGTKEEIDQVARAYRVYYSPGPRDE---DEDYIVDHTIIMYLVGPDGE 347

Query: 173 IVGVIPYKDDSDSAIEKI 190
            +        +      I
Sbjct: 348 FLDYFGQNKKNAEIAGSI 365


>gi|163738021|ref|ZP_02145437.1| regulatory protein SenC [Phaeobacter gallaeciensis BS107]
 gi|161388637|gb|EDQ12990.1| regulatory protein SenC [Phaeobacter gallaeciensis BS107]
          Length = 206

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 45/172 (26%), Positives = 78/172 (45%), Gaps = 4/172 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           +S+   G+        L+   G   +   +  KPS+V+FG+T C  VCP  ++R    + 
Sbjct: 38  ASQIAGGSDTIGGPFELLNAKGETVTEKDVITKPSLVYFGYTFCPDVCPLDVARNAEAID 97

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            +D  G  +   FI++DP RDTPEV+  F     +R+IG++G    V   ++ ++ Y   
Sbjct: 98  LLDERGQDVTPVFISIDPDRDTPEVVGDFAANLHERMIGLTGSHEQVKAASRAYKTYYKK 157

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
               + G E+ Y VDH+T   L       V      +  +   +K+   +  
Sbjct: 158 ----QDGDEDYYLVDHSTFSYLVLPEQGFVEFFRRDETPEQIADKVGCFLEN 205


>gi|297829422|ref|XP_002882593.1| electron transport SCO1/SenC family protein [Arabidopsis lyrata
           subsp. lyrata]
 gi|297328433|gb|EFH58852.1| electron transport SCO1/SenC family protein [Arabidopsis lyrata
           subsp. lyrata]
          Length = 334

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 87/211 (41%), Gaps = 21/211 (9%)

Query: 5   GIILGTILLAVLGSIAYVSFSSK----------------FVDGNRRFNSDVHLVAQDGTD 48
            +    +     G + Y     K                   G        +L+  DG  
Sbjct: 127 WMSFFLLFATGAGLVYYYDREKKRHIEDINKNSIAVKEGPSAGKAAIGGPFNLIRDDGKR 186

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTP 107
            +   L  K SI++FGFT+C  +CP  L +L   + ++     +     FI+VDP+RDT 
Sbjct: 187 VTEKDLMGKWSILYFGFTHCPDICPDELIKLAAAIDKIKENSGVDVVPVFISVDPERDTV 246

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           + + ++V+ F  ++IG++G P ++  VA+++R+Y      E       Y VDH+  + L 
Sbjct: 247 QQVHEYVKEFHPKLIGLTGSPEEIKSVARSYRVYYMKTEEED----SDYLVDHSIVMYLM 302

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
               + V       D DS  + + + I    
Sbjct: 303 SPEMNFVKFYGKNHDVDSLTDGVVKEIRQYR 333


>gi|182680557|ref|YP_001834703.1| electron transport protein SCO1/SenC [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636440|gb|ACB97214.1| electron transport protein SCO1/SenC [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 209

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 58/200 (29%), Positives = 91/200 (45%), Gaps = 16/200 (8%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDG-----------NRRFNSDVHLVAQDGTDFSLS 52
           L I    ++LAVL +   +        G             R      L A DG   S  
Sbjct: 13  LLITAFAVILAVLAATVLLVLPGHDPLGIDSKIRESQPAGPRIGGPFVLEATDGRTISDK 72

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKK 112
            L  +P ++FFG+T+C   CPT L+ +  + K +     +    FIT+DP+RDTP V++ 
Sbjct: 73  DLLGRPYLLFFGYTHCPDFCPTALADMSAVFKAMGEKAPVTGV-FITLDPERDTPAVLRD 131

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           ++  F  RIIG++G+   +  VAK FR+Y   +     G    Y +DHT  + L D  G 
Sbjct: 132 YLSSFDPRIIGLTGEKDKINAVAKAFRVYSRQIP----GPNGDYTLDHTGLVYLMDRRGQ 187

Query: 173 IVGVIPYKDDSDSAIEKINR 192
            +       D  +A E++ +
Sbjct: 188 FINAFNLGQDPRAAAEELKK 207


>gi|296192125|ref|XP_002743928.1| PREDICTED: protein SCO2 homolog, mitochondrial-like [Callithrix
           jacchus]
          Length = 266

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 42/203 (20%), Positives = 93/203 (45%), Gaps = 15/203 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGNRRF----------NSDVHLVAQDGTDFSLSSL 54
            +++  +  A LG +     + K     ++             +  L+   G     +  
Sbjct: 60  RLLITAVFGAGLGGVWLALRTEKERLRQQQRMEALRQAAVGQGNFCLLDHKGQARCKADF 119

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L +L ++++  + +P    +   FITVDP+RD  + M +
Sbjct: 120 RGQWVLMYFGFTHCPDICPDELEKLVQVVQLLEAEPALPAVQPVFITVDPERDDVKAMAR 179

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +VQ F  R++G++G    V + + ++R+Y +    ++   ++ Y VDH+ A+ L +  G 
Sbjct: 180 YVQDFHPRLLGLTGSTEQVAQASHSYRVYYSAGPKDE---DQDYIVDHSIAIYLLNPDGL 236

Query: 173 IVGVIPYKDDSDSAIEKINRLIT 195
                     ++   + + R + 
Sbjct: 237 FTDYYGRSRSAEQIADSVRRHMA 259


>gi|329118011|ref|ZP_08246724.1| regulatory protein SenC [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465899|gb|EGF12171.1| regulatory protein SenC [Neisseria bacilliformis ATCC BAA-1200]
          Length = 225

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/162 (30%), Positives = 77/162 (47%), Gaps = 4/162 (2%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
              D  L    G  F+LSSL  K  ++ FG+TNC  VCPT+L     ++ ++      + 
Sbjct: 66  IGGDFTLTDGSGKPFALSSLKGKVVLLTFGYTNCPDVCPTSLLTYSEVVGKLGEQAKDVA 125

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKSGVE 153
             F++VDP RDTPEV+ KF + F+   IG++      + V K  +R+        +    
Sbjct: 126 VVFVSVDPDRDTPEVVSKFAKTFNPDFIGLTATGEQSIPVVKQQYRVVSAK---SQEQSA 182

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           + Y +DHT    + D  G+ V +  Y   SD     + RL+ 
Sbjct: 183 DIYLIDHTAGTYVLDKNGNTVLMENYGRTSDEIAADVKRLLA 224


>gi|293607254|ref|ZP_06689595.1| SCO1/SenC family protein [Achromobacter piechaudii ATCC 43553]
 gi|292814346|gb|EFF73486.1| SCO1/SenC family protein [Achromobacter piechaudii ATCC 43553]
          Length = 207

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 73/158 (46%), Gaps = 5/158 (3%)

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAY 96
            D  L    G   +L+     P ++FFGFT C  +CPT L+R   +   +      L   
Sbjct: 55  GDFQLQDTSGQMRTLADYRGHPIMLFFGFTQCPDICPTALTRALEIKALLGADADKLRVL 114

Query: 97  FITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           FITVDP+RDTPE++  + Q F    +G+ G+       A++F+++   V          Y
Sbjct: 115 FITVDPERDTPEILAAYTQAFDPGFVGLRGNAEQTRAAAQSFKVFYQKVP-----TGSSY 169

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            +DHT    L D  G +   + ++  +   +E +  ++
Sbjct: 170 TMDHTALTYLIDAQGKLRVALRHQQSAQECVEDLRTVL 207


>gi|165971715|gb|AAI58883.1| Sco1 protein [Rattus norvegicus]
          Length = 274

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 88/198 (44%), Gaps = 12/198 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L +        + G   +     + ++       G         L   +G   +    
Sbjct: 69  KSLALTFAIGGSLLAGMKYFKKEKIEKLEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDF 128

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L ++  +++++D  P+   L   FIT+DP+RDT E +  
Sbjct: 129 LGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIAT 188

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS +++G++G   ++  VA+ +R+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 189 YVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGE 245

Query: 173 IVGVIPYKDDSDSAIEKI 190
            +               I
Sbjct: 246 FLDYFGQNKKKAEIAGSI 263


>gi|302843262|ref|XP_002953173.1| hypothetical protein VOLCADRAFT_93834 [Volvox carteri f.
           nagariensis]
 gi|300261560|gb|EFJ45772.1| hypothetical protein VOLCADRAFT_93834 [Volvox carteri f.
           nagariensis]
          Length = 217

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 43/167 (25%), Positives = 84/167 (50%), Gaps = 5/167 (2%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G         L+ QDG  ++   L  + ++++FGFT+C  +CP  L ++   +  ++ + 
Sbjct: 30  GKAAVGGPFDLIDQDGKRYTDKDLLGEFALLYFGFTHCPDICPDELEKVSEAVNLIEKST 89

Query: 91  -TLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
              +   FI+VDP+RD P ++K +V  F  R+IG++GD  ++ +V+K++R+Y +      
Sbjct: 90  GVQIQLVFISVDPERDKPPLVKSYVSEFHPRMIGLTGDLDNIKKVSKSYRVYYSKT---- 145

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
              +  Y VDH+    L D  G  V       D+    +++ + +  
Sbjct: 146 GESDADYLVDHSIIHYLIDPEGEFVTFFGKNSDAQQISKQVIQHLAN 192


>gi|170743995|ref|YP_001772650.1| electron transport protein SCO1/SenC [Methylobacterium sp. 4-46]
 gi|168198269|gb|ACA20216.1| electron transport protein SCO1/SenC [Methylobacterium sp. 4-46]
          Length = 215

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 47/162 (29%), Positives = 75/162 (46%), Gaps = 4/162 (2%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
                  LV Q G   + +       +V+FGFT+C  VCPT L+ + RLL  +   G  +
Sbjct: 45  PVGGPFALVDQTGRPRTDADFRGTLLLVYFGFTSCPDVCPTDLAEIGRLLDLLGDRGASI 104

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              FIT+DP+RDT   +  +V  F  R+I ++G    V  +A  +++Y   V        
Sbjct: 105 QPLFITLDPERDTVAHLAAYVPSFHPRLIALTGSAEAVRNIADAYKVYHERVQLG----G 160

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
             Y VDH+  + L D +G  +G  P    ++     +  L+T
Sbjct: 161 SDYTVDHSAFIYLMDRSGGYLGFFPPGTTAERMSAIVEPLLT 202


>gi|241996405|gb|ABK64014.2| putative electron chain protein [Janthinobacterium lividum]
          Length = 198

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 56/198 (28%), Positives = 94/198 (47%), Gaps = 8/198 (4%)

Query: 1   MKA-LGIILGTILLAVLGSI--AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK  L ++ GT  L  L +   A     +        +  D  L   DG  ++L+    K
Sbjct: 1   MKRRLFLLAGTAGLLTLAACEQAPKPHYNGLDLTGGDYKPDFKLSGPDGKVYTLADFKGK 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             +VFFGFT C  VCPT LSR   + +++ P    L   FI++DP+RDTPE++ ++++ F
Sbjct: 61  YVMVFFGFTQCPDVCPTALSRALEIRQKLGPDADKLQVIFISIDPERDTPELLGEYMRAF 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
               +G+  DP    + A N++++   V          Y +DHT    + DT G +   +
Sbjct: 121 DPSFLGLRTDPQATAQTAFNYKVFYRRVP-----SGSSYTMDHTAISYVLDTEGRMRLGL 175

Query: 178 PYKDDSDSAIEKINRLIT 195
            ++   D  ++ I  L+ 
Sbjct: 176 KHQLTGDECVQDIKTLMK 193


>gi|168693509|ref|NP_001108271.1| SCO cytochrome oxidase deficient homolog 2 [Xenopus laevis]
 gi|163915580|gb|AAI57458.1| LOC100137652 protein [Xenopus laevis]
          Length = 275

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 48/206 (23%), Positives = 90/206 (43%), Gaps = 14/206 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFN---------SDVHLVAQDGTDFSL 51
           ++A   +   I  A LG   Y+ +  +     ++            D  LV   G   + 
Sbjct: 66  LRARVTVSCIIGGAALGIWFYLRWEKQEQKKVQQIQQLRTLAVGQGDFSLVDHTGQPRTK 125

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEV 109
           SS      +++FGFT+C  +CP  L +L   +  +D    L +    FI++DP+RD+ E 
Sbjct: 126 SSWRGNWVLLYFGFTHCPDICPDELQKLSSAVSLLDKDPALPHVLPVFISIDPERDSVEA 185

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           + K+V  F  R++G++G P  V +VA+ +R+Y +    ++   +  Y +DHT  + L + 
Sbjct: 186 ISKYVSEFHPRLLGLTGSPEQVKKVAQEYRVYYSVGPKDE---DNDYILDHTIIIYLLNP 242

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLIT 195
            G                + +   + 
Sbjct: 243 DGLFTDYYGRGKTDQEIADSVKSHMQ 268


>gi|56237912|emb|CAI25981.1| SCO cytochrome oxidase deficient homolog 1 (yeast) [Mus musculus]
          Length = 289

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 41/162 (25%), Positives = 78/162 (48%), Gaps = 5/162 (3%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--P 88
           G         L   +G   +      +  +++FGFT+C  +CP  L ++  +++++D  P
Sbjct: 120 GKPLLGGPFSLTTHNGEPKTDKDYLGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIP 179

Query: 89  TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
           +   L   FIT+DP+RDT E +  +V+ FS +++G++G   ++  VA+ +R+Y +    +
Sbjct: 180 SLPNLTPLFITIDPERDTKEAIATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKD 239

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
           +   +E Y VDHT  + L    G  +               I
Sbjct: 240 E---DEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSI 278


>gi|156844497|ref|XP_001645311.1| hypothetical protein Kpol_1037p50 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115971|gb|EDO17453.1| hypothetical protein Kpol_1037p50 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 319

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 57/201 (28%), Positives = 88/201 (43%), Gaps = 17/201 (8%)

Query: 9   GTILLAVLGSIAYVSFSSKFV-------------DGNRRFNSDVHLVA-QDGTDFSLSSL 54
             +L  V+GS  Y  F  +                G         L+    G  F+  +L
Sbjct: 99  AALLFIVVGSGLYFIFEKEKKRLEVEREAEANRGYGKPVVGGPFSLINCSTGDRFNEENL 158

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMKKF 113
               SI++FGFT+C  +CP  L +L   L  +       L   FIT DP RDTPEVM+ +
Sbjct: 159 NDNWSIIYFGFTHCPDICPDELDKLGVWLNSLKTKFNIKLQPIFITCDPARDTPEVMENY 218

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++ F   I+G++G   ++    K +R+Y +          + Y VDH+    L D  G  
Sbjct: 219 LKDFHPDIVGLTGSYDEIKNTCKQYRVYFSTPP--NLKPGQDYLVDHSVFFYLMDPEGQF 276

Query: 174 VGVIPYKDDSDSAIEKINRLI 194
           V V+   +D  + ++KI  LI
Sbjct: 277 VQVLGMSNDEVTGVDKIKELI 297


>gi|149925640|ref|ZP_01913904.1| Electron transport protein SCO1/SenC [Limnobacter sp. MED105]
 gi|149825757|gb|EDM84965.1| Electron transport protein SCO1/SenC [Limnobacter sp. MED105]
          Length = 207

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 47/193 (24%), Positives = 93/193 (48%), Gaps = 5/193 (2%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
              +  G + L    +    SF++  + G+    ++  L    GT+ ++ S   K   +F
Sbjct: 16  KTWLAFGAVALLSACNTGPASFTNTDITGSS-LVANFKLKDLSGTERTMESYKGKVVAMF 74

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  VCP T+ +   +  ++   G  L   F++VDP+RDTPE++KK+V +F+    
Sbjct: 75  FGYTHCPDVCPITMQQWSEVKAKLGEKGDNLQVLFVSVDPERDTPELLKKYVPQFNPTFD 134

Query: 123 GISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
            ++     ++  +    R+Y   V        + Y +DHT+A  +FD  G    ++ +  
Sbjct: 135 ALTAESSDELKPLLAGLRVYAGKVEG---STPDNYLMDHTSASYVFDQQGRARLLVRHNA 191

Query: 182 DSDSAIEKINRLI 194
           DS   +  + +++
Sbjct: 192 DSAPVVSDVEQIL 204


>gi|225023599|ref|ZP_03712791.1| hypothetical protein EIKCOROL_00459 [Eikenella corrodens ATCC
           23834]
 gi|224943481|gb|EEG24690.1| hypothetical protein EIKCOROL_00459 [Eikenella corrodens ATCC
           23834]
          Length = 216

 Score =  118 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 73/168 (43%), Gaps = 7/168 (4%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTL 92
               D  L + +G   SLS    K  ++ FG+T+C  VCPT L    + + Q        
Sbjct: 51  PIGGDFTLTSHNGRPVSLSDFRGKIVVLVFGYTHCPDVCPTHLLTYAQAIAQLPPEQAEA 110

Query: 93  LNAYFITVDPKRDTPEVMKKFVQRFSDRIIGIS---GDPIDVMRVAKNFRIYVNNVLAEK 149
           +   F+++DP RD PE++ ++V  F+   IG++   G   +   V K +         + 
Sbjct: 111 VQLLFVSIDPARDRPELLARYVPAFNPSFIGLTSADGSEAETQAVMKLYGATAVKQPPQP 170

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
           +G    Y VDH++A  L +  G  V +  +   +    E +  L+   
Sbjct: 171 NGF---YSVDHSSATFLINRQGRPVVMEAFGQTATQLAEDLKTLLNQQ 215


>gi|170748844|ref|YP_001755104.1| electron transport protein SCO1/SenC [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655366|gb|ACB24421.1| electron transport protein SCO1/SenC [Methylobacterium
           radiotolerans JCM 2831]
          Length = 221

 Score =  118 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 58/181 (32%), Positives = 91/181 (50%), Gaps = 4/181 (2%)

Query: 13  LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           +   G+ A V          R+      +   DG   + + L  KPS++FFGFT+C  VC
Sbjct: 17  VVATGTGAIVLQQGSRFSHPRKVGGPFTMADLDGRPVTEADLRGKPSVLFFGFTHCPDVC 76

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVM 132
           PTTL+ L   L ++      LN  F+T+DP+RDTP+ +++++  F  RI G+ G P  V 
Sbjct: 77  PTTLATLSAALGRMGRDADRLNVVFVTLDPERDTPDALREYLASFDPRIRGLVGTPQQVA 136

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
           R+A  + +    V  +       Y ++H+  + LFD  G +VG I Y +D  S   K+  
Sbjct: 137 RMADAYHVAYKRVPTKD----GDYTMEHSATVALFDRTGRMVGEIGYGEDEASTFAKLIT 192

Query: 193 L 193
           L
Sbjct: 193 L 193


>gi|84517092|ref|ZP_01004448.1| regulatory protein SenC [Loktanella vestfoldensis SKA53]
 gi|84508987|gb|EAQ05448.1| regulatory protein SenC [Loktanella vestfoldensis SKA53]
          Length = 201

 Score =  118 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 51/195 (26%), Positives = 83/195 (42%), Gaps = 11/195 (5%)

Query: 1   MKALGIILGTILLAV-LGSIAYVSFSSKFVD------GNRRFNSDVHLVAQDGTDFSLSS 53
           MK++ I  G + +AV LG   + + ++                    LV++ G   + + 
Sbjct: 1   MKSVIIGSGVLAVAVGLGVYTWQTTNAVPDPCGNTTVAGAAIGGPFELVSETGATVTDTD 60

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           +  KP++V+FG+T C  VCP    R       +   G  +   FI+VDP RDTP+V+  F
Sbjct: 61  VITKPTLVYFGYTFCPDVCPLDSMRNAIAADILADQGVDIGTVFISVDPARDTPQVVGDF 120

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
              F   +IG++G P  V   ++ ++ Y   V     G  E Y VDH+T   L       
Sbjct: 121 TDNFHADMIGLTGSPDQVRAASQAYKTYYRAVE----GDPEYYLVDHSTQTYLMFPDTGF 176

Query: 174 VGVIPYKDDSDSAIE 188
                    ++   E
Sbjct: 177 ATFFRRDTPAEQVAE 191


>gi|122692513|ref|NP_001073712.1| protein SCO1 homolog, mitochondrial precursor [Bos taurus]
 gi|134035032|sp|A1A4J8|SCO1_BOVIN RecName: Full=Protein SCO1 homolog, mitochondrial; Flags: Precursor
 gi|119223914|gb|AAI26614.1| SCO cytochrome oxidase deficient homolog 1 (yeast) [Bos taurus]
 gi|296476712|gb|DAA18827.1| protein SCO1 homolog, mitochondrial precursor [Bos taurus]
          Length = 305

 Score =  118 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 47/198 (23%), Positives = 90/198 (45%), Gaps = 12/198 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L +        + G   +    ++ ++       G         L    G   +    
Sbjct: 100 KSLAVTFAIGGALLAGMKYFKKEKTEKLEKERHRSIGKPLLGGPFSLTTHTGEPKTDKDY 159

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L ++ +++ ++D  PT   L   FIT+DP+RDT E +  
Sbjct: 160 LGQWVLIYFGFTHCPDICPEELEKMIQVVDEIDSIPTLPNLTPLFITIDPERDTKEAIAN 219

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS ++IG++G   ++ +VA+ FR+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 220 YVKEFSPKLIGLTGTKEEIDQVARAFRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGE 276

Query: 173 IVGVIPYKDDSDSAIEKI 190
            +        +      I
Sbjct: 277 FLDYFGQNKKNAEIAGSI 294


>gi|126735824|ref|ZP_01751569.1| electron transport protein SCO1/SenC [Roseobacter sp. CCS2]
 gi|126715011|gb|EBA11877.1| electron transport protein SCO1/SenC [Roseobacter sp. CCS2]
          Length = 202

 Score =  118 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 50/197 (25%), Positives = 87/197 (44%), Gaps = 15/197 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNR---------RFNSDVHLVAQDGTDFSL 51
           MK   +I G+  LAV  +I   ++ S+                      L+++ G   + 
Sbjct: 2   MK--AVIFGSTTLAVAAAIGIYAWQSQSAMPQPCGDTAVAGSTIGGPFELISETGETVTD 59

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
           + +  KP++V+FG+T C  VCP   +R  +    ++  G  L   FI+VDP+RDT EV++
Sbjct: 60  ADVITKPTLVYFGYTFCPDVCPLDSARNAQAAYILEDQGLDLGTVFISVDPQRDTVEVVR 119

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            F   F + +IG++G P  V   ++ ++ Y   +  +     E Y VDH+T   L     
Sbjct: 120 DFTDNFHEDMIGLTGSPEQVKAASQAYKTYYRAMDDD----PEFYLVDHSTQTYLMFPET 175

Query: 172 SIVGVIPYKDDSDSAIE 188
                      ++   E
Sbjct: 176 GFKTFFRRDSTAEQIAE 192


>gi|47207985|emb|CAF91456.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 299

 Score =  118 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 44/204 (21%), Positives = 85/204 (41%), Gaps = 12/204 (5%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L I        + G   +     + ++       G         L   +         
Sbjct: 94  KSLAITFAVGGALLGGMKYFKREKEELIEKERTKSMGRPALGGPFSLTDHNNHPRRSEDF 153

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L ++  ++ ++D   +   L    IT+DP RDT E M +
Sbjct: 154 LGQWILIYFGFTHCPDICPDELEKMIEVVDEIDRIKSLPNLTPILITIDPDRDTTEAMAE 213

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS ++IG++G    + +V++++R+Y +    ++   +  Y VDHT  + L    G 
Sbjct: 214 YVKEFSPKLIGLTGTSAQIEQVSRSYRVYYSQGPKDE---DNDYIVDHTIIMYLVGPDGQ 270

Query: 173 IVGVIPYKDDSDSAIEKINRLITY 196
            V        S      I   +  
Sbjct: 271 FVDYFGQNKRSPEISSAIAAHMRK 294


>gi|302381639|ref|YP_003817462.1| electron transporter SCO1/SenC [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192267|gb|ADK99838.1| electron transport protein SCO1/SenC [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 207

 Score =  118 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 50/170 (29%), Positives = 76/170 (44%), Gaps = 7/170 (4%)

Query: 30  DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT 89
            G         LV QDG     + L  K S+VFFGFT C   CPTTL  L+    ++   
Sbjct: 43  TGQASVGGPFQLVNQDGQAVDQTLLNGKWSLVFFGFTYCPDFCPTTLQALEATKARLGAA 102

Query: 90  GTLLNAYFITVDPKRDTPEVMKKFV--QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLA 147
              L   FI+VDP RDTP+ +K ++    F + +IG++G    V   A  +R +   V  
Sbjct: 103 ADDLQIVFISVDPARDTPQALKDYLSSDGFPEGVIGLTGTDAQVKSAADAYRAFYQKV-- 160

Query: 148 EKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
              G    Y ++H+  + L    G     + +    D + + I R++  G
Sbjct: 161 ---GTGPDYTMNHSLTVYLIGPDGRYRSALAHDLGPDRSAQLIQRVMARG 207


>gi|195437420|ref|XP_002066638.1| GK24460 [Drosophila willistoni]
 gi|194162723|gb|EDW77624.1| GK24460 [Drosophila willistoni]
          Length = 256

 Score =  118 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 52/200 (26%), Positives = 88/200 (44%), Gaps = 13/200 (6%)

Query: 7   ILGTILLAVLGSIAYVSFSS--------KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           ++G +    LG + YV            K   G         LV   G          K 
Sbjct: 49  VIGVLGAGGLGFMLYVKAEKDEALLKERKRQLGKAAIGGRWELVDSQGQVRKSEDFLGKW 108

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL--NAYFITVDPKRDTPEVMKKFVQR 116
            +++FGFT+C  +CP  L ++  ++ +V+ +         FITVDP+RD+ E++ K+V+ 
Sbjct: 109 LLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPDVQPIFITVDPERDSKEIVGKYVKE 168

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS +++G++G    +  V K FR+Y +    ++   +  Y VDHT  + L +  G  V  
Sbjct: 169 FSPKLLGLTGTVDQIRNVCKAFRVYFSAGPRDE---DNDYIVDHTIIMYLVNPEGEFVDY 225

Query: 177 IPYKDDSDSAIEKINRLITY 196
                D D  +  I   I  
Sbjct: 226 YGQNRDKDQCVASILVNIAK 245


>gi|114571404|ref|YP_758084.1| electron transport protein SCO1/SenC [Maricaulis maris MCS10]
 gi|114341866|gb|ABI67146.1| electron transport protein SCO1/SenC [Maricaulis maris MCS10]
          Length = 210

 Score =  118 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 44/205 (21%), Positives = 83/205 (40%), Gaps = 15/205 (7%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVD---------GNRRFNSDVHLVAQDGTDFSLSSL 54
           L +++    + ++     +  +S   D         G  +      LV Q GT  +  + 
Sbjct: 6   LWLLIAAPTVLLIAFFTQLVTNSDRQDVRRGAVRTSGEAQIGGPFELVDQTGTTVTHETY 65

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT-LLNAYFITVDPKRDTPEVMKKF 113
             K  +++FG+T C   CP +L  +   + Q+D      +    I+ DP+RDT E M ++
Sbjct: 66  AGKLMLIYFGYTYCPDACPFSLQIMAAAMDQLDADQRARIQPILISFDPERDTVEQMARY 125

Query: 114 V--QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
           V    F D ++G++G    +   A+ +R+               Y +DH++ + L D  G
Sbjct: 126 VSSPAFPDGLVGLTGTEEQIAAAARVYRVVYQRAED---AGSGDYLMDHSSFIYLMDGNG 182

Query: 172 SIVGVIPYKDDSDSAIEKINRLITY 196
             V V P   D      ++   +  
Sbjct: 183 VFVDVFPTGVDPVDLTARLQDFLEE 207


>gi|91090063|ref|XP_969355.1| PREDICTED: similar to GA21389-PA [Tribolium castaneum]
          Length = 271

 Score =  118 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 48/197 (24%), Positives = 84/197 (42%), Gaps = 16/197 (8%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
           L    +   G +A++ +  K  +           G  +      LV  +G          
Sbjct: 63  LAITGVLGGGLLAFMYYLKKEKEDALMRERKRMLGKAKIGGYFELVDSEGKTRKSDDFLG 122

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKFV 114
           +  +++FGFT+C  +CP  L ++  ++  +D       +   FI+VDP+RD+P V+ K+ 
Sbjct: 123 QWMLIYFGFTHCPDICPDELEKMAAVINDLDSTKDVPRVQPIFISVDPQRDSPAVVGKYC 182

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             FS R++G++G    V R  K +R+Y +    +K   +  Y VDHT  + L D  G  V
Sbjct: 183 AEFSPRLLGLTGTVEQVARACKAYRVYFSAGPKDK---DSDYIVDHTIIMYLVDPDGQFV 239

Query: 175 GVIPYKDDSDSAIEKIN 191
                   +      I 
Sbjct: 240 DYYGQNKSAIEIAASIK 256


>gi|148555729|ref|YP_001263311.1| electron transport protein SCO1/SenC [Sphingomonas wittichii RW1]
 gi|148500919|gb|ABQ69173.1| electron transport protein SCO1/SenC [Sphingomonas wittichii RW1]
          Length = 206

 Score =  118 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 52/172 (30%), Positives = 82/172 (47%), Gaps = 6/172 (3%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
                  + +      L  QDG   S      K  +++FG+T C  VCP  +  L +  +
Sbjct: 34  RETPPLADAKIGGPFTLTDQDGRKVSDGDFAGKYRLIYFGYTFCPDVCPVDVQTLMKGYR 93

Query: 85  QVDPTGT----LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
           +V+ +       +   FITVDP RDTP V+K+FV+ F  ++IG++G   ++  VAK F I
Sbjct: 94  KVEASNPALAAKIQPIFITVDPARDTPAVLKQFVRAFHPKLIGLTGSEAEIAAVAKEFAI 153

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
           Y      + S     Y VDH+   +LFD  G  + ++    D+D+    I R
Sbjct: 154 YYKK--QQGSPGTPGYLVDHSRQAMLFDPQGKPLALVAQDKDADTVAADIER 203


>gi|328784752|ref|XP_001122061.2| PREDICTED: protein SCO1 homolog, mitochondrial-like [Apis
           mellifera]
          Length = 285

 Score =  118 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 43/161 (26%), Positives = 82/161 (50%), Gaps = 4/161 (2%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G         L+   G  +       +  +++FGFT+C  +CP  L ++  ++ +++   
Sbjct: 101 GKAAIGGKFELIDSQGKIWKSDDFLGQWVLIYFGFTHCPDICPDELEKMTEIVNKLEKQH 160

Query: 91  T-LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
              +   FI+VDP+RDTPEV+ K+++ FSD+I+G++G    + +V K +R+Y +N   ++
Sbjct: 161 NIKVQPIFISVDPERDTPEVVGKYIKEFSDKILGLTGTKEQIAKVCKAYRVYYSNGPKDQ 220

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
              +  Y VDHT  + L D  G  V        ++  +  +
Sbjct: 221 ---DSDYIVDHTIIIYLIDPDGLFVDYYGLTHTAEQIVHSV 258


>gi|118785805|ref|XP_314900.3| AGAP008774-PA [Anopheles gambiae str. PEST]
 gi|116127910|gb|EAA10098.4| AGAP008774-PA [Anopheles gambiae str. PEST]
          Length = 276

 Score =  118 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 55/199 (27%), Positives = 91/199 (45%), Gaps = 15/199 (7%)

Query: 7   ILGTILLAVLGSIAYVSFSS--------KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
            + T  + VLG + YV            K   G         LV  DG     +    K 
Sbjct: 70  FIATAGIGVLGFMWYVKDEKEQALLRERKRQLGKAAIGGKWDLVDSDGNPRKSADFLGKW 129

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
            +++FGFT+C  +CP  L ++  ++   + +     +   FITVDP+RD+ E++ K+V+ 
Sbjct: 130 LLIYFGFTHCPDICPDELEKMAAVVDNLEKEKDADPVQPIFITVDPQRDSKEIVGKYVKE 189

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS +++G++G    V +V + FR+Y +    ++   +  Y VDHT  + L D  G  V  
Sbjct: 190 FSPKLLGLTGTVEQVAQVCRAFRVYFSAGPKDE---DNDYIVDHTIIMYLIDPNGEFVDY 246

Query: 177 IPYKDDSDSAIEKINRLIT 195
                D +S    I  LI 
Sbjct: 247 YGQNRDKESIKNSI--LIN 263


>gi|91788793|ref|YP_549745.1| electron transport protein SCO1/SenC [Polaromonas sp. JS666]
 gi|91698018|gb|ABE44847.1| electron transport protein SCO1/SenC [Polaromonas sp. JS666]
          Length = 195

 Score =  118 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 54/195 (27%), Positives = 96/195 (49%), Gaps = 2/195 (1%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           +AL +    +L A     A  S     V    R   D  L +  GTD  LS    K  I+
Sbjct: 3   RALPVFFSLLLFAATAGAAASSGLKSGVFEPPRMAPDFSLRSTAGTDLQLSRYRGKLVIL 62

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
            FG+T+C  VCP +L+ L +  +++    + +   F+TVDP+RDT ++++K++  F    
Sbjct: 63  EFGYTSCPNVCPESLAMLAQARQKLGALASQVQVVFVTVDPERDTADLLRKYLAAFDSSF 122

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           +G++G P  + +V +++ I     + E  G +  Y V H++ L   D  GS+ G++P+  
Sbjct: 123 VGVTGTPAQMEKVRQDYGITATKEMVE--GSKTNYAVHHSSYLYFVDRQGSLRGLMPFGR 180

Query: 182 DSDSAIEKINRLITY 196
            +D  +     L+  
Sbjct: 181 TADDIVHDARILLKK 195


>gi|189183848|ref|YP_001937633.1| Sco2 protein precursor [Orientia tsutsugamushi str. Ikeda]
 gi|189180619|dbj|BAG40399.1| Sco2 protein precursor [Orientia tsutsugamushi str. Ikeda]
          Length = 216

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 54/202 (26%), Positives = 89/202 (44%), Gaps = 11/202 (5%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRF----------NSDVHLVAQDGTDFSLSS 53
           L II+G + L  +  +   S        N  +            D  L+  +  +F   S
Sbjct: 16  LSIIIGMLSLYFIFILWPQSKKKVANTDNISYSMVTSSEILLGGDFTLIDTNNREFYSKS 75

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  KP +++FGFT C  VCP TL +L +++K +D     ++  F+TVDPKRD    +K +
Sbjct: 76  LRGKPYLIYFGFTFCPDVCPATLEKLSKVIKVLDMYHIDISTIFVTVDPKRDNASTLKNY 135

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           +  F  +II ++G    +  + K F +Y +            Y +DH+T + L D  G  
Sbjct: 136 MTNFHSKIIALTGTKPQIEDITKKFGVYYSISALSDRNS-NDYLIDHSTFIYLIDKNGKY 194

Query: 174 VGVIPYKDDSDSAIEKINRLIT 195
           +      D  +  IE I   + 
Sbjct: 195 MSHFTLDDTPEKIIEYIRIHLK 216


>gi|114762253|ref|ZP_01441721.1| regulatory protein SenC [Pelagibaca bermudensis HTCC2601]
 gi|114545277|gb|EAU48280.1| regulatory protein SenC [Roseovarius sp. HTCC2601]
          Length = 206

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 46/200 (23%), Positives = 80/200 (40%), Gaps = 17/200 (8%)

Query: 1   MKALG-IILGTILLAVLGSIAYVSFSSKFVDGNRR------------FNSDVHLVAQDGT 47
           M+ +  +    +L+ ++G     +  S   D                      LV   G 
Sbjct: 1   MRWIAAVAATLVLVLLIGGTWLYTRQSAAADPFEPCRSGAIAGGAGQIGGPFELVNAQGE 60

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTP 107
             +   +  +P++++FG+T C  VCP    R    +  ++  G ++   FIT+DP+RDTP
Sbjct: 61  TVTDEDVITEPTLLYFGYTFCPDVCPLDTVRNAEAVDLLEAQGKMVTPVFITIDPERDTP 120

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E +  F     +R+IG++G P  +   ++ +R Y     AE     E Y VDH+T   L 
Sbjct: 121 EAVGDFAHNVHERMIGLTGSPEQIQAASQAYRTYYKKQDAED----EFYLVDHSTFTYLV 176

Query: 168 DTAGSIVGVIPYKDDSDSAI 187
                 V         +   
Sbjct: 177 LPEHGFVEYFRRDKSPEDVA 196


>gi|281351409|gb|EFB26993.1| hypothetical protein PANDA_010113 [Ailuropoda melanoleuca]
          Length = 210

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 90/204 (44%), Gaps = 12/204 (5%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L          + G   +    ++ ++       G         L    G   +    
Sbjct: 5   KSLAFTFAIGGALLAGMKYFKKEKTQKLEKERQRSLGKPLLGGPFSLTTHTGEPKTDKDY 64

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN--AYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  VCP  L ++ +++ ++D   TL N    FIT+DP+RDT E +  
Sbjct: 65  VGQWVLIYFGFTHCPDVCPEELEKMIQVVDEIDNIPTLPNLTPLFITIDPERDTKEAIAN 124

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS +++G++G   ++ +VA+ +R+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 125 YVKEFSPKLVGLTGSKEEIDQVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGQ 181

Query: 173 IVGVIPYKDDSDSAIEKINRLITY 196
            +        +      I   +  
Sbjct: 182 FLDYFGQNKKNAEIAGSIAAHMRE 205


>gi|163868700|ref|YP_001609912.1| sco1/2 family protein [Bartonella tribocorum CIP 105476]
 gi|161018359|emb|CAK01917.1| sco1/2 family protein [Bartonella tribocorum CIP 105476]
          Length = 193

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 69/203 (33%), Positives = 104/203 (51%), Gaps = 17/203 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  I    ++ + G   Y  F +K          +  L   +G   + + +  KPSI
Sbjct: 1   MKNVIRIFSLTVIFLGGVFIYDIFVNK------PLGDNFTLTDSNGKTITEADVRSKPSI 54

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFGFT C  +CPTTL  LDR L  + P    L  +F+TVDP+RDTPEV+ +++  F++ 
Sbjct: 55  IFFGFTMCPEICPTTLMNLDRWLTALGPKADKLGKWFVTVDPERDTPEVLHEYLSNFTNE 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+GISGDP  V ++  +F I    V     G +  Y  DHT A+ L    G + GVI Y+
Sbjct: 115 IVGISGDPEKVHKMVNSFNIVAEKVP----GTDGNYTYDHTAAIFLLKKGGKLAGVIRYE 170

Query: 181 DDSDS-------AIEKINRLITY 196
              D         IE++ +L++ 
Sbjct: 171 PKEDDNELKDEITIERLKKLVSN 193


>gi|302656091|ref|XP_003019802.1| hypothetical protein TRV_06147 [Trichophyton verrucosum HKI 0517]
 gi|291183573|gb|EFE39178.1| hypothetical protein TRV_06147 [Trichophyton verrucosum HKI 0517]
          Length = 206

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 50/167 (29%), Positives = 79/167 (47%), Gaps = 5/167 (2%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ---VD 87
           G  R      L   +G  F+  +L  K S V+FGFT+C  +CP  L ++  ++ +     
Sbjct: 25  GKPRVGGPFVLKDLNGETFTEENLKGKYSFVYFGFTHCPDICPDELDKMAEIIDEVRARS 84

Query: 88  PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLA 147
               ++   FIT DP RD+PEV++ ++  F   IIG++G    V  V + +R+Y +    
Sbjct: 85  NGQEVMRPVFITCDPARDSPEVLRGYLNEFHKDIIGLTGTYEQVKDVCRQYRVYFST--P 142

Query: 148 EKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +     E Y VDH+    L D  G  V  I  +D   +A + I   I
Sbjct: 143 QNIKPGEDYLVDHSIYFYLMDPEGDFVECIGRQDTPQTASKVILDHI 189


>gi|323334518|gb|EGA75892.1| Sco2p [Saccharomyces cerevisiae AWRI796]
          Length = 337

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 53/203 (26%), Positives = 85/203 (41%), Gaps = 13/203 (6%)

Query: 5   GIILGTILLAVLGSIAYVS-----------FSSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
                 +LL   G+ AY+S             +    G+       +L   +G  F+  +
Sbjct: 80  WKATIALLLLSGGTYAYLSRKRRLLETEKEADANRAYGSVALGGPFNLTDFNGKPFTEEN 139

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKK 112
           L  K SI++FGF++C  +CP  L RL   + +  D     +   FI+ DP RDTP+V+K+
Sbjct: 140 LKGKFSILYFGFSHCPDICPEELDRLTYWISELDDKDHIKIQPLFISCDPARDTPDVLKE 199

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           ++  F   IIG++G    V +  +                 + Y VDH+    L D  G 
Sbjct: 200 YLSDFHPAIIGLTGTYDQVKKRMQK-NTRYIFSTPRDVKPNQDYLVDHSIFFYLIDPEGQ 258

Query: 173 IVGVIPYKDDSDSAIEKINRLIT 195
            +  +    D  S +EKI   I 
Sbjct: 259 FIDALGRNYDEQSGLEKIREQIQ 281


>gi|50285463|ref|XP_445160.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524463|emb|CAG58060.1| unnamed protein product [Candida glabrata]
          Length = 282

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 51/199 (25%), Positives = 94/199 (47%), Gaps = 19/199 (9%)

Query: 10  TILLAVLGSIAYVSFSS-------------KFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
            + L   GS+ Y   ++               + G +       LV  +G  F+  +L  
Sbjct: 65  ALGLIAAGSLTYYYVNNERKLLQTEKEQEANRLYGEKFVGGPFRLVDTEGRSFTEKNLEG 124

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           K S+++FGFT+C  +CP  L +++  +  ++  G  +   FIT DP RDTPEV+K++++ 
Sbjct: 125 KFSLLYFGFTHCPDICPEELDKMNDWIIGLESKGLSVQPIFITCDPIRDTPEVVKEYLKD 184

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV-- 174
           F+  +IG++G    +  V K +++Y +    E +  +  Y VDH+    L D  G+ +  
Sbjct: 185 FNPGMIGLTGTYEAIKDVCKKYKVYFST--PENADPKSDYLVDHSIFFYLIDPEGNFIDA 242

Query: 175 --GVIPYKDDSDSAIEKIN 191
              +   K   +  I+ I 
Sbjct: 243 LGRIYDEKSGLEKIIQNIK 261


>gi|301615151|ref|XP_002937049.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Xenopus
           (Silurana) tropicalis]
          Length = 315

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 82/172 (47%), Gaps = 5/172 (2%)

Query: 27  KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQV 86
           K   G         L+  +G   +      +  +++FGFT+C  +CP  + ++  ++ ++
Sbjct: 142 KRSLGKPLLGGPFSLIDHNGQPKTDKDYLGQWVLLYFGFTHCPDICPEEIEKMILVVDEI 201

Query: 87  DPTGTLLN--AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
           D   TL N    FIT+DP+RD+ + +  +V+ FS ++IG++G    + +VAK +R+Y ++
Sbjct: 202 DKIPTLPNLTPLFITIDPERDSKDAVANYVKEFSPKLIGLTGSSEQIEKVAKAYRVYFSS 261

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
              ++   +  Y VDHT  + L    GS V        +      I   +  
Sbjct: 262 GPKDE---DNDYIVDHTIIMYLLAPDGSFVDYYGQNKRNAEISSSIASHMRN 310


>gi|297567294|ref|YP_003686266.1| electron transport protein SCO1/SenC [Meiothermus silvanus DSM
           9946]
 gi|296851743|gb|ADH64758.1| electron transport protein SCO1/SenC [Meiothermus silvanus DSM
           9946]
          Length = 213

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 50/179 (27%), Positives = 85/179 (47%), Gaps = 8/179 (4%)

Query: 21  YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLD 80
           Y  + +  ++    +  D  L    G  F LSS   K  ++FFGF NC  VCPTTL  L 
Sbjct: 40  YQPYGTPLLNPRAAY--DFTLTDNKGKPFRLSSQRGKVVLIFFGFVNCPDVCPTTLLELK 97

Query: 81  RLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
           ++ +         +    I+VDP+RDTPEV+ K+V  F    IG++G P  +  VAK + 
Sbjct: 98  KVYQALTPEERRRVQVVMISVDPERDTPEVLDKYVTFFDSSFIGLTGTPQQIAEVAKPYG 157

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS--AIEKINRLITY 196
           ++       +    ++Y VDHT +  L D  G++  +      +++   ++ +   +  
Sbjct: 158 VFYQK---SEIKSAKQYNVDHTASTYLIDPKGALRLIYGNGKPAETQRMVQDVRWALKN 213


>gi|163846396|ref|YP_001634440.1| electron transport protein SCO1/SenC [Chloroflexus aurantiacus
           J-10-fl]
 gi|222524163|ref|YP_002568634.1| electron transport protein SCO1/SenC [Chloroflexus sp. Y-400-fl]
 gi|163667685|gb|ABY34051.1| electron transport protein SCO1/SenC [Chloroflexus aurantiacus
           J-10-fl]
 gi|222448042|gb|ACM52308.1| electron transport protein SCO1/SenC [Chloroflexus sp. Y-400-fl]
          Length = 197

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 51/199 (25%), Positives = 90/199 (45%), Gaps = 3/199 (1%)

Query: 1   MKALGIILGTILLA-VLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           M+    I   +++     +++    ++  +       SD  L A  G D  LS L  +P 
Sbjct: 1   MRRFLFICWIVMICTACSAVSPPGTTTATIIDPPTVLSDFQLPASTGHDLRLSDLRGQPV 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +++FG+T C   CP TLS   R  +Q+   G  ++   I+VDP  DTPEV+  +++ F +
Sbjct: 61  LLYFGYTRCPDYCPITLSEFRRTREQLGADGEKVHFVLISVDPAHDTPEVLAAYLRGFGE 120

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
             IG+ GD   + R++K + +                 V+H+TA  L D  G +  V  Y
Sbjct: 121 GFIGLQGDDATLRRISKEYGLTYR--HGGGHQQHGDAGVEHSTASYLIDQNGRLRIVYQY 178

Query: 180 KDDSDSAIEKINRLITYGN 198
              ++  ++ I  L+    
Sbjct: 179 GTAANVYVQDIRDLLKEAQ 197


>gi|157825968|ref|YP_001493688.1| sco2 protein precursor [Rickettsia akari str. Hartford]
 gi|157799926|gb|ABV75180.1| sco2 protein precursor [Rickettsia akari str. Hartford]
          Length = 205

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 46/163 (28%), Positives = 87/163 (53%), Gaps = 2/163 (1%)

Query: 30  DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT 89
           + N     D  L+ Q+G  F+  +L    S+V+FGFT+C  +CPT+L+ + ++++ ++  
Sbjct: 44  EDNVNIGGDFELIDQNGEIFNSETLKGNLSLVYFGFTSCPDICPTSLNNMTKIVEILNKH 103

Query: 90  GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
              +   FIT+DPKRDTPEV+K++++ F  + IG++G+   +  VA  F+++   V  + 
Sbjct: 104 KIDILPIFITIDPKRDTPEVLKEYLKHFHPKFIGLTGNEQQIKDVADKFKVFYARVNGDD 163

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
              +  Y +DH++   L D  G  +            +E +  
Sbjct: 164 --DDPNYMLDHSSFTYLIDANGKYLKHFYLDSSPKDIMEFLRN 204


>gi|118161430|gb|ABK64111.1| putative electron chain protein [Janthinobacterium lividum]
          Length = 198

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 54/199 (27%), Positives = 93/199 (46%), Gaps = 10/199 (5%)

Query: 1   MKALGIIL----GTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           MK    +L    G + LA         ++   + G   +  D  L   DG  ++L+    
Sbjct: 1   MKRRLFLLAGTAGLLTLAACEQAPKPHYNGLDLTGG-DYKPDFKLSGPDGKVYTLADFKG 59

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           K  +VFFGFT C  VCPT LSR   + +++   G  L   FI++DP+RDTP ++ ++++ 
Sbjct: 60  KYVMVFFGFTQCPDVCPTALSRALEIRQKLGADGDKLQVIFISIDPERDTPALLGEYMRA 119

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F    +G+  DP    + A N++++   V          Y +DHT    + DT G +   
Sbjct: 120 FDPSFLGLRTDPQATAQTAFNYKVFYRRVP-----SGSSYTMDHTAISYVLDTEGRMRLG 174

Query: 177 IPYKDDSDSAIEKINRLIT 195
           + ++   D  ++ I  L+ 
Sbjct: 175 LKHQLTGDECVQDIKTLMK 193


>gi|4759068|ref|NP_004580.1| protein SCO1 homolog, mitochondrial precursor [Homo sapiens]
 gi|8134663|sp|O75880|SCO1_HUMAN RecName: Full=Protein SCO1 homolog, mitochondrial; Flags: Precursor
 gi|9963787|gb|AAG09693.1|AF183424_1 SCO1/2 protein [Homo sapiens]
 gi|3599966|gb|AAD08641.1| h-sco1 [Homo sapiens]
 gi|10834819|gb|AAG23836.1| cytochrome oxidase deficient in yeast homolog 1 [Homo sapiens]
 gi|15930128|gb|AAH15504.1| SCO cytochrome oxidase deficient homolog 1 (yeast) [Homo sapiens]
 gi|119610403|gb|EAW89997.1| SCO cytochrome oxidase deficient homolog 1 (yeast) [Homo sapiens]
 gi|123981404|gb|ABM82531.1| SCO cytochrome oxidase deficient homolog 1 (yeast) [synthetic
           construct]
 gi|123996245|gb|ABM85724.1| SCO cytochrome oxidase deficient homolog 1 (yeast) [synthetic
           construct]
 gi|189054983|dbj|BAG37967.1| unnamed protein product [Homo sapiens]
          Length = 301

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 47/200 (23%), Positives = 89/200 (44%), Gaps = 10/200 (5%)

Query: 3   ALGIILGTILLAVL-----GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           A+   +G  LLA +          +    +   G         L    G   +      +
Sbjct: 99  AITFAIGGALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYLGQ 158

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN--AYFITVDPKRDTPEVMKKFVQ 115
             +++FGFT+C  VCP  L ++ +++ ++D   TL +    FI++DP+RDT E +  +V+
Sbjct: 159 WLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVK 218

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            FS +++G++G   +V +VA+ +R+Y +    ++   +E Y VDHT  + L    G  + 
Sbjct: 219 EFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGEFLD 275

Query: 176 VIPYKDDSDSAIEKINRLIT 195
                         I   + 
Sbjct: 276 YFGQNKRKGEIAASIATHMR 295


>gi|114769720|ref|ZP_01447330.1| regulatory protein SenC [alpha proteobacterium HTCC2255]
 gi|114549425|gb|EAU52307.1| regulatory protein SenC [alpha proteobacterium HTCC2255]
          Length = 199

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 46/197 (23%), Positives = 86/197 (43%), Gaps = 14/197 (7%)

Query: 2   KALGIILGTILLAVLGSIAYVSF--------SSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
           K   I+   I++  L +++Y SF        SS    G         LV  +G + +   
Sbjct: 3   KYFTILFSGIVVLTLATMSYFSFWVDGKACGSSVVAGGQGSIGGSFELVDHNGVEVTEKD 62

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           +    ++++FG+T C  +CP    R    +  +D  G  +   FIT+DP+RD    +  +
Sbjct: 63  VINGLTLIYFGYTYCPDICPLDTQRNLTTVDILDEQGVDITPVFITIDPERDNISALNDY 122

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           VQ   +R+IG++G    +   +K ++ +        +G  E Y +DH+T   L D +G  
Sbjct: 123 VQASHERLIGLTGSLEQIQTASKAYKTFFRK-----NGDGEDYLLDHSTFSYLMDKSG-F 176

Query: 174 VGVIPYKDDSDSAIEKI 190
           +       + +   + I
Sbjct: 177 LQFFRRDLEPEEVAKTI 193


>gi|291415387|ref|XP_002723934.1| PREDICTED: cytochrome oxidase deficient homolog 2-like [Oryctolagus
           cuniculus]
          Length = 261

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 42/161 (26%), Positives = 82/161 (50%), Gaps = 5/161 (3%)

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLN 94
            D HL+   G     +    +  +V+FGFT+C  +CP  L +L ++++  + +P    + 
Sbjct: 95  GDFHLLDHHGRARCKADFRGQWVLVYFGFTHCPDICPDELEKLVQVVRRLEAEPGLPAVQ 154

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FITVDP+RD    M ++VQ F  R++G++G    V +V++++R+Y +    ++   ++
Sbjct: 155 PVFITVDPERDDVSAMARYVQDFHPRLLGLTGSAEQVAQVSRSYRVYYSAGPKDE---DQ 211

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            Y VDH+ A+ L    G           ++   + + R + 
Sbjct: 212 DYIVDHSIAIYLLSPDGLFTDYYGRGRSAEQIADSVRRHMA 252


>gi|157428110|ref|NP_001098963.1| protein SCO2 homolog, mitochondrial precursor [Bos taurus]
 gi|215274637|sp|A6H784|SCO2_BOVIN RecName: Full=Protein SCO2 homolog, mitochondrial; Flags: Precursor
 gi|148877402|gb|AAI46151.1| SCO2 protein [Bos taurus]
 gi|296486847|gb|DAA28960.1| SCO cytochrome oxidase deficient homolog 2 precursor [Bos taurus]
          Length = 266

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 45/202 (22%), Positives = 96/202 (47%), Gaps = 16/202 (7%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRF-----------NSDVHLVAQDGTDFSLSSLY 55
           +L T L+      A+++  ++   G ++              D  L+   G     +   
Sbjct: 61  LLVTALVGAGLGGAWLALRAEKERGRQQQRTEALRQAAVGQGDFSLLDHRGRVRCKADFR 120

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
            +  +++FGFT+C  +CP  L +L ++++  + +P    +   FITVDP+RDT   M ++
Sbjct: 121 GQWVLLYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPLFITVDPERDTVAAMARY 180

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           VQ F  R++G++G    + +V++++R+Y +    ++   ++ Y VDH+ A+ L    G  
Sbjct: 181 VQDFHPRLLGLTGSAEQIAQVSRSYRVYYSAGPKDE---DQDYIVDHSIAIYLLSPDGLF 237

Query: 174 VGVIPYKDDSDSAIEKINRLIT 195
                    ++   + + R + 
Sbjct: 238 TDYYSRARSAEQITDSVRRHMA 259


>gi|254471648|ref|ZP_05085049.1| electron transport protein SCO1/SenC [Pseudovibrio sp. JE062]
 gi|211958850|gb|EEA94049.1| electron transport protein SCO1/SenC [Pseudovibrio sp. JE062]
          Length = 200

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 55/161 (34%), Positives = 91/161 (56%), Gaps = 4/161 (2%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
           +      LV   G  F+  +L  KP+++FFGFT C  VCPTTLS +   ++ + P    L
Sbjct: 42  QIGGPFELVDGKGQVFTDKNLNGKPTLMFFGFTYCPDVCPTTLSDMQGWIENLGPKADDL 101

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
           N  F++VDP+RDTP+V+  +V  F  R++ ++G    V +V K++R+Y   V  +     
Sbjct: 102 NFVFVSVDPERDTPDVIADYVAAFDTRVVPLTGSVDQVKKVVKDYRVYARKVPLDD---- 157

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
             Y +DHT A+ + +     VG I Y++  ++A+ KI +L+
Sbjct: 158 GDYTMDHTAAVYMLNGDLDFVGTISYQEPEETALPKIRKLL 198


>gi|83950799|ref|ZP_00959532.1| regulatory protein SenC [Roseovarius nubinhibens ISM]
 gi|83838698|gb|EAP77994.1| regulatory protein SenC [Roseovarius nubinhibens ISM]
          Length = 207

 Score =  117 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 54/200 (27%), Positives = 91/200 (45%), Gaps = 12/200 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDF 49
           M     +L    +A++  + Y     +  D           G  +      LV + GT+ 
Sbjct: 1   MTRFIAVLAACTIAIVLGVTYFLTKGRGGDLASCGASSVAGGADQIGGPFTLVDETGTEV 60

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEV 109
           + ++L  KPS+++FG+T C  VCP   +R    +  +   G  +   FIT+DPKRDTPEV
Sbjct: 61  TSAALLTKPSLIYFGYTFCPDVCPLDAARNAEAVDMLAERGIEVQPIFITIDPKRDTPEV 120

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           + ++      ++IG++G    V   ++ +R Y     AE +G E+ Y VDH+T   L   
Sbjct: 121 LAEYTDFLHPKMIGLTGSEAQVKAASQAYRTYYKAQPAE-AGQEDFYLVDHSTFTYLTLP 179

Query: 170 AGSIVGVIPYKDDSDSAIEK 189
               V     +  ++   EK
Sbjct: 180 ETGFVEFFRREVSAEDMAEK 199


>gi|290981794|ref|XP_002673616.1| predicted protein [Naegleria gruberi]
 gi|284087201|gb|EFC40872.1| predicted protein [Naegleria gruberi]
          Length = 605

 Score =  117 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 50/217 (23%), Positives = 85/217 (39%), Gaps = 25/217 (11%)

Query: 2   KALGIILGTILLAVLGSIAY-------------------VSFSSKFVDGNRRFNSDVHLV 42
           K L      IL AV G + Y                    S  +    G  +      LV
Sbjct: 386 KRLFSPANLILPAVFGIVLYNFASYDVRQKKREAELEKQASSKAVKAVGAPKLGGAFTLV 445

Query: 43  AQDGTDFSLSSLYIKPSIVFFGFTNCSAVCP----TTLSRLDRLLKQVDPTGTLLNAYFI 98
              G   + S    K   ++FGFTNC  VCP         L ++ K+       +   F+
Sbjct: 446 NTKGEVVTDSEFRGKFMFMYFGFTNCPDVCPTEMKKMTKALQKIEKENPELADKIVPVFV 505

Query: 99  TVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFV 158
           + DP RD+   + +++Q +  R +G++G P  + R+ K +R+Y N    ++    + Y V
Sbjct: 506 SCDPPRDSCTAVIEYLQDYHPRFVGLTGTPDQISRICKKYRVYYNAPDYKE--GSQDYLV 563

Query: 159 DHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           DH+  + L D  G +         +D   E ++  + 
Sbjct: 564 DHSIFIYLMDPYGHLSEYFAQNTTADKIYESVSTALK 600


>gi|83312186|ref|YP_422450.1| hypothetical protein amb3087 [Magnetospirillum magneticum AMB-1]
 gi|82947027|dbj|BAE51891.1| SCO2-like protein RC0895 [Magnetospirillum magneticum AMB-1]
          Length = 202

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/175 (26%), Positives = 79/175 (45%), Gaps = 2/175 (1%)

Query: 27  KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQV 86
                +R  +    L   +G   S  S   K  +V FG+T C  +CPT L+ L   L+Q+
Sbjct: 30  AQPVEDRPISGRFLLTDMNGRAVSDESYRGKIRVVTFGYTFCPDICPTILNTLSVALEQL 89

Query: 87  DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVL 146
                 +   FI+VDP+RDTP  +K+++      I G+SG P  V   A+NF++      
Sbjct: 90  GADRAKVATLFISVDPERDTPAHLKEYL-NAFPEITGLSGTPEQVAAAARNFKVRYER-Q 147

Query: 147 AEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNVVK 201
                    Y VDH+ ++ + D  G+ +  +P+    D   E++   +    V +
Sbjct: 148 QPDGSDPSVYAVDHSASIYIMDREGNFLARMPHLSAPDRVAERVRSYLAPSRVER 202


>gi|319945285|ref|ZP_08019547.1| Sco1/SenC family protein [Lautropia mirabilis ATCC 51599]
 gi|319741855|gb|EFV94280.1| Sco1/SenC family protein [Lautropia mirabilis ATCC 51599]
          Length = 211

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 56/196 (28%), Positives = 96/196 (48%), Gaps = 7/196 (3%)

Query: 3   ALGIILGTIL--LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVA-QDGTDFSLSSLYIKPS 59
           AL +  G ++  LA       ++F S  + G   + +++ L     G   +L+S      
Sbjct: 19  ALWLGGGALMGSLAACSKEKGMTFKSTDL-GGADYGNELSLTDVSTGKPVTLASFKDHVV 77

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           ++FFGFT C  +CPTTL +   +   + P G  L+  F+T+DP+RDT EV+  +V  F  
Sbjct: 78  LLFFGFTQCPDICPTTLLKAKEIRDALGPDGKRLDVVFVTLDPERDTAEVLPAYVHSFDP 137

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
             I + GD     +VA+ FR++   V  +       Y +DHT A  + D  G +  ++ Y
Sbjct: 138 SFIALRGDMAATKKVAREFRVFFQKVPNQD---GSSYTLDHTAASYVIDKTGKLRLLVRY 194

Query: 180 KDDSDSAIEKINRLIT 195
            D  D+ +  + +L+ 
Sbjct: 195 TDPVDNVVSDLKQLLA 210


>gi|239947200|ref|ZP_04698953.1| cytochrome c oxidase Cu [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921476|gb|EER21500.1| cytochrome c oxidase Cu [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 205

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/162 (27%), Positives = 83/162 (51%), Gaps = 2/162 (1%)

Query: 30  DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT 89
           + N +   D  L  Q+G  F+   L    S+++FGFT+C  +CPT L+++  +++ +   
Sbjct: 44  EDNVKIGGDFELTDQNGKIFNSDKLQGNLSLIYFGFTSCPDICPTFLNKMTEIVENLSKH 103

Query: 90  GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
              +   FIT+DPKRDTPEV+K++++ F  + IG++G+   +  V   F+++   V  + 
Sbjct: 104 NIDILPVFITIDPKRDTPEVLKEYLKHFHPKFIGLTGNEQQIKDVTDKFKVFYARVNGDD 163

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKIN 191
              +  Y +DH++   L D  G  +            +E + 
Sbjct: 164 --DDPNYMLDHSSFTYLIDANGKYLKHFYLDSSPKEIMEFLK 203


>gi|114669051|ref|XP_001164786.1| PREDICTED: cytochrome oxidase deficient homolog 1 isoform 4 [Pan
           troglodytes]
          Length = 301

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 88/195 (45%), Gaps = 10/195 (5%)

Query: 3   ALGIILGTILLAVL-----GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           A+   +G  LLA +          +    +   G         L    G   +      +
Sbjct: 99  AITFAIGGALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYLGQ 158

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN--AYFITVDPKRDTPEVMKKFVQ 115
             +++FGFT+C  VCP  L ++ +++ ++D   TL +    FI++DP+RDT E +  +V+
Sbjct: 159 WLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVK 218

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            FS +++G++G   +V +VA+ +R+Y +    ++   +E Y VDHT  + L    G  + 
Sbjct: 219 EFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGEFLD 275

Query: 176 VIPYKDDSDSAIEKI 190
                         I
Sbjct: 276 YFGQNKRKGEIAASI 290


>gi|310815807|ref|YP_003963771.1| SCO1/2 family protein [Ketogulonicigenium vulgare Y25]
 gi|308754542|gb|ADO42471.1| SCO1/2 family protein [Ketogulonicigenium vulgare Y25]
          Length = 199

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 58/183 (31%), Positives = 90/183 (49%), Gaps = 4/183 (2%)

Query: 13  LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           +  +G+    S + +    +     D  L   +G   + +    +P++VFFGFT C  VC
Sbjct: 21  MLAIGAWRSQSAAPQSPRPDAITQMDWQLTDHNGATVTPADWIGRPTLVFFGFTWCPDVC 80

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVM 132
           PTTL  +   L+ + P    L    ITVDP RDTPEV+  +V  F  RI G++G P  + 
Sbjct: 81  PTTLMDISGWLEDLGPEADALRVVLITVDPARDTPEVLANYVGLFDPRITGLTGAPDQIA 140

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
             A++FR+    V  E       Y +DHT  + LF   G    +I + +D   A+ KI +
Sbjct: 141 AAAQHFRVRYTRVARED----GDYTMDHTAGVFLFHADGRFGRIIDFHEDRAFAVPKIRQ 196

Query: 193 LIT 195
           ++T
Sbjct: 197 VLT 199


>gi|254476891|ref|ZP_05090277.1| regulatory protein SenC [Ruegeria sp. R11]
 gi|214031134|gb|EEB71969.1| regulatory protein SenC [Ruegeria sp. R11]
          Length = 206

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/166 (28%), Positives = 74/166 (44%), Gaps = 4/166 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           SS+   G         L+   G   +   +  KPS+V+FG+T C  VCP  +SR    + 
Sbjct: 38  SSQIAGGADTIGGPFELLNAKGETVTDKDVITKPSLVYFGYTFCPDVCPLDVSRNAETID 97

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            +D  G  +   FI+VDP RDTPEV+  F     +R+IG++G    V   +K ++ Y   
Sbjct: 98  VLDERGYDVTPVFISVDPARDTPEVVGDFAANLHERMIGLTGSDEQVRAASKAYKTYFKR 157

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
              +     + Y VDH+T   L       V      +  +   +K+
Sbjct: 158 HEDD----GDYYLVDHSTFTYLVLPEQGFVEFFRRDETPEQIADKV 199


>gi|260431939|ref|ZP_05785910.1| protein SenC [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415767|gb|EEX09026.1| protein SenC [Silicibacter lacuscaerulensis ITI-1157]
          Length = 207

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/206 (21%), Positives = 87/206 (42%), Gaps = 15/206 (7%)

Query: 2   KALGIILGTILLAVLGSIAYVSF-----------SSKFVDGNRRFNSDVHLVAQDGTDFS 50
           +   I+   +L+  LG+I  ++            SS+   G+        L+   G   +
Sbjct: 3   RLYAILATVVLVLGLGAIWLMTRGGPEDKYAQCRSSQIAGGSATIGGPFELINSKGETVT 62

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
              +  +PS+++FG+T C  VCP   +R    +  +   G  +   FI++DP RDTPE +
Sbjct: 63  DKDVITEPSLIYFGYTFCPDVCPLDTARNAEAVDILAERGYSVTPIFISIDPDRDTPEAV 122

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
             F     +++IG++G P  V   +K ++ Y       +   +E Y VDH+T        
Sbjct: 123 GDFAYNLHEKMIGLTGTPEQVKAASKAYKTYYK----AQDKSDEYYLVDHSTFTYFVTPE 178

Query: 171 GSIVGVIPYKDDSDSAIEKINRLITY 196
              +      D ++   +++   +  
Sbjct: 179 EGFLEFFKRDDTAEQMADRVACFLDR 204


>gi|83953052|ref|ZP_00961774.1| regulatory protein SenC [Sulfitobacter sp. NAS-14.1]
 gi|83842020|gb|EAP81188.1| regulatory protein SenC [Sulfitobacter sp. NAS-14.1]
          Length = 197

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 50/194 (25%), Positives = 81/194 (41%), Gaps = 13/194 (6%)

Query: 6   IILGTILLAVLGSIAY---------VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           +++    LAV   + Y             +  V G         LV   G   + + +  
Sbjct: 1   MLVVLAFLAVSLMLVYRTDGDSDKYAQCKNSAVAGGAELGGPFELVNAQGQTVTDADVIT 60

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           +PS+V+FG+T C  VCP  + R  R + +++  G  +   FI+VDP RDTPEV+  F   
Sbjct: 61  EPSLVYFGYTFCPDVCPLDVDRNARAVDELEARGMSVTPVFISVDPARDTPEVVGDFAAN 120

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
              ++IG++G P  V   +  +R Y      E     + Y VDH+T   L       V  
Sbjct: 121 MHPKMIGLTGSPAQVKAASDAYRTYYKAHEDE----GDDYLVDHSTFSYLVMPGEGFVDF 176

Query: 177 IPYKDDSDSAIEKI 190
                  +   +K+
Sbjct: 177 FRRDVPPEQLADKV 190


>gi|49474443|ref|YP_032485.1| sco1/2 family protein [Bartonella quintana str. Toulouse]
 gi|49239947|emb|CAF26352.1| sco1/2 family protein [Bartonella quintana str. Toulouse]
          Length = 193

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 111/203 (54%), Gaps = 17/203 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  ILG  ++ +     Y +F +K          +  L+  +G   +   +  KPSI
Sbjct: 1   MKNVIRILGITIIFLASIFIYDAFRNK------PLGDNFTLIDSNGKTITEVDIRNKPSI 54

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT C   CPTTL+ LDR L ++ P    L  +F+TVDP+RDTPEV+ +++  F+++
Sbjct: 55  VFFGFTMCPESCPTTLTNLDRWLTELGPNADKLGVWFVTVDPERDTPEVLHEYLSNFTNK 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY- 179
           IIGISGDP  V ++  +F I    V     G +  Y  +HT A+ L    G + GVIPY 
Sbjct: 115 IIGISGDPEKVHKMVDSFNIVAEKVP----GADGSYTYNHTAAIFLLKKGGKLAGVIPYK 170

Query: 180 -KDDSDSA-----IEKINRLITY 196
            ++++D       IE+  +LI+ 
Sbjct: 171 IEENNDELKDNIAIERFKKLISN 193


>gi|324516455|gb|ADY46535.1| Protein SCO1 [Ascaris suum]
          Length = 310

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 50/195 (25%), Positives = 84/195 (43%), Gaps = 9/195 (4%)

Query: 5   GIILGTILLAVLGSI-----AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
            + +G + LA L  +     A      K + G  R      L+  DG       L     
Sbjct: 100 TLTVGGVALAALLYMREKRTAENEKRRKLMAGKARIGGPWELLNTDGKLEGSEQLKGNWL 159

Query: 60  IVFFGFTNCSAVCPTTLSRLD---RLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           +++FGFT+C  +CP  + ++     +L         +   FI+VDP+RDT E +K++   
Sbjct: 160 LIYFGFTHCPDICPDEIEKMIKVVDILDADPQKKFSIIPVFISVDPERDTIERVKEYCLE 219

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS ++ G +G    V +VAK FR+Y +     K+   + Y VDH+  + L D  G+    
Sbjct: 220 FSPKLRGYTGSREQVDKVAKTFRVYYSQGPRSKNA-PDDYIVDHSVIMYLVDPDGNFHDY 278

Query: 177 IPYKDDSDSAIEKIN 191
                + +     I 
Sbjct: 279 YGQNRNENEIANVIK 293


>gi|195035207|ref|XP_001989069.1| GH10243 [Drosophila grimshawi]
 gi|193905069|gb|EDW03936.1| GH10243 [Drosophila grimshawi]
          Length = 262

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 56/205 (27%), Positives = 90/205 (43%), Gaps = 14/205 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSS--------KFVDGNRRFNSDVHLVAQDGTDFSLSS 53
           K+L +I G +    LG + YV            K   G         LV   G       
Sbjct: 51  KSLAVI-GVLGAGGLGFMLYVKSEKDEALMKERKRQLGKAAIGGRWELVDDKGQVRKSED 109

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL--NAYFITVDPKRDTPEVMK 111
              K  +++FGFT+C  +CP  L ++  ++ +V+ +         FITVDP+RD+ EV+ 
Sbjct: 110 FVGKWLLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPEVQPIFITVDPERDSKEVVG 169

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
           K+V+ FS +++G++G    +  V K FR+Y +    +    +  Y VDHT  + L +  G
Sbjct: 170 KYVKEFSPKLLGLTGTVDQIRNVCKAFRVYFSAGPRD---SDNDYIVDHTIIMYLVNPDG 226

Query: 172 SIVGVIPYKDDSDSAIEKINRLITY 196
             V       D D  +  I   I  
Sbjct: 227 EFVDYYGQNRDKDQCVSSILVNIAK 251


>gi|255723008|ref|XP_002546438.1| protein SCO1, mitochondrial precursor [Candida tropicalis MYA-3404]
 gi|240130955|gb|EER30517.1| protein SCO1, mitochondrial precursor [Candida tropicalis MYA-3404]
          Length = 300

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 52/171 (30%), Positives = 82/171 (47%), Gaps = 6/171 (3%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI----KPSIVFFGFTNCSAVCPTTLSRLDR 81
           +    G         L   +G  F+  +L      + SI++FGFT+C  VCP  L +L  
Sbjct: 108 ANKTIGTPAVGGPFTLQDTEGNKFTHENLVDPNMKRFSILYFGFTHCPDVCPEELDKLGD 167

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           +L Q+   G  +   FIT DP RDTP V++ ++  F   I+G++G    V    K +R+Y
Sbjct: 168 ILDQLKTKGIEMQPVFITCDPARDTPAVLRAYLDDFHSGIVGLTGTYDQVKNCCKKYRVY 227

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
            +     K    + Y VDH+    L D  G+ V VI  +   D ++ KI++
Sbjct: 228 FSTPPDVK--PGQDYLVDHSIFFYLIDPEGNFVDVIGRESGVDESVLKISK 276


>gi|119387148|ref|YP_918203.1| electron transport protein SCO1/SenC [Paracoccus denitrificans
           PD1222]
 gi|119377743|gb|ABL72507.1| electron transport protein SCO1/SenC [Paracoccus denitrificans
           PD1222]
          Length = 210

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 68/205 (33%), Positives = 109/205 (53%), Gaps = 15/205 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSF---------SSKFVDGNRRFN-SDVHLVAQDGTDFS 50
           +K L   L  +++  L  + +  F          S    G       +  L A DGT+FS
Sbjct: 10  LKPLRYALWALVVLALAGLGWFQFVSPRTGSGSGSVADAGAAALGRGEYRLTATDGTEFS 69

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
            ++L  +PS VFFGFT+C  VCPTTL  +    +++   G  L  +F+TVDP+RDT E +
Sbjct: 70  QAALKGQPSAVFFGFTHCPDVCPTTLGDVASWQEELGEDGKNLRVFFVTVDPERDTVEAL 129

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           +++V  +   ++G+SG P +V +  K FRIY      E       Y +DH++ +LLFD  
Sbjct: 130 REYV-SWVPGVLGVSGTPEEVAKAIKAFRIYARKSPLE----GGDYTMDHSSTMLLFDGN 184

Query: 171 GSIVGVIPYKDDSDSAIEKINRLIT 195
           G   G+I Y++D + A+  + RL++
Sbjct: 185 GDYAGLIGYQEDRERALASLRRLLS 209


>gi|87120334|ref|ZP_01076229.1| Electron transport protein [Marinomonas sp. MED121]
 gi|86164437|gb|EAQ65707.1| Electron transport protein [Marinomonas sp. MED121]
          Length = 199

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 55/195 (28%), Positives = 95/195 (48%), Gaps = 5/195 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI-KPSIVF 62
           L  ++G  LLA LG+  +   ++K          +  LV  +G    LS     K  ++F
Sbjct: 8   LLFLMGVALLAGLGTALFNDKAAKPNGTFASLGGEFELVGNNG-AVKLSDFRDDKLVLMF 66

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FGFT+C  VCP +L+ + R +KQ        +   F+++DPKRDTP+++  +V  F++  
Sbjct: 67  FGFTHCPDVCPISLTNVARAIKQLAPEQAEQVQGMFVSLDPKRDTPDILANYVSFFNENF 126

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           IG++G    V +V + +      V  + S +   Y VDH++ L L D  G +V ++ +  
Sbjct: 127 IGVTGTKSQVDKVVQQYGAVYRIVELDDSAMG--YSVDHSSRLYLIDKKGELVKLLYHDS 184

Query: 182 DSDSAIEKINRLITY 196
             D   + I   +  
Sbjct: 185 KPDEIAQAIVATLAQ 199


>gi|68479050|ref|XP_716459.1| hypothetical protein CaO19.7325 [Candida albicans SC5314]
 gi|46438128|gb|EAK97464.1| hypothetical protein CaO19.7325 [Candida albicans SC5314]
 gi|238880306|gb|EEQ43944.1| protein SCO1, mitochondrial precursor [Candida albicans WO-1]
          Length = 301

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/171 (30%), Positives = 81/171 (47%), Gaps = 6/171 (3%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI----KPSIVFFGFTNCSAVCPTTLSRLDR 81
           +    G         L    G  F+  +L      + SI++FGFT+C  VCP  L +L  
Sbjct: 109 ANKSIGTPLIGGPFTLQDTKGNKFTEQNLVDPNNKRFSILYFGFTHCPDVCPEELDKLGD 168

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           +L ++   G  +   FIT DP RDTPEV+  +++ F   IIG++G    V    K FR+Y
Sbjct: 169 MLDKLAKDGIPIQPVFITCDPARDTPEVLDAYLKDFHPGIIGLTGTFEQVKNTCKKFRVY 228

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
            +     K    + Y VDH+    L D  G+ V VI  + ++  +  KI +
Sbjct: 229 FSTPPDVK--PGQDYLVDHSIFFYLIDPEGNFVDVIGRESEALESATKIAK 277


>gi|229586925|ref|YP_002845426.1| Sco2 protein precursor [Rickettsia africae ESF-5]
 gi|228021975|gb|ACP53683.1| Sco2 protein precursor [Rickettsia africae ESF-5]
          Length = 206

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/163 (25%), Positives = 84/163 (51%), Gaps = 2/163 (1%)

Query: 30  DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT 89
           + N +   D  L+ Q+G  F+   L    S+++FGFT+C  +CPT+L+++  +++ ++  
Sbjct: 45  EDNVKIGGDFELIDQNGEIFNSDKLKGNLSLIYFGFTSCPDICPTSLNKMTEIVEILNKH 104

Query: 90  GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
              +   FIT+DPKRDTP  +K++++ F  + IG++G+   +  V   F+++   V  + 
Sbjct: 105 KIDILPVFITIDPKRDTPIALKEYLKHFHPKFIGLTGNEQQIKDVTDKFKVFYARVHGDD 164

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
              +  Y +DH++   L D  G  +            +E +  
Sbjct: 165 --DDPNYMLDHSSFTYLIDANGKYLKHFYLDSSPKEMMEFLRN 205


>gi|49475842|ref|YP_033883.1| sco1/2 family protein [Bartonella henselae str. Houston-1]
 gi|49238650|emb|CAF27894.1| sco1/2 family protein [Bartonella henselae str. Houston-1]
          Length = 193

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 69/201 (34%), Positives = 107/201 (53%), Gaps = 17/201 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  ILG  ++ + G   Y +F +K          +  L   +G   + + +  KPSI
Sbjct: 1   MKNVIRILGLTIIFLAGIFIYDTFKNK------PLGDNFTLTDSNGNTITEADIRSKPSI 54

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFGFT C   CPTTL+ LDR L  +      L  +F+TVDP+RDTPEV+  ++  F+ +
Sbjct: 55  IFFGFTMCPESCPTTLTNLDRWLTSLGADADKLGVWFVTVDPERDTPEVLHDYLSNFNHK 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY- 179
           I+GISG+P  V ++  +F I    V     G +  Y  +HT A+ L    G + GVIPY 
Sbjct: 115 IVGISGEPEKVHKMVDSFNIVAEKVP----GTDGNYTYNHTAAIFLLKKGGKLAGVIPYK 170

Query: 180 -KDDSDSA-----IEKINRLI 194
            + +++       IEK+ +L+
Sbjct: 171 IEKNNEELRDNIAIEKLKQLV 191


>gi|297700068|ref|XP_002827092.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Pongo abelii]
          Length = 442

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 88/198 (44%), Gaps = 12/198 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L I        + G        ++ ++       G         L    G   +    
Sbjct: 237 KSLAITFAIGGALLAGMKHVKKEKAETLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDY 296

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN--AYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  VCP  L ++ +++ ++D   TL +    FI++DP+RDT E +  
Sbjct: 297 LGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIAN 356

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS +++G++G   +V +VA+ +R+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 357 YVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGE 413

Query: 173 IVGVIPYKDDSDSAIEKI 190
            +               I
Sbjct: 414 FLDYFGQNKRKGEIAASI 431


>gi|224074780|ref|XP_002187064.1| PREDICTED: similar to SCO cytochrome oxidase deficient homolog 1
           [Taeniopygia guttata]
          Length = 258

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/202 (22%), Positives = 89/202 (44%), Gaps = 16/202 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
           L   ++   G +A +    +  +           G         LV+ +G   +      
Sbjct: 57  LAATVVLGGGLLAGMKVMKRRKEEKLEKERNRGIGKPLLGGPFSLVSHEGQPRTNKDYIG 116

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKFV 114
           +  +++FGFT+C  +CP  L ++  ++ ++D  P+   L   FIT+DP+RD  E + ++V
Sbjct: 117 QWVLIYFGFTHCPDICPDELEKMIAVVNEIDQIPSLPNLTPLFITIDPERDNQEAIARYV 176

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           + FS +++G++G    + +VAK +R+Y +    ++   +  Y VDHT  + L    G  V
Sbjct: 177 KEFSPKLVGLTGSKAQIDQVAKAYRVYYSEGPKDE---DNDYIVDHTIIMYLLGPDGDFV 233

Query: 175 GVIPYKDDSDSAIEKINRLITY 196
                   S      +   +  
Sbjct: 234 DYYGQNKKSAEISASVAAHMRK 255


>gi|89067394|ref|ZP_01154907.1| PrrC [Oceanicola granulosus HTCC2516]
 gi|89046963|gb|EAR53017.1| PrrC [Oceanicola granulosus HTCC2516]
          Length = 206

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/200 (26%), Positives = 78/200 (39%), Gaps = 14/200 (7%)

Query: 1   MKALGIILG---TILLAVLGSIAYVSFSSKF--------VDGNRRFNSDVHLVAQDGTDF 49
           MKA    +G    +L  V G+ A+    S                      LV + G   
Sbjct: 1   MKARTFAIGSAAAVLALVGGTFAWTVARSGGDLADCLGGQVAGGAIGGPFELVDEAGATV 60

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEV 109
           +   +  +P++++FG+T C  VCP   +R    L  +   G      F+TVDP RDTPEV
Sbjct: 61  TSEEVLTEPTLLYFGYTFCPDVCPLDTARNATALDLLAERGIEAQGVFVTVDPTRDTPEV 120

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           +  F   F   I G+SG    V   AK +++Y      E     + Y VDH+    L   
Sbjct: 121 LADFTDSFHPDIRGLSGTTEQVDAAAKAYKVYYQLHDDED---PDYYLVDHSNFTYLVLP 177

Query: 170 AGSIVGVIPYKDDSDSAIEK 189
               V         D+  E+
Sbjct: 178 ERGFVDFFRADASPDAVAER 197


>gi|149912857|ref|ZP_01901391.1| regulatory protein SenC [Roseobacter sp. AzwK-3b]
 gi|149813263|gb|EDM73089.1| regulatory protein SenC [Roseobacter sp. AzwK-3b]
          Length = 208

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 80/174 (45%), Gaps = 1/174 (0%)

Query: 21  YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLD 80
           +       V G  +      LV++ G   + + +  +P++++FG+T C  VCP   SR  
Sbjct: 33  FAQCREGQVAGGAQIGGPFTLVSETGETVTDAEVVDQPALIYFGYTFCPDVCPLDASRNA 92

Query: 81  RLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
             ++ ++    ++   FI+VDP+RDTPEV+  F      R++G++G P  V   ++ +R 
Sbjct: 93  VAVEILEERDQIVKPVFISVDPERDTPEVLDDFTANLHPRMLGLTGSPEQVKEASQAYRT 152

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           Y         G E+ Y VDH+T   L       V     +   +   +++   +
Sbjct: 153 YFKKQEPTP-GQEDFYLVDHSTFTYLTLPEYGFVEFFRRETTPEQMADRVGCFL 205


>gi|326930620|ref|XP_003211442.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Meleagris
           gallopavo]
          Length = 280

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 81/170 (47%), Gaps = 5/170 (2%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--P 88
           G         LV+ +G   +      +  +++FGFT+C  +CP  L ++  ++ ++D  P
Sbjct: 28  GKPLLGGPFSLVSHEGQPRTNRDYLGQWVLIYFGFTHCPDICPEELEKMIEVVNEIDRIP 87

Query: 89  TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
           +   L   FIT+DP+RD+ E + ++V+ FS +++G++G    + +VAK FR+Y +    +
Sbjct: 88  SLPDLTPLFITIDPERDSEEAIARYVKEFSPKLVGLTGTRAQIDQVAKAFRVYYSEGPKD 147

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
           +   +  Y VDHT  + L    G  V        S      I   +    
Sbjct: 148 E---DNDYIVDHTIIMYLLGPDGDFVDYYGQNKRSAEISASIAAHMRKYR 194


>gi|319404496|emb|CBI78102.1| sco1/2 family protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 199

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 68/202 (33%), Positives = 111/202 (54%), Gaps = 16/202 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  ILG  ++ + G   Y +F +K          +  L+A +G   + + +  KP++
Sbjct: 1   MKNIIRILGLTVIFLAGVFTYDAFRNK------PLGENFTLIASNGKIVTEADIRDKPAV 54

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFG+T C   CPTTL  L+R L ++ P    L  +F+TVDP+RDTPEV+ +++  F+D+
Sbjct: 55  IFFGYTMCPDSCPTTLMDLNRWLMEIGPDADRLGVWFVTVDPERDTPEVLHEYLSNFTDK 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IIGISGDP  V ++  +F I    V+      +  Y  +HT A+ L    G + G+IPY 
Sbjct: 115 IIGISGDPNAVHKMVASFNIVSEKVIGTD---DSNYTYNHTAAIFLLKKGGKLAGIIPYN 171

Query: 181 DDS-------DSAIEKINRLIT 195
            +        D AI ++ +L++
Sbjct: 172 VEENENKLKDDIAITRLKKLVS 193


>gi|74191156|dbj|BAE39409.1| unnamed protein product [Mus musculus]
          Length = 247

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 88/198 (44%), Gaps = 12/198 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L +        + G   +     + ++       G         L   +G   +    
Sbjct: 42  KSLALTFAIGGSLLAGMKYFKKEKIEKLEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDY 101

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L ++  +++++D  P+   L   FIT+DP+RDT E +  
Sbjct: 102 LGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIAT 161

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS +++G++G   ++  VA+ +R+Y +    ++   +E Y VDHT  + L    G 
Sbjct: 162 YVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLIGPDGE 218

Query: 173 IVGVIPYKDDSDSAIEKI 190
            +               I
Sbjct: 219 FLDYFGQNKKKAEIAGSI 236


>gi|15604438|ref|NP_220956.1| SCO2 protein precursor (sco2) [Rickettsia prowazekii str. Madrid E]
 gi|20455278|sp|Q9ZCW7|SCO22_RICPR RecName: Full=SCO2-like protein RP587
 gi|3861132|emb|CAA15032.1| SCO2 PROTEIN PRECURSOR (sco2) [Rickettsia prowazekii]
 gi|292572207|gb|ADE30122.1| Sco2 protein precursor [Rickettsia prowazekii Rp22]
          Length = 205

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 49/198 (24%), Positives = 96/198 (48%), Gaps = 9/198 (4%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDG-------NRRFNSDVHLVAQDGTDFSLSSL 54
           K + I+   I +  L  +  +S   K + G         +      L+ Q+G  F+   L
Sbjct: 9   KIIIIMSLLIGVGALYVLLSLSTPKKPLAGQFNIYEDKIKIGGPFELIDQNGEIFNSDKL 68

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
               S+++FGFT+C  +CPT+L+++  +++ +      +   FITVDPKRDTPEV+K+++
Sbjct: 69  RGHLSLIYFGFTSCPDICPTSLNKITNIVEILHQNKIDIIPVFITVDPKRDTPEVLKEYI 128

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           + F  + I ++G+   +  V   F+++   V ++    ++ Y +DH++   L D  G  +
Sbjct: 129 KNFHPKFISLTGNEHQIKDVTDKFKVFYARVNSDN--DDQNYMIDHSSFTYLIDKNGRYM 186

Query: 175 GVIPYKDDSDSAIEKINR 192
                   +   +E    
Sbjct: 187 KHFYLDISAKEIMELFKN 204


>gi|153010528|ref|YP_001371742.1| electron transport protein SCO1/SenC [Ochrobactrum anthropi ATCC
           49188]
 gi|151562416|gb|ABS15913.1| electron transport protein SCO1/SenC [Ochrobactrum anthropi ATCC
           49188]
          Length = 206

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 54/187 (28%), Positives = 88/187 (47%), Gaps = 6/187 (3%)

Query: 9   GTILLAVLGSIAYV--SFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
           G + + +  S  +   + +     G         L +  G     ++L  KP + FFGFT
Sbjct: 19  GGLFIGLSVSKPWQQQTVAVASSTGTAAIGGPFQLTSHRGETIDNAALAGKPYLAFFGFT 78

Query: 67  NCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISG 126
           +C  VCPTTL  L  L+ ++ P     N  F TVDP+RDT E++ +++  F +RI+ + G
Sbjct: 79  HCPDVCPTTLYELSDLMNELGPVADQFNVLFFTVDPERDTQELLAQYMTAFDNRILALRG 138

Query: 127 DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSA 186
           +  +   V K F  Y   V  E      +Y +DHT  + L D     VG +   +  +  
Sbjct: 139 NRQETDAVVKAFAAYARKVPLE----GGEYTMDHTAGVYLMDAESQFVGTLDMHEPREIR 194

Query: 187 IEKINRL 193
           ++K+ RL
Sbjct: 195 LQKLRRL 201


>gi|240137935|ref|YP_002962407.1| hypothetical protein MexAM1_META1p1266 [Methylobacterium extorquens
           AM1]
 gi|240007904|gb|ACS39130.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 215

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 58/195 (29%), Positives = 95/195 (48%), Gaps = 4/195 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           + +     L+ ++ +                      L +  G      +L  KP +VFF
Sbjct: 23  ILVAFALALVGIVAATVAFLPRGDRPSALSVVGGPFRLESSKGGTVDSQALKGKPFLVFF 82

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           GFT C  VCPTTL+ L  LL +    G  + AY+IT+DP+RDT  VM++++  F+DRI G
Sbjct: 83  GFTQCPNVCPTTLADLGTLLDEFGSQGGEIQAYYITLDPERDTQAVMREYMASFTDRITG 142

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           +SG P  + RVA+++R YV  V          Y ++HT  + + D  G   G +      
Sbjct: 143 LSGTPQQIERVARDYRAYVKRVPL----PGGDYTLEHTLMVYMMDRDGGFAGPLDLNAGH 198

Query: 184 DSAIEKINRLITYGN 198
             A++++ +L++ G 
Sbjct: 199 ALALKQLRKLVSDGR 213


>gi|149204451|ref|ZP_01881417.1| SCO1/2 family protein [Roseovarius sp. TM1035]
 gi|149141950|gb|EDM29999.1| SCO1/2 family protein [Roseovarius sp. TM1035]
          Length = 162

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 57/159 (35%), Positives = 83/159 (52%), Gaps = 4/159 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
           D  L   +G +    +L  +P++VFFGFT C  VCPTTLS +   L+ +      +N  F
Sbjct: 2   DFRLTDHEGNEVGPEALIGRPTMVFFGFTYCPDVCPTTLSDISGWLEDLGDDAARMNVVF 61

Query: 98  ITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYF 157
           ITVDP+RDT E M ++V  F   I G +G    + R  + FR     V  E       Y 
Sbjct: 62  ITVDPERDTAEAMAEYVGYFHPAIRGWTGPEDQISRAVEAFRASYERVPTE----GGDYT 117

Query: 158 VDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           ++HT ++ LFD  G +V +I Y +  + A+ KI R +T 
Sbjct: 118 MNHTASVFLFDAKGELVTMIDYHEPREFAVPKIRRALTE 156


>gi|194766067|ref|XP_001965146.1| GF23635 [Drosophila ananassae]
 gi|190617756|gb|EDV33280.1| GF23635 [Drosophila ananassae]
          Length = 251

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 56/199 (28%), Positives = 92/199 (46%), Gaps = 14/199 (7%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSS--------KFVDGNRRFNSDVHLVAQDGTDFSLSS 53
           K+L +I GT+    LG + YV            K   G         LV   G       
Sbjct: 40  KSLAVI-GTLGAGGLGFMLYVKSEKDEARMRERKRQLGKAAIGGKWELVDSQGAVRKSED 98

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL--NAYFITVDPKRDTPEVMK 111
              K  +++FGFT+C  +CP  L ++  ++ +V+ +         FITVDP+RD+ EV+ 
Sbjct: 99  FLGKWLLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAIQPIFITVDPERDSKEVVG 158

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
           K+V+ FS +++G++G    +  V K FR+Y ++   ++   +  Y VDHT  + L +  G
Sbjct: 159 KYVKEFSPKLLGLTGTVDQIRNVCKAFRVYFSSGPRDE---DNDYIVDHTIIMYLVNPDG 215

Query: 172 SIVGVIPYKDDSDSAIEKI 190
             V       D D  +  I
Sbjct: 216 EFVDYYGQNRDKDQCVSSI 234


>gi|257095263|ref|YP_003168904.1| electron transport protein SCO1/SenC [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047787|gb|ACV36975.1| electron transport protein SCO1/SenC [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 211

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/184 (27%), Positives = 82/184 (44%), Gaps = 1/184 (0%)

Query: 15  VLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPT 74
           VL   + +    +             L+  +G   S      +  ++ FG+T C  +CPT
Sbjct: 17  VLALASELDPEQEHALPPPGITGRYLLMDTNGRAVSNEDFLGRFQLISFGYTFCPDICPT 76

Query: 75  TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRV 134
           TL+ +  ++  +      L   FITVDP+RDT  V++ +V  F  R+IG+ G P  + R 
Sbjct: 77  TLAEMSLVMSSLGSDAERLQPVFITVDPERDTASVLRTYVTFFHPRMIGLRGSPALIRRA 136

Query: 135 AKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           A NFR+    V  E     ++Y VDH+  + L    GS +    Y        E+I  ++
Sbjct: 137 ADNFRVRYEKVR-EPGAPPDEYAVDHSAGMFLLGPDGSYIRKFAYAVPPAEIGERIREIM 195

Query: 195 TYGN 198
             G+
Sbjct: 196 AAGD 199


>gi|319407488|emb|CBI81137.1| sco1/2 family protein [Bartonella sp. 1-1C]
          Length = 199

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 68/202 (33%), Positives = 110/202 (54%), Gaps = 16/202 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  ILG  ++ + G   Y +F +K          +  L A +G   + + +  KP++
Sbjct: 1   MKNIIRILGLTVIFLAGVFTYDAFRNK------PLGENFTLTASNGKIITEADIRDKPAV 54

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFG+T C   CPTTL  L+R L ++ P    L  +F+TVDP+RDTPEV+ +++  F+D+
Sbjct: 55  IFFGYTMCPDSCPTTLMDLNRWLMEIGPDADRLGVWFVTVDPERDTPEVLHEYLSNFTDK 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IIGISGDP  V ++  +F I    V+      +  Y  +HT A+ L    G + G+IPY 
Sbjct: 115 IIGISGDPSAVHKMVASFNIVSEKVIGTN---DNNYTYNHTAAIFLLKKGGKLAGIIPYN 171

Query: 181 DDS-------DSAIEKINRLIT 195
            +        D AI ++ +L++
Sbjct: 172 VEENENKLKDDIAITRLKKLVS 193


>gi|302801674|ref|XP_002982593.1| hypothetical protein SELMODRAFT_234054 [Selaginella moellendorffii]
 gi|300149692|gb|EFJ16346.1| hypothetical protein SELMODRAFT_234054 [Selaginella moellendorffii]
          Length = 179

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 78/161 (48%), Gaps = 5/161 (3%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G         LV  +G   +        ++++FGFT+C  +CP  L ++ + +  VD   
Sbjct: 10  GKAAIGGPFKLVNHEGKTVTEKDFLGNWTLMYFGFTSCPDICPDELQKMVQAIDAVDKKS 69

Query: 91  T-LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
              +   F++VDP+RD+ E MK++VQ F  R++G++G P D+ +VAK+FR+Y      E 
Sbjct: 70  GLKIAPLFVSVDPERDSVEQMKEYVQEFHPRLVGLTGAPEDIKQVAKSFRVYYMKTGDE- 128

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
               + Y VDH+  + L D     V         D   + I
Sbjct: 129 ---GDDYLVDHSIIMYLMDPKMEFVKFFGKNYTVDELSQGI 166


>gi|109113341|ref|XP_001118271.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Macaca
           mulatta]
          Length = 301

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 89/195 (45%), Gaps = 10/195 (5%)

Query: 3   ALGIILGTILLAVL-----GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           A+   +G  LLA +          +    +   G         L    G   +      +
Sbjct: 99  AITFAIGGALLAGMKYMKKEKAEKLEKERQRQIGKPLLGGPFSLTTHTGEHKTDKDYLGQ 158

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN--AYFITVDPKRDTPEVMKKFVQ 115
             +++FGFT+C  VCP  L ++ +++ ++D   TL +    FI++DP+RDT E + K+V+
Sbjct: 159 WLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIAKYVK 218

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            FS +++G++G   +V +VA+ +R+Y +    ++   +E Y VDHT  + L    G  + 
Sbjct: 219 EFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLVGPDGEFLD 275

Query: 176 VIPYKDDSDSAIEKI 190
                         I
Sbjct: 276 YFGQNKRKGEIAASI 290


>gi|145356274|ref|XP_001422358.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144582600|gb|ABP00675.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 291

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/177 (25%), Positives = 72/177 (40%), Gaps = 11/177 (6%)

Query: 24  FSSKFVDGNRRFNSDVHLVAQ-DGTDFSLSSLYIKPSIVFFGFTNCSAVCPT-------- 74
           F +    G         L     G  F+   L  K ++++FGFT+C  +CP         
Sbjct: 108 FQTNVAGGKASVGGAFRLTDSRTGKAFTDKDLLGKWAMLYFGFTHCPDICPDELEKVAEV 167

Query: 75  TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRV 134
           T S    L K+ D T   L   FI++DP RDT + +K++V+ F   +IG++G        
Sbjct: 168 TTSINSTLEKKHDGTAARLVPVFISIDPSRDTAKRVKEYVKEFHADMIGLTGSEKQCEDA 227

Query: 135 AKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKIN 191
           A+ +R+Y           ++ Y VDH+    L +  G  V            I  + 
Sbjct: 228 ARKYRVYYRK--TGDEAAKDDYLVDHSIITYLLNPEGEFVTFYGKNTTEKEVIASVR 282


>gi|163846157|ref|YP_001634201.1| electron transport protein SCO1/SenC [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523901|ref|YP_002568371.1| electron transport protein SCO1/SenC [Chloroflexus sp. Y-400-fl]
 gi|163667446|gb|ABY33812.1| electron transport protein SCO1/SenC [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447780|gb|ACM52046.1| electron transport protein SCO1/SenC [Chloroflexus sp. Y-400-fl]
          Length = 198

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 93/180 (51%), Gaps = 4/180 (2%)

Query: 17  GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTL 76
           G  AY    +     N     ++ LV Q G +F LS+   K  +VFFGFT+C  +CPT L
Sbjct: 19  GCGAYEFRGTVLEPPNP--APEIPLVDQFGNEFRLSNYRDKIVLVFFGFTHCPDICPTAL 76

Query: 77  SRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK 136
             L R+++++      +   F++VDP+RDTP++M++++  F+   +G++GD   + +V K
Sbjct: 77  GDLKRVMEKLGNDAAKVQVVFVSVDPERDTPDLMQRYLAAFNPTFLGLNGDRAVLEQVYK 136

Query: 137 NFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           ++ + V       SG+   Y +DH+  +   D AG+   +  +    D  +  +  L+  
Sbjct: 137 SYGVTVIKRELPNSGLG--YTIDHSGYIYAIDQAGNWRLLWAHGTPVDDIVSDVQALLRN 194


>gi|301611122|ref|XP_002935088.1| PREDICTED: protein SCO2 homolog, mitochondrial-like [Xenopus
           (Silurana) tropicalis]
          Length = 273

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/206 (25%), Positives = 88/206 (42%), Gaps = 14/206 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFN---------SDVHLVAQDGTDFSL 51
           ++A   +   I  A LG   Y+ +  +     +R            D  LV   G   + 
Sbjct: 64  LRARVAVSCIIGGAALGIWLYLRWEKQEQQKLQRIQQLQTLAVGQGDFSLVDHTGQPRTK 123

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEV 109
           S L     +++FGFT+C  +CP  L +L   +  +D    L +    FITVDP+RD+   
Sbjct: 124 SFLRDNWVLLYFGFTHCPDICPDELEKLSSAVSLLDKDPALPHVLPVFITVDPERDSVAA 183

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           + K+V  F  R++G++G    V  VAK +R+Y +    ++   +  Y VDHT  + L + 
Sbjct: 184 LAKYVSDFHPRLLGLTGSTEQVKEVAKAYRVYYSTGPKDE---DNDYIVDHTIMIYLLNP 240

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLIT 195
            G                + + R + 
Sbjct: 241 DGLFTDYYSRGKTDQEIADSVRRHMQ 266


>gi|126308969|ref|XP_001380664.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 301

 Score =  116 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/162 (25%), Positives = 82/162 (50%), Gaps = 5/162 (3%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G         L+  +G   +      +  +++FGFT+C  +CP  + ++  ++ ++D   
Sbjct: 132 GKPLLGGPFSLMDHNGEPRTDKDYLGQWILIYFGFTHCPDICPEEVEKMIAVVDEIDSIP 191

Query: 91  TLLN--AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
           TL N    FIT+DP+RD  E ++++V+ FS +++G++G P ++ +VA+ +R+Y +    +
Sbjct: 192 TLPNLIPLFITIDPERDNREAVERYVKEFSPKLVGLTGAPKEIDQVARAYRVYYSPGPKD 251

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
           +   +E Y VDHT  + L    G  +        +      I
Sbjct: 252 E---DEDYIVDHTIIMYLIGPDGEFLDYFGQNKKNTEIAGSI 290


>gi|163744489|ref|ZP_02151849.1| Electron transport protein SCO1/SenC [Oceanibulbus indolifex
           HEL-45]
 gi|161381307|gb|EDQ05716.1| Electron transport protein SCO1/SenC [Oceanibulbus indolifex
           HEL-45]
          Length = 215

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/167 (28%), Positives = 83/167 (49%), Gaps = 3/167 (1%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G+    SD  L+  DG   +      +  +VFFGFT+C  +CPTTL+ +  +L Q+    
Sbjct: 46  GDADIRSDFTLINHDGQTVTQDDYKGRWQLVFFGFTHCPDICPTTLAYMGSVLDQLGSDA 105

Query: 91  TLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKS 150
           + +   F+TVDP+RDTPEV+K ++  F  ++IG++G+   V   A+ F++Y   +  E  
Sbjct: 106 SQVAPLFVTVDPERDTPEVLKGYIANFHPQLIGLTGNKAQVAATAEAFKVYHEMLSNED- 164

Query: 151 GVEEKYFVDHTTALLLFDTAGSI-VGVIPYKDDSDSAIEKINRLITY 196
              + Y + H   + L    G      +     ++   E+I+  I  
Sbjct: 165 -AADGYIMAHAGHIYLMAPDGRFDAVFLESAQPAEEMAEQISMRIAK 210


>gi|126732969|ref|ZP_01748730.1| regulatory protein SenC [Sagittula stellata E-37]
 gi|126706586|gb|EBA05662.1| regulatory protein SenC [Sagittula stellata E-37]
          Length = 210

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 73/160 (45%), Gaps = 4/160 (2%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
                 LV +DG   + + +  +P++V+FG+T C  VCP   +R    +  +   G    
Sbjct: 52  IGGPFELVNKDGATVTDADVITEPTLVYFGYTFCPDVCPFDTARNAEAVDLLAERGMSAT 111

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FI++DP+RDTPE + +F      ++IG++G    V   ++++R Y       + G  +
Sbjct: 112 PVFISIDPERDTPEAVGEFAANLHPKMIGLTGSDEQVKAASQSYRTYYKK----QDGDPD 167

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            Y VDH+T   L       V     +   +   +++   I
Sbjct: 168 YYLVDHSTFTYLVLPEAGFVDYFRREVTPEQMADRVACFI 207


>gi|195386488|ref|XP_002051936.1| GJ17274 [Drosophila virilis]
 gi|194148393|gb|EDW64091.1| GJ17274 [Drosophila virilis]
          Length = 255

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/166 (27%), Positives = 80/166 (48%), Gaps = 5/166 (3%)

Query: 27  KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQV 86
           K   G         LV  +G     S    K  +++FGFT+C  +CP  L ++  ++ ++
Sbjct: 76  KRQLGKAAIGGSWELVDSEGKVRKSSDFLGKWLLIYFGFTHCPDICPDELEKMALVVDEI 135

Query: 87  DPTGTLL--NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
           + +         FITVDP+RD+ E++ K+V+ FS +++G++G    +  V K FR+Y + 
Sbjct: 136 EKSPQTPEVQPIFITVDPERDSKEIVGKYVKEFSPKLLGLTGTVDQIRNVCKAFRVYFSA 195

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
              ++   +  Y VDHT  + L +  G  V       D D  +  I
Sbjct: 196 GPRDE---DNDYIVDHTIIMYLVNPDGEFVDYYGQNRDKDQCVSSI 238


>gi|296201247|ref|XP_002747966.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Callithrix
           jacchus]
          Length = 305

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 90/200 (45%), Gaps = 10/200 (5%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVD-----GNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           A+   +G  LLA +  I          +     G         L A  G   +      +
Sbjct: 103 AITFAVGGALLAGMKYIKKKKAEEVEKEMHRHIGKPLLGGPFSLTAHTGEPKTDKDYLGQ 162

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN--AYFITVDPKRDTPEVMKKFVQ 115
             +++FGFT+C  +CP  L ++  ++ ++D   TL N    FI++DP+RDT E +  +V+
Sbjct: 163 WILIYFGFTHCPDICPEELEKMIHVVDEIDNIPTLPNLTPLFISIDPERDTKEAIANYVK 222

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            FS +++G++G   ++ +VA+ +R+Y +    ++   +E Y VDHT  + L    G  V 
Sbjct: 223 EFSPKLVGLTGTKEEIDKVARAYRVYYSPGPKDE---DEDYIVDHTIIMYLVGPDGEFVD 279

Query: 176 VIPYKDDSDSAIEKINRLIT 195
                  +      I   + 
Sbjct: 280 YFGQNKRNREIAGSIATHMR 299


>gi|242008123|ref|XP_002424862.1| conserved hypothetical protein [Pediculus humanus corporis]
 gi|212508412|gb|EEB12124.1| conserved hypothetical protein [Pediculus humanus corporis]
          Length = 311

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/200 (23%), Positives = 88/200 (44%), Gaps = 10/200 (5%)

Query: 4   LGIILGTILLAVLGSI-----AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
             +++G    A +  +     +    +     G      D  LV QD    S    + + 
Sbjct: 96  WTLVIGGCFTAFVMYLRDKRKSLKEINKVKSIGKALIGGDFELVNQDNVPVSNKDFFGQW 155

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
            +++FGFT+C  +CP  + ++  ++     +    +L   FITVDP+RDTP V+ K+++ 
Sbjct: 156 LLIYFGFTHCPDICPDEIEKMVEIVDTINKEEPEKVLKPVFITVDPERDTPSVVGKYLKE 215

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FSD+IIG++G    + +  K +R+Y +    ++   +  Y VDHT  +      G  +  
Sbjct: 216 FSDKIIGLTGTVEQIKQACKAYRVYFSAGPKDE---DNDYIVDHTIIIYFVGPNGEFIDY 272

Query: 177 IPYKDDSDSAIEKINRLITY 196
                     +++I      
Sbjct: 273 YTQTKSVKDIVDEIKLYFAK 292


>gi|114705920|ref|ZP_01438823.1| cytochrome-c oxidase assembly factor protein [Fulvimarina pelagi
           HTCC2506]
 gi|114538766|gb|EAU41887.1| cytochrome-c oxidase assembly factor protein [Fulvimarina pelagi
           HTCC2506]
          Length = 196

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 59/177 (33%), Positives = 88/177 (49%), Gaps = 6/177 (3%)

Query: 18  SIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLS 77
               +  +++    N  + S   LV Q+G   +  +L  +PS VFFGFT+C  VCPTTL 
Sbjct: 22  VFWSMQGANQNAIANEPYGSPFQLVDQNGDPVTEQALRGRPSAVFFGFTHCPEVCPTTLY 81

Query: 78  RLDRLLKQV-DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK 136
            L    K++           F+TVDP+RD PE +K +V+  SD ++ I+G+P  V  + K
Sbjct: 82  ELSGFQKEIAAEGAEPFQIVFVTVDPERDRPETLKSYVESVSDDVLAITGEPQAVAEMLK 141

Query: 137 NFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
            + +          G  E Y V+HT    L D  G + G I Y +D + A  K+ RL
Sbjct: 142 GWGVIAER-----DGEGENYNVNHTATTFLIDEEGRLDGTIGYGEDPEMARGKLERL 193


>gi|302496542|ref|XP_003010272.1| hypothetical protein ARB_03527 [Arthroderma benhamiae CBS 112371]
 gi|291173814|gb|EFE29632.1| hypothetical protein ARB_03527 [Arthroderma benhamiae CBS 112371]
          Length = 318

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/216 (25%), Positives = 87/216 (40%), Gaps = 31/216 (14%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
               +L   G I Y  +    ++           G  R      L   +G  F+  +L  
Sbjct: 88  AVLFVLTGAGMIVYFQYEKARLERERIVEMSKGVGKPRVGGPFVLKDLNGETFTEENLKG 147

Query: 57  KPSIV---------------FFGFTNCSAVCPTTLSRLDRLLKQ---VDPTGTLLNAYFI 98
           K S V               +FGFT+C  +CP  L ++  ++ +         ++   FI
Sbjct: 148 KYSFVRKTTIYTHARKQTQVYFGFTHCPDICPDELDKMAEIIDEVRARSNGQEVMRPVFI 207

Query: 99  TVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFV 158
           T DP RD+PEV++ ++  F   IIG++G    V  V + +R+Y +    +     E Y V
Sbjct: 208 TCDPARDSPEVLRGYLNEFHKDIIGLTGTYEQVKDVCRQYRVYFST--PQNIKPGEDYLV 265

Query: 159 DHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           DH+    L D  G  V  I  +D   +A + I   I
Sbjct: 266 DHSIYFYLMDPEGDFVECIGRQDTPQTASKVILDHI 301


>gi|302823378|ref|XP_002993342.1| hypothetical protein SELMODRAFT_187412 [Selaginella moellendorffii]
 gi|300138851|gb|EFJ05604.1| hypothetical protein SELMODRAFT_187412 [Selaginella moellendorffii]
          Length = 179

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 78/161 (48%), Gaps = 5/161 (3%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G         LV  +G   +        ++++FGFT+C  +CP  L ++ + +  VD   
Sbjct: 10  GKAAIGGPFKLVNHEGKTVTEKDFLGNWTLMYFGFTSCPDICPDELQKMVQAIDAVDKKS 69

Query: 91  T-LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
              +   F++VDP+RD+ E MK++VQ F  R++G++G P D+ +VAK+FR+Y      E 
Sbjct: 70  GLKIAPLFVSVDPERDSVEQMKEYVQEFHPRLVGLTGAPEDIKQVAKSFRVYYMKTGDE- 128

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
               + Y VDH+  + L D     V         D   + I
Sbjct: 129 ---GDDYLVDHSIIMYLMDPKMEFVNFFGKNYTVDELSQGI 166


>gi|325920470|ref|ZP_08182397.1| hypothetical protein SCO1/SenC/PrrC [Xanthomonas gardneri ATCC
           19865]
 gi|325549050|gb|EGD19977.1| hypothetical protein SCO1/SenC/PrrC [Xanthomonas gardneri ATCC
           19865]
          Length = 196

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 53/199 (26%), Positives = 93/199 (46%), Gaps = 9/199 (4%)

Query: 1   MKA----LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           MK     L ++    ++A  G        +           D +L   +G    L S   
Sbjct: 1   MKRVVSNLLLVCTACVMAGCGLWGSSFSPNGADLSGMGRGVDFYLHDTEGKPKPLRSFRG 60

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           K  ++FFGFTNC  VCPTTL+R  ++ +++    + +   F T+DP+RD P V++ +V  
Sbjct: 61  KTLVLFFGFTNCPDVCPTTLARAAQVKRKLGAQASQVQFAFATLDPQRDVPNVLRTYVHA 120

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F    IG++G   ++   A N ++    V   K+     Y +DH+T   +FD  G++   
Sbjct: 121 FDPDFIGLTGSEGEIRVAADNLKVVHTKVPMGKT-----YTIDHSTRSFVFDRNGNLRVG 175

Query: 177 IPYKDDSDSAIEKINRLIT 195
           + ++   DS +  I ++I 
Sbjct: 176 LAHEQSVDSTVADIRQVIA 194


>gi|153871569|ref|ZP_02000708.1| electron transport protein SCO1/SenC [Beggiatoa sp. PS]
 gi|152071965|gb|EDN69292.1| electron transport protein SCO1/SenC [Beggiatoa sp. PS]
          Length = 219

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 44/213 (20%), Positives = 87/213 (40%), Gaps = 21/213 (9%)

Query: 2   KALG-IILGTILLAVLGSIAYVSFSSKFVDGNRRFN----------------SDVHLVAQ 44
           K +  I+L   + A++    +++   ++      F                     L  Q
Sbjct: 4   KKISEILLSVGIGAIVFGAVWMALQFRYTPEPPAFPLALDTNATVLSEPLAVPTFTLTDQ 63

Query: 45  DGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDP 102
             + F+   L    S +FFG+T C  +CPTTL+ L ++ K              F++VDP
Sbjct: 64  QNSPFTEKELRGHWSFLFFGYTYCPDICPTTLAILAQVDKLLLDKKVLPHPRVIFVSVDP 123

Query: 103 KRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTT 162
            RDTP+ +  +V  F+   +GI+G+   +  + +   I        +    E Y +DH+ 
Sbjct: 124 LRDTPQKLANYVAYFNPAFLGITGEEEQLQILTRPLGIAYQRSPGTE--TSENYLIDHSA 181

Query: 163 ALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           ++LL +  G +  ++       +  E   +++ 
Sbjct: 182 SILLVNPQGQVQAIVSPPHQPATIAEDYQKILA 214


>gi|195114366|ref|XP_002001738.1| GI15364 [Drosophila mojavensis]
 gi|193912313|gb|EDW11180.1| GI15364 [Drosophila mojavensis]
          Length = 250

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 51/202 (25%), Positives = 90/202 (44%), Gaps = 16/202 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
           L  I +   G +A++ +     D           G         L+  +G          
Sbjct: 41  LSVIGVLGAGGLAFMLYVKHEKDEARLRERKRQLGKAAIGGRWELIDSEGVVRKSEDFLG 100

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT--LLNAYFITVDPKRDTPEVMKKFV 114
           K  +++FGFT+C  +CP  L ++  ++ +V+ +     +   FITVDP+RD+ EV+ K+V
Sbjct: 101 KWLLIYFGFTHCPDICPDELDKMALVVDEVEKSPQAPPVQPIFITVDPERDSKEVVGKYV 160

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           + FS +++G++G    +  V K FR+Y +    ++   +  Y VDHT  + L +  G  V
Sbjct: 161 KEFSPKLLGLTGTVDQIRNVCKAFRVYFSAGPRDE---DNDYIVDHTIIMYLVNPDGEFV 217

Query: 175 GVIPYKDDSDSAIEKINRLITY 196
                  D D  +  I   I  
Sbjct: 218 DYYGQNRDKDQCVASILVNIAK 239


>gi|288957629|ref|YP_003447970.1| SCO2 protein [Azospirillum sp. B510]
 gi|288909937|dbj|BAI71426.1| SCO2 protein [Azospirillum sp. B510]
          Length = 207

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 45/162 (27%), Positives = 76/162 (46%), Gaps = 1/162 (0%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
           +      L  Q G   +  S   K  ++FFG+  C  +CPT L  +   L  +    + +
Sbjct: 46  KLGGPWSLTDQTGQPRTDRSFPSKLQVMFFGYRYCPDICPTELQAIAETLDLLGADASQV 105

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              FI++DP+RDTP  + ++   F  RI+G++G P  V  +A  FR+Y   + A+  G  
Sbjct: 106 QPLFISIDPQRDTPAALAEYTALFDSRILGLTGTPDQVAAMATAFRVYYARIEAKD-GGA 164

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           + Y +DH+  + L D  G++ GV+P           I   + 
Sbjct: 165 DDYLMDHSAFVYLTDRTGAVAGVVPPGTKPADLAGIIRTRLK 206


>gi|301763781|ref|XP_002917316.1| PREDICTED: protein SCO2 homolog, mitochondrial-like [Ailuropoda
           melanoleuca]
          Length = 266

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 40/161 (24%), Positives = 81/161 (50%), Gaps = 5/161 (3%)

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG--TLLN 94
            D  L+   G     +    +  +++FGFT+C  +CP  L +L +++++++       + 
Sbjct: 102 GDFSLLDHRGQARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVQELEAEPGLPPVQ 161

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FITVDP+RDT   M ++VQ F  R++G++G    V +V++++R+Y +    ++   ++
Sbjct: 162 PVFITVDPERDTVAAMARYVQDFHPRLLGLTGSAEQVAQVSRSYRVYYSAGPKDE---DQ 218

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            Y VDH+ A+ L    G           +    + + R + 
Sbjct: 219 DYVVDHSVAIYLLSPDGLFTDYYGRARSAQQIADSVRRHMA 259


>gi|294670582|ref|ZP_06735461.1| hypothetical protein NEIELOOT_02304 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307707|gb|EFE48950.1| hypothetical protein NEIELOOT_02304 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 228

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/162 (29%), Positives = 80/162 (49%), Gaps = 4/162 (2%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
              D  L + DG  F++SSL  K  ++ FG+TNC  VCP +L     ++ Q+      + 
Sbjct: 69  IGGDFTLTSGDGKPFAISSLKGKVVLLTFGYTNCPDVCPASLLTYSEVIDQLGEQAKDVA 128

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAK-NFRIYVNNVLAEKSGVE 153
             F++VDP+RDTPEV+ K+V+ F+   IG++      + V K  +R+  +     +    
Sbjct: 129 VVFVSVDPERDTPEVIDKYVKTFNKNFIGLTATGDQSIPVVKQQYRVVSSK---SQEQSA 185

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           + Y +DHT    + D  G+ V +  Y   S      + +L+ 
Sbjct: 186 DIYLIDHTAGTYVLDKEGNTVLMENYGRTSTEIAADVKKLLQ 227


>gi|281339520|gb|EFB15104.1| hypothetical protein PANDA_005520 [Ailuropoda melanoleuca]
          Length = 265

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 40/161 (24%), Positives = 81/161 (50%), Gaps = 5/161 (3%)

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG--TLLN 94
            D  L+   G     +    +  +++FGFT+C  +CP  L +L +++++++       + 
Sbjct: 102 GDFSLLDHRGQARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVQELEAEPGLPPVQ 161

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FITVDP+RDT   M ++VQ F  R++G++G    V +V++++R+Y +    ++   ++
Sbjct: 162 PVFITVDPERDTVAAMARYVQDFHPRLLGLTGSAEQVAQVSRSYRVYYSAGPKDE---DQ 218

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            Y VDH+ A+ L    G           +    + + R + 
Sbjct: 219 DYVVDHSVAIYLLSPDGLFTDYYGRARSAQQIADSVRRHMA 259


>gi|311108444|ref|YP_003981297.1| alkyl hydroperoxide reductase [Achromobacter xylosoxidans A8]
 gi|310763133|gb|ADP18582.1| AhpC/TSA family protein 9 [Achromobacter xylosoxidans A8]
          Length = 207

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 41/160 (25%), Positives = 77/160 (48%), Gaps = 5/160 (3%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
              D  L   +G +  L+    +P ++FFGFT C  +CPT L+R   +   +      L 
Sbjct: 53  PAGDFQLQDTEGRERRLADYAGQPVMLFFGFTQCPDICPTALTRAVEIKSLLGADAKKLR 112

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FITVDP+RDTPE+++ + Q F    +G+ G+       A++F+++   V         
Sbjct: 113 VLFITVDPERDTPEILRAYTQAFDPDFVGLRGNAEQTRAAAQSFKVFYQKV-----ATGS 167

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            Y +DHT    + D +G +   + ++  +   ++ +  ++
Sbjct: 168 SYTMDHTALTYVIDASGKLRIALRHQQSAQECVDDLRTVL 207


>gi|6403490|gb|AAF07830.1|AC010871_6 putative SCO1 protein [Arabidopsis thaliana]
          Length = 273

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 88/211 (41%), Gaps = 21/211 (9%)

Query: 5   GIILGTILLAVLGSIAYVSFSSK----------------FVDGNRRFNSDVHLVAQDGTD 48
            +    +     G + Y     K                   G         L+  DG  
Sbjct: 66  WMSFFLLFATGAGLVYYYDTQKKRHIEDINKNSIAVKEGPSAGKAAIGGPFSLIRDDGKR 125

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTP 107
            +  +L  K +I++FGFT+C  +CP  L +L   + ++     +     FI+VDP+RDT 
Sbjct: 126 VTEKNLMGKWTILYFGFTHCPDICPDELIKLAAAIDKIKENSGVDVVPVFISVDPERDTV 185

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           + + ++V+ F  ++IG++G P ++  VA+++R+Y      E S     Y VDH+  + L 
Sbjct: 186 QQVHEYVKEFHPKLIGLTGSPEEIKSVARSYRVYYMKTEEEDS----DYLVDHSIVMYLM 241

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
               + V       D DS  + + + I    
Sbjct: 242 SPEMNFVKFYGKNHDVDSLTDGVVKEIRQYR 272


>gi|258543159|ref|YP_003188592.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256634237|dbj|BAI00213.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256637297|dbj|BAI03266.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256640349|dbj|BAI06311.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256643406|dbj|BAI09361.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256646461|dbj|BAI12409.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256649514|dbj|BAI15455.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256652500|dbj|BAI18434.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655558|dbj|BAI21485.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 260

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 47/193 (24%), Positives = 94/193 (48%), Gaps = 6/193 (3%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K +  + G +   ++G+       +       +      L  ++G   S ++     +++
Sbjct: 66  KTIFPVAGILFALLIGATGLRVVLTSRSHT--QIGGPYALTDENGHVVSQAAFQGHYTLI 123

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           +FG+T+C  VCP TL+ +   L ++   G  +   FI+VDP RDTP V+K+++QRFS RI
Sbjct: 124 YFGYTHCVDVCPLTLATVSAALDELGSQGKNITPIFISVDPARDTPAVVKEYIQRFSSRI 183

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           +G++G    +  +   F +        ++   + Y +DH++ L L D    + G+IP   
Sbjct: 184 VGLTGTEAQLQPIMTAFHVSARR----RAITGDGYLMDHSSLLYLMDGQNHLAGMIPVDS 239

Query: 182 DSDSAIEKINRLI 194
            +     ++ +L+
Sbjct: 240 SAHQITVELKQLL 252


>gi|21231486|ref|NP_637403.1| hypothetical protein XCC2038 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768459|ref|YP_243221.1| hypothetical protein XC_2145 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21113162|gb|AAM41327.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573791|gb|AAY49201.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 184

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 49/186 (26%), Positives = 87/186 (46%), Gaps = 5/186 (2%)

Query: 10  TILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCS 69
              +A  G  A     +     +     D +L   +GT   L S   K  ++FFGFTNC 
Sbjct: 2   ACAIAGCGQWASSFSPTGTDLSSMGRGVDFYLKDTEGTPRPLRSFRGKVLVLFFGFTNCP 61

Query: 70  AVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPI 129
            VCPTTL+R  ++ + +      +   F T+DP+RD P V++ +V+ F    IG++G   
Sbjct: 62  DVCPTTLARAAQVKRALGADAAQVQFAFATLDPQRDVPNVLRTYVKAFDPDFIGLTGSEG 121

Query: 130 DVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEK 189
           ++   A N ++    V   K+     Y +DH+T   +FD  G +   + ++   ++    
Sbjct: 122 EIRVAADNLKVVYAKVPMGKT-----YTIDHSTRSFVFDREGKLCVGLTHEQTVETVAAD 176

Query: 190 INRLIT 195
           I +++ 
Sbjct: 177 IRQVLA 182


>gi|296283383|ref|ZP_06861381.1| electron transport protein [Citromicrobium bathyomarinum JL354]
          Length = 199

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 43/175 (24%), Positives = 78/175 (44%), Gaps = 7/175 (4%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           +            D  L  +DG   S      +   ++FG+T C  VCP  + R    LK
Sbjct: 28  AGPPPLEGADIGGDFTLTGEDGKPVSWGDFDGQYRTIYFGYTFCPDVCPVDVQRAMAGLK 87

Query: 85  QVD----PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
           + +         +   F++VDP RDTPEV+ +F   F  R+IG++G    + ++ K++  
Sbjct: 88  RFEASDPERAAKIQPLFVSVDPARDTPEVLTEFTDAFHPRLIGMTGSKEQLDKLTKDYAA 147

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           Y +     +      Y VDHT+   LF   G  + ++P     ++  E++++ + 
Sbjct: 148 YYS---IGEPNEAGGYLVDHTSITYLFGPDGKPIAILPTDAGPEAVAEELDKWVR 199


>gi|171060499|ref|YP_001792848.1| electron transport protein SCO1/SenC [Leptothrix cholodnii SP-6]
 gi|170777944|gb|ACB36083.1| electron transport protein SCO1/SenC [Leptothrix cholodnii SP-6]
          Length = 211

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 51/175 (29%), Positives = 80/175 (45%), Gaps = 4/175 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +F +  + G   +   + L   DG   +LS    K ++VFFG+T C  VCPTTL+ L  
Sbjct: 39  AAFKAVDISG-ADYADQLELPDVDGKRRNLSEFKDKLAVVFFGYTQCPDVCPTTLNDLVE 97

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
             + + P G  L A  +TVDP+RDT  ++K +V  F+   + + G   +    AK F+++
Sbjct: 98  TQRLLGPDGDKLVAILVTVDPERDTAALLKGYVGNFNPSWVALRGSAEETAAAAKRFKVF 157

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
                       + Y VDHT A  +FDT G I   +            +  L+  
Sbjct: 158 YRKAPG---TSADTYTVDHTAASYVFDTQGRIRLYVRNGTPPADLAADLKILLAQ 209


>gi|188580328|ref|YP_001923773.1| electron transport protein SCO1/SenC [Methylobacterium populi
           BJ001]
 gi|179343826|gb|ACB79238.1| electron transport protein SCO1/SenC [Methylobacterium populi
           BJ001]
          Length = 198

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 40/161 (24%), Positives = 75/161 (46%), Gaps = 7/161 (4%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
                  L+ QDG   + +    +  I+ FG+T C  VCPT L  + R L  +   G  +
Sbjct: 42  PVGGPFALIDQDGRPRTDADFRGRLVILTFGYTACPDVCPTDLMEISRALTLLGKAGEEI 101

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              F+T+DP RDTP ++ +FV  F  R+IG++G    + + A  ++++      +     
Sbjct: 102 QPVFVTLDPARDTPALLAEFVPSFHPRLIGLTGSEAAIRQAADAYKVFYRREDGQD---- 157

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
               ++H+  + L D +G+ +G  P    ++  +  I   +
Sbjct: 158 ---TIEHSAFVYLMDRSGAYLGFFPPGTSAERMLTIIRPHL 195


>gi|294084572|ref|YP_003551330.1| SCO1/2 family protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664145|gb|ADE39246.1| SCO1/2 family protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 216

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 57/200 (28%), Positives = 86/200 (43%), Gaps = 10/200 (5%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSD------VHLVAQDGTDFSLSSLYI 56
            + II+G      +G        +       +            L   +G      +L  
Sbjct: 15  TITIIVGLSAAIGVGWWQVDGPGAVRPLSKIKTVIPSITSMSFSLTDHEGNAVGPETLIG 74

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           +P++ FFGFT C  VCPTTL+ +   L  +      +N  FITVDP+RDT E M ++V  
Sbjct: 75  RPTMAFFGFTYCPDVCPTTLADISGWLDDLGDEADEMNVVFITVDPERDTVETMAEYVGY 134

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F   I G +G    + RVA  FR     V          Y ++HT ++ LF  +G  V +
Sbjct: 135 FHPAIRGWTGPEEQIARVADGFRATYERVPTG----SGDYTMNHTASVFLFAASGRFVTM 190

Query: 177 IPYKDDSDSAIEKINRLITY 196
           I Y +  + A+ KI R +  
Sbjct: 191 IDYHEPREFAVPKIRRAMEE 210


>gi|99031874|pdb|2B7J|A Chain A, Crystal Structure Of Yeast Sco1 With Copper Bound
 gi|99031875|pdb|2B7J|B Chain B, Crystal Structure Of Yeast Sco1 With Copper Bound
 gi|99031876|pdb|2B7J|C Chain C, Crystal Structure Of Yeast Sco1 With Copper Bound
 gi|99031877|pdb|2B7J|D Chain D, Crystal Structure Of Yeast Sco1 With Copper Bound
 gi|99031878|pdb|2B7K|A Chain A, Crystal Structure Of Yeast Sco1
 gi|99031879|pdb|2B7K|B Chain B, Crystal Structure Of Yeast Sco1
 gi|99031880|pdb|2B7K|C Chain C, Crystal Structure Of Yeast Sco1
 gi|99031881|pdb|2B7K|D Chain D, Crystal Structure Of Yeast Sco1
          Length = 200

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 50/167 (29%), Positives = 77/167 (46%), Gaps = 3/167 (1%)

Query: 30  DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDP 88
            G        HL    G +F+  +L  K SI++FGF+NC  +CP  L +L   L      
Sbjct: 15  YGKPSLGGPFHLEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSK 74

Query: 89  TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
            G  L   FIT DP RD+P V+K+++  F   I+G++G   +V    K +R+Y +     
Sbjct: 75  YGITLQPLFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYFSTPP-- 132

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                + Y VDH+    L D  G  V  +    D  + ++KI   + 
Sbjct: 133 NVKPGQDYLVDHSIFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVK 179


>gi|222102628|ref|YP_002539667.1| Electron transport protein SCO1/SenC [Agrobacterium vitis S4]
 gi|221739229|gb|ACM39962.1| Electron transport protein SCO1/SenC [Agrobacterium vitis S4]
          Length = 166

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 43/160 (26%), Positives = 70/160 (43%), Gaps = 2/160 (1%)

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAY 96
               L   +G   + +S      +V+FGFT+C  VCP +L+ +   L  +  T  ++   
Sbjct: 4   GSFSLTDHNGHAVTEASYRGSFMLVYFGFTHCRKVCPRSLACMTAALDTLGETRRMVVPL 63

Query: 97  FITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           +ITVDP+RDTPE MK FV+    R  G++G    +     +FR++    L  +    E Y
Sbjct: 64  YITVDPERDTPERMKAFVEANFPRFTGLTGSREAIDSAKASFRVFSRKGLDPE--DAEGY 121

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            + HT    L    G  +       D      ++  L+  
Sbjct: 122 AMPHTAFAYLLGPDGKYLAHFMDTIDDLQMANRLRILLAE 161


>gi|304393477|ref|ZP_07375405.1| putative protein SCO2-like protein [Ahrensia sp. R2A130]
 gi|303294484|gb|EFL88856.1| putative protein SCO2-like protein [Ahrensia sp. R2A130]
          Length = 194

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 52/195 (26%), Positives = 96/195 (49%), Gaps = 6/195 (3%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGN--RRFNSDVHLVAQDGTDFSLSSLYIKP 58
           MK   + L +++  +   +A+ +  +   +G+           V  DGT  +   +  +P
Sbjct: 1   MKVFRLALWSVIFVLGAYLAFQTVQTTLREGDNVAAVGGPFEGVFTDGTVANEDKIEGRP 60

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS 118
             +FFGFT+C  VCPTTL    +    +   G  ++ YF+TVDP+RDT +V+  ++  F 
Sbjct: 61  YAIFFGFTHCPDVCPTTLYEASQWYAALGEDGDKVDMYFVTVDPERDTQQVLADYISAFD 120

Query: 119 DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
            RI GI+G    +  + + +R++   V  +     + Y ++HT    L  +  ++   I 
Sbjct: 121 KRIKGITGTQAQMAEMMQAYRVFAQRVDED----GDDYTMNHTATTFLMTSDNTLQSTIA 176

Query: 179 YKDDSDSAIEKINRL 193
           Y + ++ AI K+ RL
Sbjct: 177 YGESAEVAIAKMKRL 191


>gi|113676613|ref|NP_001038697.1| protein SCO2 homolog, mitochondrial precursor [Danio rerio]
 gi|82077900|sp|Q5RH02|SCO2_DANRE RecName: Full=Protein SCO2 homolog, mitochondrial; Flags: Precursor
 gi|56207345|emb|CAI20823.1| novel protein similar to vertebrate endothelial cell growth factor
           1 (platelet-derived) (ECGF1) [Danio rerio]
          Length = 279

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 90/206 (43%), Gaps = 14/206 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF---------NSDVHLVAQDGTDFSL 51
           ++   ++       ++G+  YV    +     +R            D HL+   G   + 
Sbjct: 69  LRTRLVVTLLFGGGIIGTWWYVHQEKEKRIQMQRLEQLRKVALGQGDFHLLDHTGQRRTK 128

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEV 109
                   +++FGFT+C  +CP  L +L  ++     DP+   +   FITVDP+RD    
Sbjct: 129 RDFLGHWVLLYFGFTHCPDICPDELEKLTSVVHILDKDPSLPSVQPLFITVDPERDDVSA 188

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           M ++V+ F  R++G++G   +V +  ++FR+Y +N   ++   +  Y VDH+  + L + 
Sbjct: 189 MARYVKDFHPRLVGLTGSAEEVKQAGRDFRVYASNGPKDE---DGDYIVDHSIVIYLVNP 245

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLIT 195
            G  +       +     E I   + 
Sbjct: 246 DGLFIDYYNRMKNDTQIAESIRNHMK 271


>gi|83955883|ref|ZP_00964425.1| Electron transport protein [Sulfitobacter sp. NAS-14.1]
 gi|83839888|gb|EAP79065.1| Electron transport protein [Sulfitobacter sp. NAS-14.1]
          Length = 178

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 77/171 (45%), Gaps = 3/171 (1%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
            +    G     S+  L+   G + + +    +  +VFFGFTNC  VCPTTL+ +  +L 
Sbjct: 10  KAVRYSGEADIRSEFSLIDHTGQEVTQADYADRWQLVFFGFTNCPDVCPTTLAYMASVLD 69

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            +      +   FITVDP+RDT  VM ++V  F   +IG++G    V    +NFR +   
Sbjct: 70  LLGKDADQVAPIFITVDPERDTVPVMAEYVSVFHPSLIGLTGTEAQVAEATRNFRTWYER 129

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP-YKDDSDSAIEKINRLI 194
              E     + YF+ H   + L    G    V        ++  ++I + +
Sbjct: 130 --TEDDSAPDGYFMAHAGHIYLMRPGGEFEAVYQEGGQPPEALAQEIRKKL 178


>gi|157803566|ref|YP_001492115.1| Sco2 protein precursor [Rickettsia canadensis str. McKiel]
 gi|157784829|gb|ABV73330.1| Sco2 protein precursor [Rickettsia canadensis str. McKiel]
          Length = 205

 Score =  114 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 43/163 (26%), Positives = 84/163 (51%), Gaps = 2/163 (1%)

Query: 30  DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT 89
           + N +   D  L+ Q+G  F+   L    S+++FGFT C  +CPT+L+++  +++ ++  
Sbjct: 44  EDNVKIGGDFELIDQNGEIFNSDELKGNLSLIYFGFTRCPDICPTSLNKMTEIVEMLNKH 103

Query: 90  GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
              +   FIT+D KRDTP V+K++++ F  + IG++G+   +  +   F+++   V  + 
Sbjct: 104 NIDIIPLFITIDSKRDTPIVLKEYLKHFHPKFIGLTGNEQQIKDITNKFKVFYARVNNDD 163

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
              +  Y  DH++ + L DT G  +            IE +  
Sbjct: 164 --DDPNYMFDHSSFIYLMDTNGKYLKHFYLDSSPKEIIEFLRN 204


>gi|222102886|ref|YP_002539925.1| electron transport protein [Agrobacterium vitis S4]
 gi|221739487|gb|ACM40220.1| electron transport protein [Agrobacterium vitis S4]
          Length = 219

 Score =  114 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 65/200 (32%), Positives = 100/200 (50%), Gaps = 7/200 (3%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNS---DVHLVAQDGTDFSLSSLYIK 57
           M    +I+  + +A L   + +         + R         L    G     S  +  
Sbjct: 1   MTRSPLIILALAVAGLFVTSLIGVMIWVAYDSPRPGPFRTQFELTDDRGNPVGPSIFHGS 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           P++V+FG+T+C  VCPTTL  +   LK +   G  L AYF ++DP+RDTPEVM  +V  F
Sbjct: 61  PALVYFGYTHCPEVCPTTLYEVADWLKTLGSEGKDLKAYFFSIDPERDTPEVMHGYVTAF 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           +DRI GI+G P ++ +V   + I+ + + +E       Y + HT +LLL    G +  +I
Sbjct: 121 TDRITGITGKPEEMKKVVDGWMIHASKLPSED----GDYHMSHTVSLLLVGADGRLKDMI 176

Query: 178 PYKDDSDSAIEKINRLITYG 197
           PY  D   AI KI  L++ G
Sbjct: 177 PYGLDKQQAITKIRELLSNG 196


>gi|84503204|ref|ZP_01001289.1| SCO1/2 family protein [Oceanicola batsensis HTCC2597]
 gi|114762619|ref|ZP_01442063.1| SCO1/2 family protein [Pelagibaca bermudensis HTCC2601]
 gi|159046160|ref|YP_001541832.1| electron transport protein SCO1/SenC [Dinoroseobacter shibae DFL
           12]
 gi|159046495|ref|YP_001542165.1| electron transport protein SCO1/SenC [Dinoroseobacter shibae DFL
           12]
 gi|84388445|gb|EAQ01394.1| SCO1/2 family protein [Oceanicola batsensis HTCC2597]
 gi|114544874|gb|EAU47879.1| SCO1/2 family protein [Roseovarius sp. HTCC2601]
 gi|157913919|gb|ABV95351.1| electron transport protein SCO1/SenC [Dinoroseobacter shibae DFL
           12]
 gi|157914254|gb|ABV95684.1| electron transport protein SCO1/SenC [Dinoroseobacter shibae DFL
           12]
          Length = 208

 Score =  114 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 62/204 (30%), Positives = 96/204 (47%), Gaps = 13/204 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNS---------DVHLVAQDGTDFSLS 52
           +   ++ G     VLG   +V +      G               +  L   +  +    
Sbjct: 3   RRQLLLYGAAGAGVLGLTLFVGWWRVDGPGAPEPKGQRPLPLSAMEFRLTDHEENEVGPG 62

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKK 112
           +L  +P++VFFGFT C  VCPTTLS +   L+++    + +N  FITVDP+RDT E M +
Sbjct: 63  NLIGRPTMVFFGFTYCPDVCPTTLSDISGWLEELGDEASEMNVVFITVDPERDTVEAMAE 122

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V  F   I G +G    + R A+ FR     V  E       Y ++HT ++ LFD  G 
Sbjct: 123 YVGYFHPVIRGWTGPEDQIARAAEGFRASFERVPTE----GGGYTMNHTASVFLFDAEGE 178

Query: 173 IVGVIPYKDDSDSAIEKINRLITY 196
           +V +I Y +  + A+ KI R +T 
Sbjct: 179 LVTMIDYHEQREFAVPKIQRALTE 202


>gi|240140750|ref|YP_002965230.1| hypothetical protein MexAM1_META1p4317 [Methylobacterium extorquens
           AM1]
 gi|240010727|gb|ACS41953.1| hypothetical protein; putative exported protein [Methylobacterium
           extorquens AM1]
          Length = 206

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 72/162 (44%), Gaps = 4/162 (2%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
                  L+ Q G   + +    +  +V FG+T C  VCPT L  + R L  +   G  +
Sbjct: 43  PVGGPFALIDQAGRPRTEADFRGRLLLVTFGYTACPDVCPTDLMEIGRALTLLGEAGDAV 102

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              FIT+DP+ DT  ++ +++  F  R++G++G    V R A  ++++            
Sbjct: 103 QPLFITLDPEHDTAALLAEYLPNFHPRLVGLTGSEAAVRRAADAYKVFYETSP----RPG 158

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
               ++H+  + L D +G+ +G  P    ++  +  +   + 
Sbjct: 159 GGRAIEHSAFVYLMDRSGAYLGFFPPGTSAERMLTILRPHLA 200


>gi|86139680|ref|ZP_01058247.1| SCO1/2 family protein [Roseobacter sp. MED193]
 gi|85823571|gb|EAQ43779.1| SCO1/2 family protein [Roseobacter sp. MED193]
          Length = 208

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 60/188 (31%), Positives = 85/188 (45%), Gaps = 7/188 (3%)

Query: 12  LLAVLGSIAYVSFSSKFVDGNRRFNS---DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNC 68
           L   +G        +      R       D  L   +G +    +L  +P++ FFGFT C
Sbjct: 19  LTLFVGWWRVDGPGAPEPIEQRPMALTEMDFRLTDHEGNEVGPETLIGRPTMAFFGFTYC 78

Query: 69  SAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDP 128
             VCPTTLS +   L  +      LN  FITVDP+RDT E M ++V  F   I G +G  
Sbjct: 79  PDVCPTTLSDISGWLDDLGDEAKQLNVVFITVDPERDTVEAMAEYVSYFHPAIRGWTGPE 138

Query: 129 IDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIE 188
             + R+A  FR     V  E       Y ++HT ++ LF  AG  V +I Y +  + A+ 
Sbjct: 139 GQIARIADGFRAAYERVPTE----GGDYTMNHTASVFLFGAAGRFVTMIDYHEPREFAVP 194

Query: 189 KINRLITY 196
           KI R +  
Sbjct: 195 KIRRALEE 202


>gi|308476295|ref|XP_003100364.1| CRE-SCO-1 protein [Caenorhabditis remanei]
 gi|308265106|gb|EFP09059.1| CRE-SCO-1 protein [Caenorhabditis remanei]
          Length = 317

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 50/208 (24%), Positives = 86/208 (41%), Gaps = 14/208 (6%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSS----------KFVDGNRRFNSDVHLVAQDGTDFSLS 52
               +LGT  +      A                K   G  R   +  L+   G      
Sbjct: 100 NWKTVLGTFAVGGSCLAALFYIKKIRLEEREKHRKQTAGKARIGGEWELINTSGKLEGSE 159

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVM 110
            L     +++FGFTNC  +CP  + ++ ++++  +       +   FI+VDP+RD+ E +
Sbjct: 160 ELRGNWLLMYFGFTNCPDICPDEIEKMVKVVEIVEGKKNAPPIVPVFISVDPERDSVERV 219

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           K++   FSD++ G +G    V +VAK FR+Y +         E+ Y VDHT  + L D  
Sbjct: 220 KEYCSEFSDKLKGFTGSQEQVNKVAKTFRVYHSQGPRTSKQ-EDDYIVDHTVIMYLIDPD 278

Query: 171 GSIVGVIPYKDDSDSAIEKIN-RLITYG 197
           G           ++     I  +++ Y 
Sbjct: 279 GQFHDYYGQNRKAEEIANVIEMKVLKYQ 306


>gi|319405992|emb|CBI79624.1| sco1/2 family protein [Bartonella sp. AR 15-3]
          Length = 199

 Score =  114 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 65/204 (31%), Positives = 108/204 (52%), Gaps = 16/204 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  ILG  ++ +     Y +F +K          +  L A +G   + + +  KP++
Sbjct: 1   MKNVIRILGLTVVFLASVFIYDAFRNK------PLGENFTLTASNGKIITEADIRSKPAV 54

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           +FFG+T C   CPTTL  L R L  +      L  +F+TVDP+RDTPEV+++++  F+D+
Sbjct: 55  IFFGYTMCPDTCPTTLMDLSRWLTAIGSDADKLGVWFVTVDPERDTPEVLREYLSNFTDK 114

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           IIGISGDP  V ++  +F I    V+      ++ Y  +HT A+ L    G + G+IPY 
Sbjct: 115 IIGISGDPNAVHKMVASFNIVSEKVVGTN---DDNYTYNHTAAIFLLKKGGKLAGIIPYN 171

Query: 181 DDSDS-------AIEKINRLITYG 197
            + +        AI ++ +L++  
Sbjct: 172 VEENENKLKDNIAITRLKKLVSNS 195


>gi|149201431|ref|ZP_01878406.1| electron transport protein SCO1/SenC [Roseovarius sp. TM1035]
 gi|149145764|gb|EDM33790.1| electron transport protein SCO1/SenC [Roseovarius sp. TM1035]
          Length = 209

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 80/170 (47%), Gaps = 1/170 (0%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           +S    G  +   +  LV++ G   +   +  +PS+++FG+T C  VCP   +R    + 
Sbjct: 38  ASSVAGGAAQIGGEFTLVSETGETVTDKQVIDQPSLIYFGYTFCPDVCPLDNTRNAEAVD 97

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            ++  G ++   FI+VDP RDTPEVM ++      R++G++G    V   +K +R +   
Sbjct: 98  LLEERGLMVKPVFISVDPNRDTPEVMAEYTDYVHPRLLGLTGSEEQVRAASKAYRTFFQA 157

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
               + G E+ Y VDH+T   L       V        ++   +++   +
Sbjct: 158 HQPTE-GEEDFYLVDHSTMTYLTLPEHGFVEFFRRDATAEQIADRVQCFL 206


>gi|325265740|ref|ZP_08132429.1| AhpC/TSA family antioxidant [Kingella denitrificans ATCC 33394]
 gi|324982871|gb|EGC18494.1| AhpC/TSA family antioxidant [Kingella denitrificans ATCC 33394]
          Length = 241

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 50/164 (30%), Positives = 77/164 (46%), Gaps = 5/164 (3%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
              D  L    G  FSLSSL  K  ++ FGFTNC  VCPT L   +   KQ+      + 
Sbjct: 81  IGGDFTLTDGSGKPFSLSSLKGKVVLLTFGFTNCPDVCPTELLTFNDAFKQLGEQSKDVA 140

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDP--IDVMRVAKNFRIYVNNVLAEKSGV 152
           A F++VDP RDTPE++ ++  +F+   IG++      D+  V + +RI            
Sbjct: 141 AVFVSVDPDRDTPELIGRYAAQFNPAFIGLTDTNGGRDIAVVKQQYRIVSAR---TDIKS 197

Query: 153 EEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           +  Y VDH++   + D  G     +P+  D+      I +L+  
Sbjct: 198 DRIYNVDHSSGTYIIDKKGEAAVFVPFGADATQIAGDIRKLLAE 241


>gi|299132751|ref|ZP_07025946.1| electron transport protein SCO1/SenC [Afipia sp. 1NLS2]
 gi|298592888|gb|EFI53088.1| electron transport protein SCO1/SenC [Afipia sp. 1NLS2]
          Length = 225

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/212 (24%), Positives = 87/212 (41%), Gaps = 21/212 (9%)

Query: 2   KALGIILGTILLAVLGSIAYV------------------SFSSKFVDGNRRFNSDVHLVA 43
           +   I    ILL  +  + +                   S  +  V           L +
Sbjct: 10  RWASIAGIAILLLGIAVLKFAPNLRHFNEPASEKTASTASGDAVTVPAGVPIGGPFTLRS 69

Query: 44  QDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPK 103
                 + +    +  +VFFG+TNC   CP TL ++   LK V P    +   FITVDP 
Sbjct: 70  DKNVTVTDADYRGRWMLVFFGYTNCPDECPLTLQKMATSLKDVGPLADRIAPLFITVDPA 129

Query: 104 RDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTA 163
           RDTP+ +  +++ F  RI+G++G    +  VAK +R+Y      E+SG +    V H+T 
Sbjct: 130 RDTPDRLASYLENFDTRIVGLTGSDEQIAAVAKAYRVYYAPGQNEQSGTD---LVSHSTF 186

Query: 164 LLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           L L +  G +  +      +D   + +   + 
Sbjct: 187 LYLMNPGGKLNALFSQDVTADKLAKALRSRLA 218


>gi|46201793|ref|ZP_00054321.2| COG1999: Uncharacterized protein SCO1/SenC/PrrC, involved in
           biogenesis of respiratory and photosynthetic systems
           [Magnetospirillum magnetotacticum MS-1]
          Length = 190

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 76/173 (43%), Gaps = 2/173 (1%)

Query: 23  SFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRL 82
           +  +       R      L   +G   S  S   K  +V FG+T C  +CPTTL+ L   
Sbjct: 14  AIPAAHAQEEARVTGHFILSDMNGRLVSDESYRGKVRLVTFGYTFCPDICPTTLNTLSAT 73

Query: 83  LKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYV 142
           L  +      +   F++VDP+RDTP  +K+++      I G+SG    V   A+NF++  
Sbjct: 74  LDLLGADRAKVAVLFVSVDPERDTPAHLKEYL-NAFPDITGLSGTTEQVAAAARNFKVRF 132

Query: 143 NNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                 +      Y VDH+  + + D  G+ +  +P+    D   E++   +T
Sbjct: 133 ER-QKPEGADPNVYSVDHSANIYIMDREGNFLARLPHLAAPDRVAERVRSYLT 184


>gi|163853334|ref|YP_001641377.1| electron transport protein SCO1/SenC [Methylobacterium extorquens
           PA1]
 gi|163664939|gb|ABY32306.1| electron transport protein SCO1/SenC [Methylobacterium extorquens
           PA1]
          Length = 206

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/162 (22%), Positives = 72/162 (44%), Gaps = 4/162 (2%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
                  L+ Q G   + +    +  +V FG+T C  VCPT L  + R L  +   G  +
Sbjct: 43  PVGGPFALIDQAGRPRTEADFRGRLLLVTFGYTACPDVCPTDLMEIGRALTLLGADGDAV 102

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              FIT+DP+ DT  ++ +++  F  R++G++G    V R A  +++Y           +
Sbjct: 103 QPLFITLDPEHDTAALLAEYLPNFHPRLVGLTGSEAAVRRAADAYKVYYET----SLRSD 158

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
               ++H+    L D +G+ +G  P    ++  +  +   + 
Sbjct: 159 GGRAIEHSAFTYLMDRSGAYLGFFPPGTSAERMLTILRPHLA 200


>gi|238024852|ref|YP_002909084.1| Electron transport protein SCO1/SenC [Burkholderia glumae BGR1]
 gi|237879517|gb|ACR31849.1| Electron transport protein SCO1/SenC [Burkholderia glumae BGR1]
          Length = 214

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/198 (26%), Positives = 92/198 (46%), Gaps = 7/198 (3%)

Query: 3   ALGIILGTILLAVLGSI--AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
            L I+     +++L     +  SF++  + GN +F  D  L   DG   +L+    K  +
Sbjct: 18  TLAIVGALAGVSLLSGCKPSEPSFTNLDITGNTQFGRDFSLPDTDGRIRTLADYRGKVVV 77

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           + FG+T+C  VCPTTL+ L + L Q+ P     +   F++VDPKRDT  V+ ++V  F  
Sbjct: 78  LLFGYTHCPDVCPTTLAELAQALNQLGPDVAKRVQVLFVSVDPKRDTNPVLAQYVSAFDP 137

Query: 120 RII-GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
                   +   + +V+++FRI    V        + Y ++HT A ++FD +G       
Sbjct: 138 SFRALRPANEAQLKQVSRDFRITYEQVAGSN---ADNYSMNHTAASIVFDPSGKPRLFAR 194

Query: 179 YKDDSDSAIEKINRLITY 196
               +   +  +  L+  
Sbjct: 195 DGQGTAPWVHDLPLLLKQ 212


>gi|190571470|ref|YP_001975828.1| SCO1/SenC family protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018873|ref|ZP_03334681.1| SCO1/SenC family protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357742|emb|CAQ55193.1| SCO1/SenC family protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995824|gb|EEB56464.1| SCO1/SenC family protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 199

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/204 (23%), Positives = 92/204 (45%), Gaps = 17/204 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFV----DGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           K + ++   ++      + Y  F+ + +    +   +   D  L+ Q+G     S    K
Sbjct: 3   KFIRLLSSLLITVAAIFLGYCYFTKQGIFVSQNTEIKIGGDFSLINQNGQIVRSSDFKDK 62

Query: 58  PSIVFFGFTNCSAVCPT-TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
             ++FFGF++C  +CP       + L K  + T   L  +FITVDP+RD  E +K+F Q+
Sbjct: 63  YMMIFFGFSSCKRICPMNLGIISETLAKLDEKTDNKLQTFFITVDPERDNTERLKEFQQQ 122

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F  RI  ++G+   +  V   +++Y + V  E+        ++H++ + L    G  V  
Sbjct: 123 FDHRIQMLTGERQKIDEVVAKYKVYASKVDGEE-------EINHSSMIYLISPEGKYVTH 175

Query: 177 IPYKDDSDS-----AIEKINRLIT 195
                +SD       + +I + ++
Sbjct: 176 FVADLNSDESQSDKILAEIKKYVS 199


>gi|270014369|gb|EFA10817.1| hypothetical protein TcasGA2_TC030680 [Tribolium castaneum]
          Length = 214

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 83/195 (42%), Gaps = 20/195 (10%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
           L    +   G +A++ +  K  +           G  +      LV  +G          
Sbjct: 14  LAITGVLGGGLLAFMYYLKKEKEDALMRERKRMLGKAKIGGYFELVDSEGKTRKSDDFLG 73

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           +  +++FGFT+C  +CP  L ++  ++        L+   FI+VDP+RD+P V+ K+   
Sbjct: 74  QWMLIYFGFTHCPDICPDELEKMAAVIND------LVQPIFISVDPQRDSPAVVGKYCAE 127

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS R++G++G    V R  K +R+Y +    +K   +  Y VDHT  + L D  G  V  
Sbjct: 128 FSPRLLGLTGTVEQVARACKAYRVYFSAGPKDK---DSDYIVDHTIIMYLVDPDGQFVDY 184

Query: 177 IPYKDDSDSAIEKIN 191
                 +      I 
Sbjct: 185 YGQNKSAIEIAASIK 199


>gi|85705632|ref|ZP_01036730.1| probable lipoprotein [Roseovarius sp. 217]
 gi|85670057|gb|EAQ24920.1| probable lipoprotein [Roseovarius sp. 217]
          Length = 219

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 82/175 (46%), Gaps = 3/175 (1%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +     V G    ++   L+   G   +  S   +  +VFFGFT+C  +CPTTL+ + +
Sbjct: 41  AALPGTRVTGEAAISNAYTLIDHTGRSVTADSFDGQWQLVFFGFTHCPDICPTTLAYMAQ 100

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           ++ ++ P    +   FITVDP RDT +VM  +V+    R++G+ G    V   A+NFR++
Sbjct: 101 VMDELGPKAAQVTPIFITVDPARDTRDVMAAYVEALHPRMVGLIGTEGQVAEAARNFRVW 160

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI-PYKDDSDSAIEKINRLIT 195
                 E     + Y + H+  + +    G  V V       ++S    ++ L+ 
Sbjct: 161 YER--TEDEAAPDGYTMAHSGYIYVLAPDGRFVDVWLEGDAPAESFANNLSTLLQ 213


>gi|327264848|ref|XP_003217223.1| PREDICTED: protein SCO1 homolog, mitochondrial-like [Anolis
           carolinensis]
          Length = 261

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/196 (23%), Positives = 82/196 (41%), Gaps = 16/196 (8%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
           L        G +A + +  K              G         L    G   S      
Sbjct: 59  LAITCAIGGGLLATMKYFKKEKQEMMEKERQRSIGKPLLGGHFSLTDHKGEPKSDRHYLG 118

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVMKKFV 114
           +  +++FGFT+C  +CP  L ++   + ++D   +L N    FIT+DP+RD  E + ++V
Sbjct: 119 QWVLIYFGFTHCPDICPEELEKMILAVDEIDAIQSLPNVTPLFITIDPERDNKEAIARYV 178

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           + FS ++IG++G    + +VA+ +R+Y ++   ++   +  Y VDHT  + L    G  V
Sbjct: 179 KEFSPKLIGLTGTKEQIDQVARAYRVYYSSGPKDE---DNDYIVDHTIIMYLVGPDGKFV 235

Query: 175 GVIPYKDDSDSAIEKI 190
                          I
Sbjct: 236 DYYGQNKKHSEIAASI 251


>gi|291296997|ref|YP_003508395.1| electron transport protein SCO1/SenC [Meiothermus ruber DSM 1279]
 gi|290471956|gb|ADD29375.1| electron transport protein SCO1/SenC [Meiothermus ruber DSM 1279]
          Length = 204

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 6/178 (3%)

Query: 21  YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLD 80
           Y  + ++ ++      +   L A DG+  SLS    K  ++FFGF NC  VCPTTL  L 
Sbjct: 30  YQPYGTRLLNARPPEANQFTLTAHDGSRKSLSDFQGKVVLIFFGFVNCPDVCPTTLLELS 89

Query: 81  RLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
           ++ K         +    I+VDP+RDT E ++ +V  FS   IG++G P  +  VAK + 
Sbjct: 90  KVYKALTPAEQARVQVLLISVDPERDTLEKLRNYVTFFSPSFIGLTGTPEQIAEVAKRYG 149

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS--AIEKINRLIT 195
           ++       +     +Y VDHT  +   D  G +  +      +++   ++ +  L+ 
Sbjct: 150 VFYQK---SQIKSATEYNVDHTATVFALDPKGQLRLIYGNGKAAETERVVQDVRWLLR 204


>gi|329755269|ref|NP_001193305.1| SCO cytochrome oxidase deficient homolog 2 isoform 1 [Sus scrofa]
 gi|329755271|ref|NP_001193306.1| SCO cytochrome oxidase deficient homolog 2 [Sus scrofa]
          Length = 264

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 90/199 (45%), Gaps = 15/199 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGNRRF----------NSDVHLVAQDGTDFSLSSL 54
            +++  ++ A LG       + K     ++             D  L+   G     +  
Sbjct: 58  RLLITALIGAGLGGAWLALRAEKEQWRQQQRTEALRRAAVGQGDFSLLDHRGQVRCKADF 117

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  L +L ++++  + +P    +   FITVDP+RD    M +
Sbjct: 118 RGQWVLIYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPLFITVDPERDDVAAMAR 177

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +VQ F  R++G++G    + +V++++R+Y +    ++   ++ Y VDH+ A+ L    G 
Sbjct: 178 YVQDFHPRLLGLTGSAEQIAQVSRSYRVYYSAGPKDE---DQDYIVDHSIAIYLLSPDGL 234

Query: 173 IVGVIPYKDDSDSAIEKIN 191
                     +    + + 
Sbjct: 235 FTDYYGRARSAQQITDSVR 253


>gi|268529622|ref|XP_002629937.1| Hypothetical protein CBG03655 [Caenorhabditis briggsae]
 gi|187036400|emb|CAP24500.1| CBR-SCO-1 protein [Caenorhabditis briggsae AF16]
          Length = 318

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/174 (27%), Positives = 81/174 (46%), Gaps = 4/174 (2%)

Query: 27  KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK-- 84
           K   G  R   +  LV  DG       L     +++FGFTNC  +CP  + ++ ++++  
Sbjct: 135 KQTAGKARIGGEWELVNTDGKLEGSEQLRGNWLLMYFGFTNCPDICPDEIEKMVKVVEII 194

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
           +     T +   FI+VDP+RD+   +K++   FS+++ G +G    V +VAK FR+Y + 
Sbjct: 195 ESKKDATPIVPVFISVDPERDSVARVKEYCSEFSEKLRGFTGSTEQVNKVAKTFRVYHSQ 254

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKIN-RLITYG 197
                   E+ Y VDHT  + L D  G           ++     I  +++ Y 
Sbjct: 255 GPRTNKQ-EDDYIVDHTVIMYLIDPDGQFHDYYGQNRKAEEIANVIEMKVLKYQ 307


>gi|218532191|ref|YP_002423007.1| electron transporter SCO1/SenC [Methylobacterium chloromethanicum
           CM4]
 gi|218524494|gb|ACK85079.1| electron transport protein SCO1/SenC [Methylobacterium
           chloromethanicum CM4]
          Length = 206

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 72/162 (44%), Gaps = 4/162 (2%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
                  L+ Q G   + +    +  +V FG+T C  +CPT L  + R L  +   G  +
Sbjct: 43  PVGGPFALIDQAGRPRTEADFRGRLLLVTFGYTACPDICPTDLMEIGRALTLLGADGDAV 102

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              FIT+DP+ DT  ++ +++  F  R++G++G    V R A  +++Y           +
Sbjct: 103 QPLFITLDPEHDTAALLAEYLPNFHPRLVGLTGSEPAVRRAADAYKVYYET----SLRSD 158

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
               ++H+    L D +G+ +G  P    ++  +  +   + 
Sbjct: 159 GGRAIEHSAFTYLMDRSGAYLGFFPPGTSAERMLTILRPHLA 200


>gi|58696734|ref|ZP_00372278.1| SCO1/SenC family protein [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58698127|ref|ZP_00373050.1| SCO1/SenC family protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225629989|ref|YP_002726780.1| SCO1/SenC family protein [Wolbachia sp. wRi]
 gi|58535373|gb|EAL59449.1| SCO1/SenC family protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58537086|gb|EAL60208.1| SCO1/SenC family protein [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225591970|gb|ACN94989.1| SCO1/SenC family protein [Wolbachia sp. wRi]
          Length = 202

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/207 (22%), Positives = 91/207 (43%), Gaps = 20/207 (9%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNR-------RFNSDVHLVAQDGTDFSLSSL 54
           + + ++   +    +  + Y  F+ K +           +   D  L+ QDG     S  
Sbjct: 3   RFIRLLSNVLAALAVVFLGYCYFTKKGIFAPAAIHNAEVKIGGDFSLINQDGQILRSSDF 62

Query: 55  YIKPSIVFFGFTNCSAVCPT-TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
             K  ++FFGF++C  +CP       + L +  + T   L  +FITVDP+RD+ E +K+F
Sbjct: 63  KDKYMMIFFGFSSCKRICPMNLGIISETLARLDEKTNNKLQTFFITVDPERDSTERLKEF 122

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
            Q+F  RI  ++G+   +  V   +++Y + V  E+        ++H++ + L    G  
Sbjct: 123 QQQFDHRIQMLTGEREKIDEVVAKYKVYASKVDGEE-------EINHSSIIYLIGPGGRY 175

Query: 174 VGVIPYKDDSDS-----AIEKINRLIT 195
           V       +SD       + +I + + 
Sbjct: 176 VTHFAADLNSDESQSDKILAEIRKYVN 202


>gi|153791313|ref|NP_005129.2| protein SCO2 homolog, mitochondrial precursor [Homo sapiens]
 gi|281182716|ref|NP_001162580.1| protein SCO2 homolog, mitochondrial precursor [Homo sapiens]
 gi|281182722|ref|NP_001162581.1| protein SCO2 homolog, mitochondrial precursor [Homo sapiens]
 gi|281182727|ref|NP_001162582.1| protein SCO2 homolog, mitochondrial precursor [Homo sapiens]
 gi|8134662|sp|O43819|SCO2_HUMAN RecName: Full=Protein SCO2 homolog, mitochondrial; Flags: Precursor
 gi|6175867|gb|AAF05313.1|AF177385_1 cytochrome c oxidase assembly protein isoform 2 [Homo sapiens]
 gi|74354511|gb|AAI02026.1| SCO cytochrome oxidase deficient homolog 2 (yeast) [Homo sapiens]
 gi|74355767|gb|AAI02025.1| Cytochrome oxidase deficient homolog 2 [Homo sapiens]
          Length = 266

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/161 (26%), Positives = 82/161 (50%), Gaps = 5/161 (3%)

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLN 94
            D HL+   G     +    +  +++FGFT+C  +CP  L +L ++++  + +P    + 
Sbjct: 102 GDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQ 161

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FITVDP+RD  E M ++VQ F  R++G++G    V + + ++R+Y N    ++   ++
Sbjct: 162 PVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDE---DQ 218

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            Y VDH+ A+ L +  G           ++   + + R + 
Sbjct: 219 DYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMA 259


>gi|3217034|emb|CAA16671.1| unnamed protein product [Homo sapiens]
 gi|47678669|emb|CAG30455.1| SCO2 [Homo sapiens]
 gi|109451476|emb|CAK54599.1| SCO2 [synthetic construct]
 gi|109452072|emb|CAK54898.1| SCO2 [synthetic construct]
 gi|261859742|dbj|BAI46393.1| SCO cytochrome oxidase deficient homolog 2 [synthetic construct]
          Length = 266

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/161 (26%), Positives = 82/161 (50%), Gaps = 5/161 (3%)

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLN 94
            D HL+   G     +    +  +++FGFT+C  +CP  L +L ++++  + +P    + 
Sbjct: 102 GDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQ 161

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FITVDP+RD  E M ++VQ F  R++G++G    V + + ++R+Y N    ++   ++
Sbjct: 162 PVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDE---DQ 218

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            Y VDH+ A+ L +  G           ++   + + R + 
Sbjct: 219 DYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMA 259


>gi|316968421|gb|EFV52699.1| cuticle collagen rol-6 [Trichinella spiralis]
          Length = 301

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 78/182 (42%), Gaps = 12/182 (6%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           ++   K + G         LV   G          +  +++FGFT+C  VCP  + ++ +
Sbjct: 111 INLEKKRIIGKSLIGGSWELVNHYGQPVKSEDFKGQWLLIYFGFTHCPDVCPDEIEKMCK 170

Query: 82  LLK--QVDPTGTLLNAYFITVDPKRDTPEVMK-------KFVQRFSDRIIGISGDPIDVM 132
           ++     D    ++   F++VDP+RD P           +    FS +++G++G    V 
Sbjct: 171 IISILDKDKEFAIVKPLFVSVDPERDDPAAFALISLLHLRHTVEFSPKLLGLTGSEEQVN 230

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
           ++ K FR+Y +    ++   ++ Y VDHT  + L +  G  V       +++     I  
Sbjct: 231 KICKAFRVYRSQGPRDQ---DDDYIVDHTIIMYLINPDGGFVDYYGQSRNAEEIANAIRT 287

Query: 193 LI 194
            I
Sbjct: 288 KI 289


>gi|322500009|emb|CBZ35084.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 432

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 4/157 (2%)

Query: 23  SFSSKFVDGNRRFNSDVHLVA-QDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +  S              LV  + G   +   +  K   ++FGFTNC  VCP  ++++ R
Sbjct: 194 AVKSFDSPEGPSIGGPFSLVDVRTGKRVTDVDMKGKWLYIYFGFTNCPDVCPEEMAKMAR 253

Query: 82  LLKQVDPT--GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
           ++K +D           FI++DPKRDTP  +++++  FS RI+G+ G   +V   A+ +R
Sbjct: 254 VIKHLDKKVGKDYWQPIFISLDPKRDTPAKIREYLSDFSPRIMGLVGTQAEVEAAARQYR 313

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           +Y   +  E++  E+ Y VDH+  + L D  G     
Sbjct: 314 VYFA-IPDEEAMSEDDYLVDHSIIMYLIDPEGRFSDY 349


>gi|146090034|ref|XP_001470536.1| electon transport protein SCO1/SCO2 [Leishmania infantum JPCM5]
 gi|134070569|emb|CAM68914.1| putative electon transport protein SCO1/SCO2 [Leishmania infantum
           JPCM5]
          Length = 432

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 4/157 (2%)

Query: 23  SFSSKFVDGNRRFNSDVHLVA-QDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +  S              LV  + G   +   +  K   ++FGFTNC  VCP  ++++ R
Sbjct: 194 AVKSFDSPEGPSIGGPFSLVDVKTGKRVTDVDMKGKWLYIYFGFTNCPDVCPEEMAKMAR 253

Query: 82  LLKQVDPT--GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
           ++K +D           FI++DPKRDTP  +++++  FS RI+G+ G   +V   A+ +R
Sbjct: 254 VIKHLDKKVGKDYWQPIFISLDPKRDTPAKIREYLSDFSPRIMGLVGTQAEVEAAARQYR 313

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           +Y   +  E++  E+ Y VDH+  + L D  G     
Sbjct: 314 VYFA-IPDEEAMSEDDYLVDHSIIMYLIDPEGRFSDY 349


>gi|158430849|pdb|2RLI|A Chain A, Solution Structure Of Cu(I) Human Sco2
          Length = 171

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/161 (26%), Positives = 82/161 (50%), Gaps = 5/161 (3%)

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLN 94
            D HL+   G     +    +  +++FGFT+C  +CP  L +L ++++  + +P    + 
Sbjct: 7   GDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQ 66

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FITVDP+RD  E M ++VQ F  R++G++G    V + + ++R+Y N    ++   ++
Sbjct: 67  PVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDE---DQ 123

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            Y VDH+ A+ L +  G           ++   + + R + 
Sbjct: 124 DYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMA 164


>gi|125984362|ref|XP_001355945.1| GA21389 [Drosophila pseudoobscura pseudoobscura]
 gi|195161260|ref|XP_002021486.1| GL26535 [Drosophila persimilis]
 gi|54644263|gb|EAL33004.1| GA21389 [Drosophila pseudoobscura pseudoobscura]
 gi|194103286|gb|EDW25329.1| GL26535 [Drosophila persimilis]
          Length = 254

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/172 (27%), Positives = 79/172 (45%), Gaps = 5/172 (2%)

Query: 27  KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQV 86
           K   G         LV   G          K  +++FGFT+C  +CP  L ++  ++ +V
Sbjct: 75  KRQLGKAAIGGRWDLVDSQGQVRKSEEFLGKWLLIYFGFTHCPDICPDELEKMAAVVDEV 134

Query: 87  DPTGTLL--NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
           + +         FITVDP+RD+ EV+ K+V+ FS +++G++G    +  V K FR+Y + 
Sbjct: 135 EKSPQTPAVQPIFITVDPERDSKEVVGKYVKEFSPKLLGLTGTVDQIRNVCKAFRVYFSA 194

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
              ++   +  Y VDHT  + L +  G  V       D +  +  I   I  
Sbjct: 195 GPRDE---DNDYIVDHTIIMYLVNPDGEFVDYYGQNRDKEQCVASILVNIAK 243


>gi|327194173|gb|EGE61037.1| electron transport protein [Rhizobium etli CNPAF512]
          Length = 200

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 62/203 (30%), Positives = 103/203 (50%), Gaps = 11/203 (5%)

Query: 1   MKALGII-----LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLY 55
           MK   +      L    +A L ++ +  + ++     R F +   L+  +G     S   
Sbjct: 1   MKPRTLAITGVSLSAAFVASLVALMWSLYLAEPR--ARPFEASFALIDDEGRAVDQSIFK 58

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
             P++V+FG+T+C  VCPTTL  +   +  +      L AYF +VDP+RD+ EVM  +V 
Sbjct: 59  GHPALVYFGYTHCPEVCPTTLYEVADWINALGGQAQNLKAYFFSVDPERDSQEVMHDYVN 118

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            FS RI GI+GDP ++ +V   + ++V  + +E       Y + HT +LLL    G + G
Sbjct: 119 AFSSRITGITGDPQEMKKVVDGWLVHVAKLPSEN----GDYHMSHTVSLLLIGADGRLKG 174

Query: 176 VIPYKDDSDSAIEKINRLITYGN 198
           +IPY  D + A+ KI  ++   +
Sbjct: 175 LIPYGTDREVALAKIRDVLLKQS 197


>gi|110346945|ref|YP_665763.1| electron transport protein SCO1/SenC [Mesorhizobium sp. BNC1]
 gi|110283056|gb|ABG61116.1| electron transport protein SCO1/SenC [Chelativorans sp. BNC1]
          Length = 197

 Score =  113 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 56/193 (29%), Positives = 90/193 (46%), Gaps = 4/193 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           M    I++  + + V    +  S + +   G  +      LV+  G      SL  +P +
Sbjct: 1   MVWAAIVVLGMFVIVSTQRSGRSPTVETSSGTAKVGGPFSLVSHTGERVDNQSLAGRPYL 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT C  +CPTTL  L  L+ ++ P        FITVDP+RDT E +  ++  F  R
Sbjct: 61  VFFGFTYCPDICPTTLFELTDLMTELGPVADGFEVLFITVDPQRDTQEALASYMTSFDSR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           I+ + G   +     K F  Y   V  E      +Y +DHT  + L  + GS  G++   
Sbjct: 121 ILALRGTAAETDAALKAFSAYAKKVPLE----AGEYTMDHTAGVFLMKSDGSFGGMMDMH 176

Query: 181 DDSDSAIEKINRL 193
           +  ++ +EK+ R+
Sbjct: 177 EPRETRLEKLRRI 189


>gi|238022108|ref|ZP_04602534.1| hypothetical protein GCWU000324_02014 [Kingella oralis ATCC 51147]
 gi|237866722|gb|EEP67764.1| hypothetical protein GCWU000324_02014 [Kingella oralis ATCC 51147]
          Length = 242

 Score =  113 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/164 (29%), Positives = 80/164 (48%), Gaps = 5/164 (3%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
              D  L   DG  F+LSSL  K  ++ FG+T+C  +CPT L   +  LKQ+      + 
Sbjct: 82  IGGDFTLTDGDGKPFALSSLKGKVVVLSFGYTHCPDICPTELLTYNDTLKQLGDEAKNVA 141

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDP--IDVMRVAKNFRIYVNNVLAEKSGV 152
             F++VDP RDTPE+MK++V++F+   IG++      ++    + +RI            
Sbjct: 142 VVFVSVDPDRDTPELMKQYVKQFNPAFIGLTDTQGGNEIALAKQQWRIISAK---ADIKS 198

Query: 153 EEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           E+ Y VDH++   L D  G+      +  ++      I +L+  
Sbjct: 199 EKLYNVDHSSGTYLLDKQGNAAYFERFGAEAPQIAADIKKLLAE 242


>gi|322822958|gb|EFZ28847.1| electron transport protein SCO1/SCO2, putative [Trypanosoma cruzi]
          Length = 402

 Score =  113 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 75/151 (49%), Gaps = 3/151 (1%)

Query: 28  FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD 87
                        LV  DG  ++      K   ++FGFTNC  VCP  ++++ R+++ +D
Sbjct: 173 DSPDGPSIGGPFSLVGVDGRRYTEKDFLGKWLYIYFGFTNCPDVCPEEMAKMSRVVQHLD 232

Query: 88  PT--GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
                      FI++DP+RDTPE +++++  FS RI+G+ G   +V   A+ +R+Y   +
Sbjct: 233 KKVGRDYWQPLFISLDPRRDTPEKVREYLADFSPRILGLVGTQEEVEAAAREYRVYFA-I 291

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
             E+   E+ Y VDH+  + L D  G     
Sbjct: 292 PDEEGMSEDDYLVDHSIIMYLMDPEGRFCDY 322


>gi|260220132|emb|CBA27365.1| hypothetical protein Csp_A01910 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 188

 Score =  113 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/183 (25%), Positives = 78/183 (42%), Gaps = 17/183 (9%)

Query: 13  LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           +    S +   FSS  V G   +  +  L   +G    L+    K  ++FFG+T C  VC
Sbjct: 22  MLSACSESRPKFSSVDVTG-ASYAKEFELTDHNGKVRHLADFKGKVVVMFFGYTQCPDVC 80

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVM 132
           PT+                     F+TVDP RDTPEV+K +++ F    + +   P  + 
Sbjct: 81  PTSXXXXXXX-------------LFVTVDPARDTPEVLKGYMENFDPTFLALYTTPEKLE 127

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
            +AK+F++Y   V          Y +DH+    ++DT G++     Y   +      I +
Sbjct: 128 ALAKDFKVYYKRV---NGQTPTSYTMDHSAGSYIYDTQGNLRLFTRYGSGAQVLAADIQQ 184

Query: 193 LIT 195
           L+ 
Sbjct: 185 LLK 187


>gi|71019087|ref|XP_759774.1| hypothetical protein UM03627.1 [Ustilago maydis 521]
 gi|46099214|gb|EAK84447.1| hypothetical protein UM03627.1 [Ustilago maydis 521]
          Length = 301

 Score =  113 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/202 (23%), Positives = 84/202 (41%), Gaps = 16/202 (7%)

Query: 9   GTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
              L+   G + Y     + V+            G  R     +L+      F+   L  
Sbjct: 75  LLFLVTGAGLLYYFRSEKQKVEQRRKAETASAKVGRPRIGGPFNLITSTSHPFTHHDLLG 134

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL--NAYFITVDPKRDTPEVMKKFV 114
             S+V+FGFTNC  +CP  L ++  ++ ++D        N  FI+ DP RDT   +++++
Sbjct: 135 SFSLVYFGFTNCPDICPEELDKMGEVVDRIDAKYGKKLINPVFISCDPARDTVPQLQRYM 194

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           + F  R++G++G    V +  K +R+Y +            Y VDH+    L D  G  V
Sbjct: 195 EDFHPRMVGLTGAFDAVKQACKAYRVYFSTPPGAD--PMGDYLVDHSIFFYLMDPEGKFV 252

Query: 175 GVIPYKDDSDSAIEKINRLITY 196
                  D+    +K++  +  
Sbjct: 253 DAFGRSVDAQETGDKVDAYVKQ 274


>gi|71409778|ref|XP_807216.1| electon transport protein SCO1/SCO2 [Trypanosoma cruzi strain CL
           Brener]
 gi|70871169|gb|EAN85365.1| electon transport protein SCO1/SCO2, putative [Trypanosoma cruzi]
          Length = 402

 Score =  113 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 75/151 (49%), Gaps = 3/151 (1%)

Query: 28  FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD 87
                        LV  DG  ++      K   ++FGFTNC  VCP  ++++ R+++ +D
Sbjct: 173 DSPDGPSIGGPFSLVGVDGRRYTEKDFLGKWLYIYFGFTNCPDVCPEEMAKMSRVVQHLD 232

Query: 88  PT--GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
                      FI++DP+RDTPE +++++  FS RI+G+ G   +V   A+ +R+Y   +
Sbjct: 233 KKVGRDYWQPLFISLDPRRDTPEKVREYLADFSPRILGLVGTQEEVEAAAREYRVYFA-I 291

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
             E+   E+ Y VDH+  + L D  G     
Sbjct: 292 PDEEGMSEDDYLVDHSIIMYLMDPEGRFCDY 322


>gi|330820134|ref|YP_004348996.1| Electron transport protein SCO1/SenC [Burkholderia gladioli BSR3]
 gi|327372129|gb|AEA63484.1| Electron transport protein SCO1/SenC [Burkholderia gladioli BSR3]
          Length = 216

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 53/198 (26%), Positives = 92/198 (46%), Gaps = 10/198 (5%)

Query: 5   GIILGTILLAVLGSIAY-----VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
            + L    LA   +++       SF++  + GN +F  D  L   DG   +L+    K  
Sbjct: 18  TLALVCAALAGTAALSGCQQDQPSFNNLDITGNTQFGKDFSLPDTDGKLRTLADYRGKVV 77

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPT-GTLLNAYFITVDPKRDTPEVMKKFVQRFS 118
           ++ FG+T+C  VCPTTL+ L + L Q+ P     +   F++VDPKRDT +V+ ++V  F 
Sbjct: 78  VLLFGYTHCPDVCPTTLAELAQSLNQLGPDVAKRVQVLFVSVDPKRDTDQVLSQYVSAFD 137

Query: 119 DRII-GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
                    +   + +V  +FRI    V   K    + Y ++HT A ++FD +G +    
Sbjct: 138 PSFRALRPANDAQLKQVTNDFRITYEQVAGSK---PDNYSMNHTAASVVFDPSGKLRLFA 194

Query: 178 PYKDDSDSAIEKINRLIT 195
                +   +  +  L+ 
Sbjct: 195 RDGQGTPPWVHDLPLLLK 212


>gi|226939114|ref|YP_002794185.1| electron transport protein SCO1/SenC [Laribacter hongkongensis
           HLHK9]
 gi|226714038|gb|ACO73176.1| electron transport protein SCO1/SenC [Laribacter hongkongensis
           HLHK9]
          Length = 210

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 98/197 (49%), Gaps = 7/197 (3%)

Query: 1   MKALGIILGTILLAVLG---SIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           ++AL + L  ++LA        A  SF++  V G   +   + L   DG   SL+    K
Sbjct: 5   LRALTVALFGLMLAACSPQPGAAGPSFAATDVTG-AGYAQALTLDGTDGRPRSLADFRGK 63

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             +VFFG+T+C  VCPTTLS L + ++ + P    +   F++VDP+RDTPE++  +V  F
Sbjct: 64  AVVVFFGYTHCPDVCPTTLSELSQAMRDMGPLADQVQVLFVSVDPQRDTPELLHSYVTGF 123

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
             R   ++G    + R A+ +++    V      V   Y +DH+    L+D AGS+   +
Sbjct: 124 DRRFAALTGSAEAIARTARAYKVVYQQVAGP---VPADYTIDHSAGAYLYDPAGSLRVYV 180

Query: 178 PYKDDSDSAIEKINRLI 194
           PY   +      +  L+
Sbjct: 181 PYGSGAAVFRHDLTVLL 197


>gi|294954672|ref|XP_002788261.1| protein sco1, putative [Perkinsus marinus ATCC 50983]
 gi|239903524|gb|EER20057.1| protein sco1, putative [Perkinsus marinus ATCC 50983]
          Length = 285

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/202 (23%), Positives = 81/202 (40%), Gaps = 13/202 (6%)

Query: 3   ALGIILGTILLAVLGSIAYV-------SFSSKFVDGNRRFNSDVHLVA-QDGTDFSLSSL 54
           AL + +G+++L ++    Y        S +     G  +      LV  ++G   +   L
Sbjct: 66  ALFVCVGSLVLLMVEFADYQRKHGVGRSLAEVEEIGKPKLGGPWTLVDCRNGKPVASEQL 125

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFI--TVDPKRDTPEVMKK 112
             K  +++FGFT C  +CP  L +  + +  ++          I  TVDP RDT      
Sbjct: 126 RGKYYLIYFGFTFCPDICPQELEKAGKTVDIIEKEFGAGTIVPIFVTVDPSRDTCAQTSL 185

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           ++  F  R IG++G    +  + + FR+Y N          E Y VDH+    L    G 
Sbjct: 186 YLSEFDPRTIGLTGTHEQIKDITRKFRVYYNQ---GIRTDSEDYLVDHSIIHYLMGPNGK 242

Query: 173 IVGVIPYKDDSDSAIEKINRLI 194
            +        ++    KI + I
Sbjct: 243 FIDFYGKNMTAEEIAGKIGKEI 264


>gi|78048435|ref|YP_364610.1| putative SCO1/SenC family protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325928890|ref|ZP_08190053.1| hypothetical protein SCO1/SenC/PrrC [Xanthomonas perforans 91-118]
 gi|78036865|emb|CAJ24558.1| putative SCO1/SenC family protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325540751|gb|EGD12330.1| hypothetical protein SCO1/SenC/PrrC [Xanthomonas perforans 91-118]
          Length = 216

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/193 (24%), Positives = 75/193 (38%), Gaps = 3/193 (1%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           LG++LG   L    S  +    +       R      L   DGT      L    ++VF 
Sbjct: 18  LGMLLGQKFLGGAPSSPWPPTKTITFYPQPRPLPQFSLRQSDGTQLVPGELKGHWTLVFL 77

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGT--LLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           GFT C  VCPTTL+ L    +Q +           F++VDP+RD P  + ++   F    
Sbjct: 78  GFTFCPDVCPTTLTDLAVAQQQWESIPDGLRPRVLFVSVDPQRDPPARLGEYAHAFHKDT 137

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKS-GVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           +  + D   + R A         V  +        Y +DH+  + + D  G + G+I   
Sbjct: 138 LAATADVPALERFATALGFVFQKVPGKGYAQNPNDYSMDHSAGIAVLDPQGRLAGLIRPP 197

Query: 181 DDSDSAIEKINRL 193
            D  +    + +L
Sbjct: 198 LDPKAIAADLQQL 210


>gi|320159937|ref|YP_004173161.1| electron transport protein SCO1/SenC family protein [Anaerolinea
           thermophila UNI-1]
 gi|319993790|dbj|BAJ62561.1| electron transport protein SCO1/SenC family protein [Anaerolinea
           thermophila UNI-1]
          Length = 193

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/200 (25%), Positives = 96/200 (48%), Gaps = 13/200 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKF-----VDGNRRFNSDVHLVAQDGTDFSLSSLY 55
           M+     LG  +   L ++A ++ +  +     +    +    + L   +G  F LS+  
Sbjct: 1   MRKYAFWLGLGVFIALLAVAGLALAQPYRLRGSIIDPPQPAPAIAL---NG--FDLSAQR 55

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
            K +++FFG+T C  VCP TL  + ++L+++      +   F+TVDP+RDTPE ++K+  
Sbjct: 56  GKVALLFFGYTTCPDVCPATLGEMKQVLQRLGTQAQNVQVVFVTVDPQRDTPEKIQKYTT 115

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F  RI+G++G   D+  + + + +Y       + G    Y VDH+  + L D  G +  
Sbjct: 116 AFDPRIVGVTGTEEDLQPIWQAYGVY---REIRQGGTAAGYLVDHSARVYLIDPEGFLRA 172

Query: 176 VIPYKDDSDSAIEKINRLIT 195
             P+    +  +  +  L+ 
Sbjct: 173 TYPFGTPVEDLLSDVRFLLK 192


>gi|148284669|ref|YP_001248759.1| putative electron transport protein [Orientia tsutsugamushi str.
           Boryong]
 gi|146740108|emb|CAM80275.1| putative electron transport protein [Orientia tsutsugamushi str.
           Boryong]
          Length = 195

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 77/161 (47%), Gaps = 1/161 (0%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
              D  L+  +  +F   SL  KP +++FGFT C  VCP TL +L +++K +D     ++
Sbjct: 36  LGGDFTLIDTNNREFYSKSLRGKPYLIYFGFTFCPDVCPATLEKLSKVIKVLDMYHIDIS 95

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             F+TVDPKRD    +K ++  F  +II ++G    +  + K F +Y +           
Sbjct: 96  TIFVTVDPKRDNASTLKNYMTNFHSKIIALTGTKPQIEDITKKFGVYYSISALSDRNS-N 154

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            Y +DH+T + L D  G  +      D  +  IE I   + 
Sbjct: 155 DYLIDHSTFIYLIDKNGKYMSHFTLDDTPEKIIEYIRIHLK 195


>gi|109157954|pdb|2GQK|A Chain A, Solution Structure Of Human Ni(Ii)-Sco1
 gi|109157955|pdb|2GQL|A Chain A, Solution Structure Of Human Ni(Ii)-Sco1
 gi|109157956|pdb|2GQM|A Chain A, Solution Structure Of Human Cu(I)-Sco1
 gi|109158050|pdb|2GT5|A Chain A, Solution Structure Of Apo Human Sco1
 gi|109158051|pdb|2GT6|A Chain A, Solution Structure Of Human Cu(I) Sco1
 gi|109158103|pdb|2GVP|A Chain A, Solution Structure Of Human Apo Sco1
          Length = 173

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 79/168 (47%), Gaps = 5/168 (2%)

Query: 30  DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT 89
            G         L    G   +      +  +++FGFT+C  VCP  L ++ +++ ++D  
Sbjct: 3   TGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSI 62

Query: 90  GTLLN--AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLA 147
            TL +    FI++DP+RDT E +  +V+ FS +++G++G   +V +VA+ +R+Y +    
Sbjct: 63  TTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPK 122

Query: 148 EKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           ++   +E Y VDHT  + L    G  +               I   + 
Sbjct: 123 DE---DEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMR 167


>gi|71905777|ref|YP_283364.1| electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
 gi|71845398|gb|AAZ44894.1| Electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
          Length = 197

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/162 (29%), Positives = 81/162 (50%), Gaps = 1/162 (0%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
            N    L   +G   +      +  ++ FG+T C  +CPTTL  +  +LKQ+      + 
Sbjct: 36  INPRYLLQDPNGRSVTSEDFRGRYQLIAFGYTYCPDICPTTLVEMAEILKQLGKEAKNIQ 95

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
           A FI+VDP+RDT +++K + + F  RI+G++  P  V R A+NF++    V  E     +
Sbjct: 96  AIFISVDPERDTGKILKTYTEFFDPRILGLTASPALVRRTAENFKVRYAKV-QEPGATSD 154

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           +Y VDH+  ++L    G+ +    +        E+I+ LI  
Sbjct: 155 RYAVDHSAGMILLGPDGNFIKKFAFAMPVSEITEQISNLINN 196


>gi|321462391|gb|EFX73415.1| hypothetical protein DAPPUDRAFT_307706 [Daphnia pulex]
          Length = 278

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 49/207 (23%), Positives = 90/207 (43%), Gaps = 14/207 (6%)

Query: 2   KALGIILGTILLAVLGSI-------AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
           K L +  G     +   +       A +        G    +   +LV  +G   S    
Sbjct: 68  KTLLVTAGLSGSLLAFMLYVRKEKEAAIQLERNRALGKAAISGKFNLVDHNGVKKSSDDF 127

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +V+FGFT+C  +CP  + +L +++           +   FITVDP RD+ + ++K
Sbjct: 128 LGQWLLVYFGFTHCPDICPDEIEKLVKVVDNLDQMKGVPKVQPLFITVDPDRDSIQSVEK 187

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS ++IG++G+   +    KNFR+Y +    ++   ++ Y VDHT  + L +  G 
Sbjct: 188 YVKEFSPKLIGLTGNKEQIAEACKNFRVYFSAGPRDQ---DDDYIVDHTIIVYLINPDGE 244

Query: 173 IVGVIPYKDDSDSAIEKINRLITYGNV 199
            V        S++    I  L+     
Sbjct: 245 FVDYYGQNKTSENISAGI--LLNMSKF 269


>gi|163747590|ref|ZP_02154938.1| SCO1/2 family protein [Oceanibulbus indolifex HEL-45]
 gi|161379115|gb|EDQ03536.1| SCO1/2 family protein [Oceanibulbus indolifex HEL-45]
          Length = 207

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 62/159 (38%), Positives = 83/159 (52%), Gaps = 4/159 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
           +  L  QDG D    +L  +PS+VFFGFT C  VCPTTLS +   L ++ P    LN  F
Sbjct: 46  EFSLTDQDGRDVGPETLIGEPSLVFFGFTYCPDVCPTTLSDISGWLDEIGPDAEDLNTVF 105

Query: 98  ITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYF 157
           ITVDP RDT E M ++V  F  +I G +G P  +  +A  FR     V  E      +Y 
Sbjct: 106 ITVDPDRDTVETMAEYVSYFHPQIQGWTGLPDQIAAIADGFRATYEKVEGEN----GEYT 161

Query: 158 VDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           ++HT  + LFD  G  V  I Y +  + A+ KI R +  
Sbjct: 162 MNHTAGVFLFDATGRFVTTIDYHEPREFAVPKIRRAMQN 200


>gi|158422963|ref|YP_001524255.1| electron transport SCO1/SenC protein [Azorhizobium caulinodans ORS
           571]
 gi|158329852|dbj|BAF87337.1| electron transport SCO1/SenC protein [Azorhizobium caulinodans ORS
           571]
          Length = 216

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 55/170 (32%), Positives = 87/170 (51%), Gaps = 4/170 (2%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ 85
            +             L +  G   S   L  KP  +FFGFT+C  VCPTTL  + + L++
Sbjct: 40  GREPSVRTSVGGPFRLASSKGEVLSSDDLKGKPFAIFFGFTHCPDVCPTTLWDMSQSLER 99

Query: 86  VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
           +   G  L   F+++DP+RDTP+V+  ++  F  +I+G+SG   ++ R+A+ +R+Y   V
Sbjct: 100 LRTGGLGLPVLFVSLDPERDTPQVLASYIDAFDTQIVGLSGTSEEIARLARAYRVYWKRV 159

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
             +       Y +DHT  + L D  G   G I Y +D+ S   K+ RLI 
Sbjct: 160 PGKD----GDYTLDHTATVYLMDARGQFAGTIGYGEDASSRDAKLRRLIA 205


>gi|68171397|ref|ZP_00544790.1| Electron transport protein SCO1/SenC [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88658484|ref|YP_507763.1| major antigenic protein [Ehrlichia chaffeensis str. Arkansas]
 gi|5163247|gb|AAD40620.1|AF117731_1 major antigenic protein 2 homolog [Ehrlichia chaffeensis]
 gi|67999192|gb|EAM85849.1| Electron transport protein SCO1/SenC [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599941|gb|ABD45410.1| major antigenic protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 205

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 49/210 (23%), Positives = 88/210 (41%), Gaps = 21/210 (10%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGT 47
           MK +  IL   LL     + Y   + +              +       +   LV QDG 
Sbjct: 1   MKVIKFILNICLLFAAIFLGYSYVTKQGIFQVRDHNTPNTNISNKASITTSFSLVNQDGN 60

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTP 107
             +      K  +V FGF++C ++CP  L     +L Q+      L   FIT+DP  DT 
Sbjct: 61  TVNSQDFLGKYMLVLFGFSSCKSICPAELGIASEVLSQLGNDTDKLQVIFITIDPTNDTV 120

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           + +K F + F  RI  ++G   D+ ++ KN++IYV          ++   +DH+  + + 
Sbjct: 121 QKLKTFHEHFDPRIQMLTGSAEDIEKIIKNYKIYV-------GQADKDNQIDHSAIMYII 173

Query: 168 DTAGSIVGVIPYKD-DSDSAIEKINRLITY 196
           D  G  +         +++ ++K+  +I  
Sbjct: 174 DKKGEYISHFSPDLKSTENQVDKLLSIIKQ 203


>gi|260429283|ref|ZP_05783260.1| protein SenC [Citreicella sp. SE45]
 gi|260419906|gb|EEX13159.1| protein SenC [Citreicella sp. SE45]
          Length = 204

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 50/200 (25%), Positives = 83/200 (41%), Gaps = 15/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSF-----------SSKFVDGNRRFNSDVHLVAQDGTDF 49
           M+ +      + L ++    +              SS    G         LV   G   
Sbjct: 1   MRWIAAAAAALFLVLMMGGVWYWTRPGGDVFADCRSSAVAGGAGAIGGPFELVNAQGETV 60

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEV 109
           + + ++ +PS+V+FG+T C  VCP  +SR    +  +   G  +   FI++DP+RDTPEV
Sbjct: 61  TDADVFTEPSLVYFGYTFCPDVCPFDVSRNAEAVDLLAERGMSVTPVFISIDPERDTPEV 120

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           +  F     +++IG++G P  V   ++ +R Y     +E     E Y VDH+T   L   
Sbjct: 121 VGDFAYNMHEKMIGLTGSPEQVQAASQAYRTYYKKQESED----EFYLVDHSTFTYLVLP 176

Query: 170 AGSIVGVIPYKDDSDSAIEK 189
               V         +   EK
Sbjct: 177 EQGFVEFFRRDVTPEEMAEK 196


>gi|220922814|ref|YP_002498116.1| electron transport protein SCO1/SenC [Methylobacterium nodulans ORS
           2060]
 gi|219947421|gb|ACL57813.1| electron transport protein SCO1/SenC [Methylobacterium nodulans ORS
           2060]
          Length = 197

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 81/160 (50%), Gaps = 4/160 (2%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
                 LV QDG   S      +  +VFFGFT+C  VCPTTL ++  +L  + P G  + 
Sbjct: 42  VGGPFTLVNQDGKTVSEKDFAGRTHLVFFGFTHCPDVCPTTLQQISDVLAALGPKGRDMK 101

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FITVDP+RDTPE +K+++  F  RI+G++G    V    K +R Y   V  +      
Sbjct: 102 VLFITVDPERDTPEALKQYLASFDPRIVGLTGSTDAVAGAVKAYRAYSRKVPLKD----G 157

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            Y ++HT  + + D A + VG +     +  A  ++ R +
Sbjct: 158 DYTMEHTALVYIMDGANNFVGSLNLMRPASDAAAEVARRL 197


>gi|126030639|pdb|2HRF|A Chain A, Solution Structure Of Cu(I) P174l Hsco1
 gi|126030640|pdb|2HRN|A Chain A, Solution Structure Of Cu(I) P174l-Hsco1
          Length = 173

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 78/168 (46%), Gaps = 5/168 (2%)

Query: 30  DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT 89
            G         L    G   +      +  +++FGFT+C  VC   L ++ +++ ++D  
Sbjct: 3   TGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCLEELEKMIQVVDEIDSI 62

Query: 90  GTLLN--AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLA 147
            TL +    FI++DP+RDT E +  +V+ FS +++G++G   +V +VA+ +R+Y +    
Sbjct: 63  TTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPK 122

Query: 148 EKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           ++   +E Y VDHT  + L    G  +               I   + 
Sbjct: 123 DE---DEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMR 167


>gi|78485906|ref|YP_391831.1| electron transport protein SCO1/SenC [Thiomicrospira crunogena
           XCL-2]
 gi|78364192|gb|ABB42157.1| SCO1/SenC family protein [Thiomicrospira crunogena XCL-2]
          Length = 208

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 52/209 (24%), Positives = 91/209 (43%), Gaps = 16/209 (7%)

Query: 1   MKA-LGIILGTILLAVLGSIAYVSFSSKFVDG-----------NRRFNSDVHLVAQDGTD 48
           MK  + +IL T ++  L  I +++  S+F+              +    D  L++  G  
Sbjct: 1   MKKHIFLILVTSVIIGLSIIVWLTPPSQFLVSGDAKMKTAALSQKPKGGDFTLMSSSG-P 59

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTP 107
            SLS    K  +++FG+T C  +CPT L  L    +Q        L   FI+VDP RDTP
Sbjct: 60  VSLSDYKGKLVLIYFGYTFCPDICPTNLGNLAMAYQQLTPKERDQLQILFISVDPDRDTP 119

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
             +K++   F   I+G++G    +  +   + +       +    E  Y VDH+    + 
Sbjct: 120 NRLKQYADYFKSGIVGLTGKKTIIDDITHRYGVVYAIHREKP--DETTYSVDHSAFTYII 177

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           +  G +V  +P+    D   ++I   +T 
Sbjct: 178 NAKGELVKQLPHATSPDIFTQQIRHFMTQ 206


>gi|309790937|ref|ZP_07685479.1| electron transport protein SCO1/SenC [Oscillochloris trichoides
           DG6]
 gi|308227051|gb|EFO80737.1| electron transport protein SCO1/SenC [Oscillochloris trichoides
           DG6]
          Length = 214

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 49/169 (28%), Positives = 81/169 (47%), Gaps = 3/169 (1%)

Query: 31  GNRRFNSDVHLVAQDG-TDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT 89
              R  +D  L +  G T  SLS L  KP +++FG+T C  VCPTTL     + + +   
Sbjct: 48  SPPRELTDFTLPSSRGGTPLSLSDLRGKPLLIYFGYTFCPDVCPTTLVEFIGVKQDLAAQ 107

Query: 90  GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK 149
               N   ++VDP+RDTPEV++++++ +    IG+SGD   + ++   + ++      E 
Sbjct: 108 ADAFNVLMVSVDPERDTPEVLERYLKVYDPSFIGMSGDVEILKQIGPEYGLFYQRHAVE- 166

Query: 150 SGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
            G    Y VDH+ +  L D  G +  +  Y    +     + RLI    
Sbjct: 167 -GSASAYLVDHSASAYLLDRQGRLRFIYRYGTPHNVMSADLQRLIAEQE 214


>gi|225708036|gb|ACO09864.1| SCO1 protein homolog, mitochondrial precursor [Osmerus mordax]
          Length = 305

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 45/191 (23%), Positives = 82/191 (42%), Gaps = 10/191 (5%)

Query: 3   ALGIILGTILLAVL-----GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           A+   LG  LLAV+          +        G         LV  +           +
Sbjct: 103 AITFALGGALLAVMKYFKKEKEELIEKERTKSIGKPALGGPFSLVDHNNKPCKSDDFLGQ 162

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
             +++FGFT+C  +CP  + ++  ++ ++D   +   L    IT+DP RDT E M  +++
Sbjct: 163 WVLIYFGFTHCPDICPDEIEKMIEVVDEIDGIQSLPNLTPLLITIDPDRDTAEAMATYIK 222

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            FS ++IG++G    + +V++ +R+Y +    ++   +  Y VDHT  + L    G  V 
Sbjct: 223 DFSPKLIGLTGAKAQIDQVSRAYRVYYSQGPKDE---DNDYIVDHTIIMYLVGPDGEFVE 279

Query: 176 VIPYKDDSDSA 186
                  S   
Sbjct: 280 YFGQNKKSSEI 290


>gi|146284483|ref|YP_001174636.1| Sco1/SenC family protein [Pseudomonas stutzeri A1501]
 gi|145572688|gb|ABP81794.1| Sco1/SenC family protein [Pseudomonas stutzeri A1501]
 gi|327482871|gb|AEA86181.1| Sco1/SenC family protein [Pseudomonas stutzeri DSM 4166]
          Length = 211

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 55/210 (26%), Positives = 91/210 (43%), Gaps = 17/210 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDG------------NRRFNSDVHLVAQDGTDF 49
           K + I++  I L V  +++ V  S + +D               R    + L  QDG   
Sbjct: 6   KTVFILVALIALVVGLTVSKVLNSQRQLDPTQLLDAGIVLLPQSRPVPALSLTDQDGEAV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT-LLNAYFITVDPKRDTPE 108
            L +L  + +++FFG+T C  +CPTTL+ L +L   +  T    L    ++VDP RDTP 
Sbjct: 66  QLDALKGQWTLLFFGYTFCPDICPTTLAELRQLNGMLPETVRGQLRTILVSVDPDRDTPA 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F+    G++G   D+  +A    I            +E Y VDH+  L+L  
Sbjct: 126 QLKEYLGYFNAGFQGLTGPLDDIQTLANGVGIPF----IPGDTSKENYTVDHSGNLVLIG 181

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
             G   G I          E++  L+    
Sbjct: 182 PDGRQRGFIRSPLRVQKLAEQLPELVNRAE 211


>gi|17531419|ref|NP_494755.1| hypothetical protein C01F1.2 [Caenorhabditis elegans]
 gi|1330396|gb|AAB00716.1| Hypothetical protein C01F1.2 [Caenorhabditis elegans]
          Length = 312

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 14/208 (6%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSS----------KFVDGNRRFNSDVHLVAQDGTDFSLS 52
               +LGT  +      A                K   G  R   +  L+  DG      
Sbjct: 95  NWKTVLGTFAVGGTCLAALFYIKKIRLDEREKHRKQTAGKARIGGEWELMNTDGKMEGSQ 154

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVM 110
            L     +++FGFTNC  +CP  + ++ ++++  +     T +   FI+VDP+RD+   +
Sbjct: 155 ELRGNWLLMYFGFTNCPDICPDEIEKMVKVVEIIEAKKDATPIVPVFISVDPERDSVARV 214

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           K++   FS+++ G +G    V +VAK FR+Y +         E+ Y VDHT  + L D +
Sbjct: 215 KEYCSEFSNKLRGFTGTTEQVNKVAKTFRVYHSQGPRTNKQ-EDDYIVDHTVIMYLIDPS 273

Query: 171 GSIVGVIPYKDDSDSAIEKIN-RLITYG 197
           G           ++     I  +++ Y 
Sbjct: 274 GQFHDYYGQNRKAEEIANVIEMKVLKYQ 301


>gi|254460307|ref|ZP_05073723.1| electron transport protein SCO1/SenC [Rhodobacterales bacterium
           HTCC2083]
 gi|206676896|gb|EDZ41383.1| electron transport protein SCO1/SenC [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 206

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 86/208 (41%), Gaps = 16/208 (7%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRR------------FNSDVHLVAQDGTDF 49
           + L I+    +   LG    ++F     D   +                  L+ + G + 
Sbjct: 3   RLLAILAVLAVALCLGLFLVLTFFGAPKDQFAQCRIGQVAGGGGQIGGPFTLIDKTGAEV 62

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEV 109
           +   +  +P++++FG++ C  VCP  LSR       +   GT +   FI++DP RDTPEV
Sbjct: 63  TEKDVITEPTLIYFGYSFCPDVCPFDLSRNAEATDVLLERGTEITPVFISIDPNRDTPEV 122

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           + +F     +R+IG++G P  V   ++ +R Y     A+     E Y VDH+T   L   
Sbjct: 123 VGEFADNLHERMIGLTGSPAQVKAASQAYRTYYKAQPADD----EFYLVDHSTFSYLVLP 178

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLITYG 197
               V     +   +   + I   +   
Sbjct: 179 EYGFVEFFRREIQPEQMADTIQCFVKNS 206


>gi|85372861|ref|YP_456923.1| electron transport protein [Erythrobacter litoralis HTCC2594]
 gi|84785944|gb|ABC62126.1| Electron transport protein [Erythrobacter litoralis HTCC2594]
          Length = 197

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 76/173 (43%), Gaps = 7/173 (4%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
            +   +          D  L ++ G   + S    +  IV+FG+  C  +CPT + R   
Sbjct: 23  QAPPPEAPLAGSTIGGDFELTSESGDTVNWSDFDGQYRIVYFGYAYCPDICPTDVQRAMA 82

Query: 82  LLKQVDPTGT----LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKN 137
            L+Q +         +   F+++DP+RDT EV+ +F   F  R+IG++G P  + + A  
Sbjct: 83  GLRQFEQDNPALGAQIQPLFVSIDPERDTQEVVAEFTDAFHPRLIGLTGTPEQIEQAASA 142

Query: 138 FRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
           F+++       +      Y +DH+    LF   G  +  +P    +D+   ++
Sbjct: 143 FKVFYAR---GEDQPGGGYLMDHSNITYLFGPDGEPIATLPTDQGADAVATEL 192


>gi|73666784|ref|YP_302800.1| electron transport protein SCO1/SenC [Ehrlichia canis str. Jake]
 gi|5163245|gb|AAD40619.1|AF117730_1 major antigenic protein 2 homolog [Ehrlichia canis]
 gi|72393925|gb|AAZ68202.1| Electron transport protein SCO1/SenC [Ehrlichia canis str. Jake]
          Length = 205

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 55/210 (26%), Positives = 94/210 (44%), Gaps = 21/210 (10%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGT 47
           MKA+  IL   LL     + Y   + +              +       S   L+ QDG 
Sbjct: 1   MKAIKFILNVCLLFAAIFLGYSYITKQGIFQTKHHDTPNTTIPNEDGIQSSFSLINQDGK 60

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTP 107
             +      K  +V FGF+ C ++CP  L  +   L Q+      L   FIT+DPK DT 
Sbjct: 61  TVTSQDFLGKHMLVLFGFSACKSICPAELGLVSEALAQLGNNADKLQVIFITIDPKNDTV 120

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E +K+F + F  RI  ++G+  D+ ++ KN++IYV          ++ + ++H+  + L 
Sbjct: 121 EKLKEFHEHFDSRIQMLTGNTEDINQIIKNYKIYV-------GQADKDHQINHSAIMYLI 173

Query: 168 DTAGSIVG-VIPYKDDSDSAIEKINRLITY 196
           D  GS +   IP     ++ ++K+  L+  
Sbjct: 174 DKKGSYLSHFIPDLKSQENQVDKLLSLVKQ 203


>gi|257094969|ref|YP_003168610.1| electron transport protein SCO1/SenC [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047493|gb|ACV36681.1| electron transport protein SCO1/SenC [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 212

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 48/208 (23%), Positives = 89/208 (42%), Gaps = 18/208 (8%)

Query: 2   KALGIILGTIL--LAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTD 48
           K L + L   L  + +L ++ +     + +                   +  L    G  
Sbjct: 4   KTLLMALIAALSAILILLAVFWEPVPPRPIARIAPHERLPAATAPPAGGEFTLQGAQGN- 62

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTP 107
             LS    K  +++FG+T C  VCPT+LS L + L +        +   FI+VDP+RDT 
Sbjct: 63  VRLSDFRGKVVLIYFGYTYCPDVCPTSLSLLAQALSELAPNERERVQGIFISVDPERDTA 122

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
             ++++   F  +I+G+SG    + RVA+ +    +    +    E +Y VDH++A  + 
Sbjct: 123 ARLQEYTPFFHPQIVGLSGTAAQIARVAEQYGARYHKQAPD---AEGRYAVDHSSATYVV 179

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           D  G + G +P+       +  +   + 
Sbjct: 180 DPQGRLTGALPHASTPTQIVAAVREQLA 207


>gi|156555428|ref|XP_001605752.1| PREDICTED: similar to ENSANGP00000012964 [Nasonia vitripennis]
          Length = 274

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 52/201 (25%), Positives = 89/201 (44%), Gaps = 17/201 (8%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
           +G   +   G + Y+ +  +  +           G         LV   G          
Sbjct: 55  VGVTAVIGGGLLGYMYYLRELKEIKIAKERRRQIGKAAIGGKFELVDPQGNLVKSDDFLG 114

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
           K  +++FGFT+C  +CP  L +L  ++ +        +   FITVDP RDTPE + K+V+
Sbjct: 115 KWVMIYFGFTHCPDICPDELEKLSLVVDRLEKEYNIEVKPIFITVDPVRDTPEAVGKYVK 174

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            FSD+IIG++G    + +  K +R+Y +   +     ++ Y VDHT  + L D  G  + 
Sbjct: 175 EFSDKIIGLAGSIEQIAKACKAYRVYFS---SGPPDDDDDYIVDHTVIIYLIDPEGGFID 231

Query: 176 VIPYKDDSDSAIEKINRLITY 196
                 D+D  I+ +  L+  
Sbjct: 232 YYGQTHDADKIIDSV--LLNK 250


>gi|33601510|ref|NP_889070.1| hypothetical protein BB2531 [Bordetella bronchiseptica RB50]
 gi|33575946|emb|CAE33025.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 216

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/158 (26%), Positives = 81/158 (51%)

Query: 39  VHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFI 98
             L    G   S   L  K  ++FFG+ +C  VCPTT+++L  +L+Q+      +   F+
Sbjct: 57  FSLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPTTMAQLTAVLQQLGEQARDVRILFV 116

Query: 99  TVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFV 158
           +VDP RDTP++++ +V  F++  IG++G+   +  +A+ +R+       +     + Y V
Sbjct: 117 SVDPHRDTPDILQAYVNAFNNNAIGVTGNEKQIADLARRYRVAYQIEKPKPGDDADIYDV 176

Query: 159 DHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            H+  + +FD  G    +    D  D+ ++ + +LI  
Sbjct: 177 THSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQ 214


>gi|311105897|ref|YP_003978750.1| alkyl hydroperoxide reductase [Achromobacter xylosoxidans A8]
 gi|310760586|gb|ADP16035.1| AhpC/TSA family protein 4 [Achromobacter xylosoxidans A8]
          Length = 204

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 45/193 (23%), Positives = 90/193 (46%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           +AL  +L T+ + +          + +       +    L    G   S   L  K  ++
Sbjct: 8   RALRSLLLTLCVFLAACGDRNVDWTLYNVKGHLPDLKFSLPGAGGKTISSDDLKGKTVLL 67

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFG+ +C  VCPTT+++L  +L+ +      +   F++VDP RDTP++++ +V  F++  
Sbjct: 68  FFGYASCPDVCPTTMAQLTAVLQNLGDKARDVRILFVSVDPHRDTPDILQAYVNAFNNNA 127

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           IG++GD   +  +A+ +R+             + Y V H+  + +FD  G    +    D
Sbjct: 128 IGVTGDEKQIADLARRYRVAYQIEKPRPGDDADMYEVTHSRGVYIFDKDGKARLLASDTD 187

Query: 182 DSDSAIEKINRLI 194
             ++  + + +LI
Sbjct: 188 SIEAMTKDVRQLI 200


>gi|229368054|gb|ACQ59007.1| SCO1 protein homolog, mitochondrial precursor [Anoplopoma fimbria]
          Length = 304

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 42/202 (20%), Positives = 80/202 (39%), Gaps = 12/202 (5%)

Query: 2   KALGIILGTILLAVLGS-------IAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L I        + G           +        G         L+  +         
Sbjct: 94  KSLAITFAIGGTLLAGMKYLKKEKEEQIEKERTKSIGRPALGGPFSLIDHNNKPTKSEDF 153

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  + ++  ++ ++D   +   L    IT+DP RDT E M  
Sbjct: 154 LGQWVLIYFGFTHCPDICPDEIEKMIEVVDEIDRIKSLPNLTPILITIDPDRDTTEAMGA 213

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS ++IG++G    + +V++ +R+Y +    ++   +  Y VDHT  + L    G 
Sbjct: 214 YVKEFSPKLIGLTGKKDQIDQVSRAYRVYYSQGPKDE---DNDYIVDHTIIMYLVAPDGE 270

Query: 173 IVGVIPYKDDSDSAIEKINRLI 194
                     S      I   +
Sbjct: 271 FAEYFGQNKRSGEISSSIASHM 292


>gi|4406651|gb|AAD20051.1| h-sco1 [Homo sapiens]
          Length = 190

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 42/167 (25%), Positives = 79/167 (47%), Gaps = 5/167 (2%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G         L    G   +      +  +++FGFT+C  VCP  L ++ +++ ++D   
Sbjct: 21  GKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSIT 80

Query: 91  TLLN--AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
           TL +    FI++DP+RDT E +  +V+ FS +++G++G   +V +VA+ +R+Y +    +
Sbjct: 81  TLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKD 140

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           +   +E Y VDHT  + L    G  +               I   + 
Sbjct: 141 E---DEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMR 184


>gi|167031147|ref|YP_001666378.1| electron transport protein SCO1/SenC [Pseudomonas putida GB-1]
 gi|166857635|gb|ABY96042.1| electron transport protein SCO1/SenC [Pseudomonas putida GB-1]
          Length = 210

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/208 (24%), Positives = 86/208 (41%), Gaps = 18/208 (8%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVD-------------GNRRFNSDVHLVAQDGTDF 49
               IL  ++  +LG       + +                   R  +DV +  QDG   
Sbjct: 6   KTVFILVALVALILGLTVNKVLNGRDQPNPTELIDAGIILLPQSRTVADVTMTNQDGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
            L  L  K S++FFG+T C  +CPTTL++L ++  +        L    ++VDP RDTP 
Sbjct: 66  RLDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSELPKEAVDRLQVVLVSVDPNRDTPN 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F    +G++G   D  ++A    I        K G    Y VDH+  L +  
Sbjct: 126 QLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFIPADTSKPG----YTVDHSGNLAVVG 181

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G   G I    ++   + ++  L+  
Sbjct: 182 PDGRQRGFIRAPFNNQKLVAQLPGLVKR 209


>gi|42520015|ref|NP_965930.1| SCO1/SenC family protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42409752|gb|AAS13864.1| SCO1/SenC family protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 202

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 48/207 (23%), Positives = 91/207 (43%), Gaps = 20/207 (9%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNR-------RFNSDVHLVAQDGTDFSLSSL 54
           + + ++   +    +  + Y  F+ K +           +   D  L+ QDG     S  
Sbjct: 3   RFIRLLSNVLAALAVVFLGYCYFTKKGIFAPAAIHNAEVKIGGDFSLINQDGQILRSSDF 62

Query: 55  YIKPSIVFFGFTNCSAVCPT-TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
             K  ++FFGF++C  +CP       + L K  + T   L  +FITVDP+RD+ E +K+F
Sbjct: 63  KDKYMMIFFGFSSCKRICPMNLGIISETLAKLDEKTNNKLQTFFITVDPERDSTERLKEF 122

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
            Q+F  RI  ++G+   +  V   +++Y + V  E+        ++H++ + L    G  
Sbjct: 123 QQQFDHRIQMLTGEREKIDEVIAKYKVYASKVGGEE-------EINHSSIMYLIGPGGKY 175

Query: 174 VGVIPYKDDSDS-----AIEKINRLIT 195
           V       +SD       + +I + + 
Sbjct: 176 VTHFAADLNSDESQSDKILAEIRKYVN 202


>gi|83646725|ref|YP_435160.1| hypothetical protein HCH_04019 [Hahella chejuensis KCTC 2396]
 gi|83634768|gb|ABC30735.1| uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of
           respiratory and photosynthetic systems [Hahella
           chejuensis KCTC 2396]
          Length = 195

 Score =  111 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 48/198 (24%), Positives = 93/198 (46%), Gaps = 7/198 (3%)

Query: 1   MKALGIILGTILLAVLGSIA--YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           M A+ ++   I++ +  + +   + +S   + G         L +++    S      K 
Sbjct: 1   MTAIRLVFIAIVMTLTSACSQEPLEWSGTDISGMLPELK-FSLQSENAASVSEKDFEGKY 59

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDP-TGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           +I+FFG+T C  +CPTTL+RL   L +++      +N  F++VDPKRD PE +K +   F
Sbjct: 60  NILFFGYTYCPDICPTTLARLKSALSKLEASEQQRINILFVSVDPKRDAPEQLKAYTDAF 119

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
               +G++GD   +  + K +R+               Y V H++A  +FD  G    ++
Sbjct: 120 GPEFVGLTGDMDALQSITKRYRVAFG---YGNPDEAGNYDVSHSSAAFVFDANGKARLLL 176

Query: 178 PYKDDSDSAIEKINRLIT 195
                +D   + +++L+ 
Sbjct: 177 RDDLSADMIAKDLDQLLK 194


>gi|170741926|ref|YP_001770581.1| electron transport protein SCO1/SenC [Methylobacterium sp. 4-46]
 gi|168196200|gb|ACA18147.1| electron transport protein SCO1/SenC [Methylobacterium sp. 4-46]
          Length = 197

 Score =  111 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 56/176 (31%), Positives = 84/176 (47%), Gaps = 5/176 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD-GNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           M+   I L   +L +       S                  LV QDG   +   +  +  
Sbjct: 7   MRRAAIPLVAFVLGLAALGLAASAMLGRPTVPASGVGGPFALVDQDGRPVTDKDVAGRAH 66

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +VFFGFT+C  VCPTTL ++  +L  + P G    A FITVDP+RDTPE +K ++  F  
Sbjct: 67  LVFFGFTHCPDVCPTTLQQISDVLAALGPKGRDAKALFITVDPERDTPEALKAYLASFDP 126

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
           RI+G++G P  V    K++R+Y   V  +       Y ++HT  + + D   + VG
Sbjct: 127 RIVGLTGTPEAVAGTLKSYRVYSRKVPLKD----GDYTMEHTALVYIMDARNNFVG 178


>gi|87200866|ref|YP_498123.1| electron transport protein SCO1/SenC [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87136547|gb|ABD27289.1| electron transport protein SCO1/SenC [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 204

 Score =  111 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 46/196 (23%), Positives = 84/196 (42%), Gaps = 9/196 (4%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDG--NRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
               IL  +      ++A  + +              D  L  +DG     S    K  +
Sbjct: 9   TFRSILAAVAATCTFALAACNGAPTEKPPLEGAAIGGDFTLTGKDGRPVRWSDFAGKYRV 68

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTG----TLLNAYFITVDPKRDTPEVMKKFVQR 116
           V+FG+T C  VCP  L  + + L+            +   FIT+DP+RDT EV+ K+   
Sbjct: 69  VYFGYTFCPDVCPLDLQNIAQGLRLFGKDHADLAANVVPVFITIDPERDTAEVVGKYAAN 128

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F  +++G++G P  +  VA+ + ++       K    E Y +DH+ A  L    G  + +
Sbjct: 129 FGPKVVGLTGTPAQIADVARKWAVFYQKRDDGK---PEAYLMDHSRAAYLMGPKGDAIAL 185

Query: 177 IPYKDDSDSAIEKINR 192
           +P + D+ +   ++ +
Sbjct: 186 LPAEQDAKAVAAELAK 201


>gi|182679336|ref|YP_001833482.1| electron transport protein SCO1/SenC [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635219|gb|ACB95993.1| electron transport protein SCO1/SenC [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 205

 Score =  111 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 57/192 (29%), Positives = 94/192 (48%), Gaps = 6/192 (3%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVD--GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
           G+I GTIL+  + ++  V  +   +       F     LV Q+G + + +    +P ++F
Sbjct: 13  GLIAGTILVGGVFALGSVMRNGGRMHAADAAHFGGPFELVDQNGAEVTQARFSGRPLVLF 72

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  +C T L+ +     Q+      L   F+TVDP+RDTP V+  ++Q F+   I
Sbjct: 73  FGYTHCQDICSTALADMSLWQAQLGDKAASLPFVFVTVDPERDTPAVLHDYLQNFAGHFI 132

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
           G+SG    V  +   + I    V       +  Y +DHT  + L +  GS+ G I   DD
Sbjct: 133 GLSGRVDAVKSMLGEYHIASLPV----GRSDGSYDLDHTGGIFLINGDGSLAGTIASHDD 188

Query: 183 SDSAIEKINRLI 194
             + + KI RL+
Sbjct: 189 LGTGLAKIRRLL 200


>gi|21243454|ref|NP_643036.1| hypothetical protein XAC2727 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|294625089|ref|ZP_06703735.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|21109009|gb|AAM37572.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|292600598|gb|EFF44689.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 197

 Score =  111 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 45/191 (23%), Positives = 73/191 (38%), Gaps = 3/191 (1%)

Query: 6   IILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGF 65
           ++LG   L    S  +    +       R      L   DGT      L    ++VF GF
Sbjct: 1   MLLGQKFLGGAPSSPWPPTKTITFYPQPRPLPQFSLRQSDGTQLVPGELKGHWTLVFLGF 60

Query: 66  TNCSAVCPTTLSRLDRLLKQVDPTGT--LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           T C  VCPTTL+ L    +Q +           F++VDP+RD P  + ++   F    + 
Sbjct: 61  TFCPDVCPTTLTDLAVAQQQWEAIPDGLRPRVLFVSVDPQRDPPARLGEYAHAFHKDTLA 120

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKS-GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
            + D   + R A         V  +        Y +DH+  + + D  G + G+I    D
Sbjct: 121 ATADVPALERFATALGFVFQKVPGKGYAQNPNDYSMDHSAGIAVLDPQGRLAGLIRPPLD 180

Query: 183 SDSAIEKINRL 193
             +    + +L
Sbjct: 181 PKAIAADLQQL 191


>gi|114669057|ref|XP_001164743.1| PREDICTED: similar to h-sco1 isoform 3 [Pan troglodytes]
          Length = 190

 Score =  111 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 42/162 (25%), Positives = 78/162 (48%), Gaps = 5/162 (3%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G         L    G   +      +  +++FGFT+C  VCP  L ++ +++ ++D   
Sbjct: 21  GKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSIT 80

Query: 91  TLLN--AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
           TL +    FI++DP+RDT E +  +V+ FS +++G++G   +V +VA+ +R+Y +    +
Sbjct: 81  TLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKD 140

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
           +   +E Y VDHT  + L    G  +               I
Sbjct: 141 E---DEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASI 179


>gi|326470547|gb|EGD94556.1| mitochondrial metallochaperone Sco1 [Trichophyton tonsurans CBS
           112818]
          Length = 297

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 51/201 (25%), Positives = 82/201 (40%), Gaps = 16/201 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
               +L   G I Y  +    ++           G  R      L   +           
Sbjct: 82  AVLFVLTGAGMIVYFQYEKARLERERIVEMSKGVGKPRVGGPFVLKDLNERPSRRRISKG 141

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQ---VDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           K S V+FGFT+C  +CP  L ++  ++ +         ++   FIT DP RD+PEV++ +
Sbjct: 142 KYSFVYFGFTHCPDICPDELDKMAEIIDEVRARSNGQEVMRPVFITCDPARDSPEVLRGY 201

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           +  F   IIG++G    V  V + +R+Y +    +     E Y VDH+    L D  G  
Sbjct: 202 LNEFHKDIIGLTGTYEQVKDVCRQYRVYFST--PQNIKPGEDYLVDHSIYFYLMDPEGDF 259

Query: 174 VGVIPYKDDSDSAIEKINRLI 194
           V  I  +D   +A + I   I
Sbjct: 260 VECIGRQDTPQTASKVILDHI 280


>gi|255261242|ref|ZP_05340584.1| protein SenC [Thalassiobium sp. R2A62]
 gi|255103577|gb|EET46251.1| protein SenC [Thalassiobium sp. R2A62]
          Length = 207

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 41/202 (20%), Positives = 85/202 (42%), Gaps = 15/202 (7%)

Query: 1   MKALG-IILGTILLAVLGSIAYVSFSSKFVD----------GNRRFNSDVHLVAQDGTDF 49
           M  +  I  GT ++A++G     +   +  D                    LV  DG   
Sbjct: 1   MSKIAAIAAGTTVVALIGGAYLFTLVDRDADVFAQCRASQVAGGDIGGPFTLVNGDGVTV 60

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPE 108
           +   +  +PS+++FG+T C  VCP  ++R    ++ ++     ++   FI++DP+RD  +
Sbjct: 61  TSEEVIDQPSLIYFGYTFCPDVCPLDVARNTVAIEILEEDRGMMVQPVFISIDPERDDVQ 120

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +  +   F +R++G++G P  V   +  +R Y      +     + Y +DH+T   L  
Sbjct: 121 TVSDYAANFHERMVGLTGSPEQVKSASTAYRTYYRKQEGDD---PDYYLMDHSTFSYLMF 177

Query: 169 TAGSIVGVIPYKDDSDSAIEKI 190
               +V         +   +++
Sbjct: 178 PDVGLVEFFRNDIGPEKMADQM 199


>gi|83943437|ref|ZP_00955896.1| Electron transport protein [Sulfitobacter sp. EE-36]
 gi|83845669|gb|EAP83547.1| Electron transport protein [Sulfitobacter sp. EE-36]
          Length = 215

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 47/167 (28%), Positives = 77/167 (46%), Gaps = 3/167 (1%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
           G+    S+  L+  D    +      +  +VFFGFTNC  +CPTTL+ +  +L ++    
Sbjct: 46  GDADIRSEFALIDHDEQAVTQDDYKGRWQLVFFGFTNCPDICPTTLAYMGSVLDKLGSEA 105

Query: 91  TLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKS 150
             +   F+TVDP+RDTPEV+K +V  F  ++ G++G    V   A  F++Y   +  E  
Sbjct: 106 NQVAPLFVTVDPERDTPEVLKDYVANFHPQLTGLTGSTAQVSAAADAFKVYHEKLSNE-- 163

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVI-PYKDDSDSAIEKINRLITY 196
              + Y + H   + L    G    V        +   E+I+  I  
Sbjct: 164 TAPDGYMMAHAGHIYLMAPDGRFDAVFLESAQPVEEMAEQISMRIAK 210


>gi|170033218|ref|XP_001844475.1| SCO1, mitochondrial [Culex quinquefasciatus]
 gi|167873882|gb|EDS37265.1| SCO1, mitochondrial [Culex quinquefasciatus]
          Length = 264

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 56/212 (26%), Positives = 90/212 (42%), Gaps = 22/212 (10%)

Query: 1   MKALGII----LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQD 45
           MK  G I       I  A LG + ++ +     +           G         LV  +
Sbjct: 45  MKGKGPITWKSFALIATAGLGGLGFMWYVKDEKEQALMRERKRQLGKAAIGGAWELVDAE 104

Query: 46  GTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPK 103
           G     +    +  +++FGFT+C  +CP  L ++  ++           +   FITVDP 
Sbjct: 105 GNVRKSADFVGQWLLIYFGFTHCPDICPDELEKMAAVVDGLAKVEEADTIQPLFITVDPV 164

Query: 104 RDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTA 163
           RDT E++ K+V+ F  R++G++G    + RV K FR+Y +    ++   +E Y VDHT  
Sbjct: 165 RDTREIVGKYVKEFHPRLLGLTGTVDQIARVCKAFRVYFSAGPKDQ---DEDYIVDHTII 221

Query: 164 LLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           + L D  G  V       D +     I  LI 
Sbjct: 222 MYLCDPQGQFVDYYGINRDKEQIKSSI--LIN 251


>gi|332188401|ref|ZP_08390125.1| SCO1/SenC family protein [Sphingomonas sp. S17]
 gi|332011547|gb|EGI53628.1| SCO1/SenC family protein [Sphingomonas sp. S17]
          Length = 212

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 80/184 (43%), Gaps = 7/184 (3%)

Query: 16  LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT 75
            GS    S   +      +      L   DG   +      +  +++FG+T C  VCPT 
Sbjct: 32  CGSGPQTSAQEQPPLAGAKIGGPFRLTGADGRTVTDRDFAGRYRVMYFGYTFCPDVCPTD 91

Query: 76  LSRLDRLLKQVD----PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDV 131
           +  +   LK +D         + A F+TVDP+RDTPEV+ +F   F  RI+G++G P  +
Sbjct: 92  MQAIAAGLKLLDKSAPAKAKKIAAVFVTVDPERDTPEVVGRFAAAFDPRIVGLTGTPAQI 151

Query: 132 MRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKIN 191
               K + ++              Y V+H+  + L D AG  + ++P  +   +    ++
Sbjct: 152 DAAKKAYAVWSQK---GDPAPGGGYLVNHSRQVYLMDPAGKPLALVPSDEGPQAVAATLD 208

Query: 192 RLIT 195
           R + 
Sbjct: 209 RWVQ 212


>gi|85710335|ref|ZP_01041400.1| Electron transport protein [Erythrobacter sp. NAP1]
 gi|85689045|gb|EAQ29049.1| Electron transport protein [Erythrobacter sp. NAP1]
          Length = 205

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 90/193 (46%), Gaps = 7/193 (3%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
           ++  + L +    +  +   +          +  L    G     +    +  IV+FG+ 
Sbjct: 16  VVAPLALVLSACGSEPAVPVEPPLYGATIGGEFDLQNTSGEAVKWADFNGQYRIVYFGYA 75

Query: 67  NCSAVCP----TTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
            C  +CP     T+  L++   +    G  +   FI+VDP RDTPEV+++F   FS+R+I
Sbjct: 76  YCPDICPTDVQRTVQGLNQFTDENPELGEQVQPIFISVDPDRDTPEVVEEFTNAFSERLI 135

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
           G++G P  +   AK F +Y   +    S   + Y +DH+  +LLF   G  + ++P    
Sbjct: 136 GLTGSPDQIADAAKTFGVYYTKL---DSPSPDTYLMDHSRTVLLFGPQGEPLALLPADLG 192

Query: 183 SDSAIEKINRLIT 195
           +D+  E++ + +T
Sbjct: 193 ADAVAEELGKWVT 205


>gi|254563260|ref|YP_003070355.1| hypothetical protein METDI4927 [Methylobacterium extorquens DM4]
 gi|254270538|emb|CAX26541.1| hypothetical protein; putative exported protein [Methylobacterium
           extorquens DM4]
          Length = 205

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 37/162 (22%), Positives = 73/162 (45%), Gaps = 4/162 (2%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
                  L+ Q G   + +    +  +V FGFT C  +CPT L  + R L  +   G  +
Sbjct: 42  PVGGPFALIDQAGRPRTEADFRGRLLLVTFGFTACPDICPTDLMEIGRALTLLGEAGDAV 101

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              FIT+DP+ DT  ++ +++  F  R++G++G    V R A  +++Y           +
Sbjct: 102 QPLFITLDPEHDTAALLAEYLPNFHPRLVGLTGSAAAVRRAADAYKVYYET----SLRSD 157

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
               ++H+  + L D +G+ +G  P    ++  +  +   + 
Sbjct: 158 GGRAIEHSAFVYLMDRSGAYLGFFPPGTSAERMLTILRPHLA 199


>gi|99034423|ref|ZP_01314430.1| hypothetical protein Wendoof_01000769 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 202

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/207 (23%), Positives = 90/207 (43%), Gaps = 20/207 (9%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNR-------RFNSDVHLVAQDGTDFSLSSL 54
           + + ++   +    +  + Y  F+ K +           +   D  L+ QDG     S  
Sbjct: 3   RFIRLLSNVLAALAVVFLGYCYFTKKGIFAPAAIHNAEVKIGGDFSLINQDGQILRSSDF 62

Query: 55  YIKPSIVFFGFTNCSAVCPT-TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
             K  ++FFGF++C  +CP       + L K  + T   L  +FITVDP+RD+ E +K+F
Sbjct: 63  KDKYMMIFFGFSSCKRICPMNLGIISETLAKLDEKTNNKLQTFFITVDPERDSTERLKEF 122

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
            Q+F  RI  ++G    +  V   +++Y + V  E+        ++H++ + L    G  
Sbjct: 123 QQQFDHRIQMLTGKREKIDEVIAKYKVYASKVGGEE-------EINHSSIMYLIGPGGKY 175

Query: 174 VGVIPYKDDSDS-----AIEKINRLIT 195
           V       +SD       + +I + + 
Sbjct: 176 VTHFAADLNSDESQSDKILAEIRKYVN 202


>gi|33592138|ref|NP_879782.1| hypothetical protein BP0988 [Bordetella pertussis Tohama I]
 gi|33571782|emb|CAE41289.1| putative exported protein [Bordetella pertussis Tohama I]
          Length = 204

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/158 (26%), Positives = 80/158 (50%)

Query: 39  VHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFI 98
             L    G   S   L  K  ++FFG+ +C  VCPTT+++L  +L+Q+      +   F+
Sbjct: 45  FSLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPTTMAQLTAVLQQLGEQARDVRILFV 104

Query: 99  TVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFV 158
           +VDP RDTP++++ +V  F+   IG++G+   +  +A+ +R+       +     + Y V
Sbjct: 105 SVDPHRDTPDILQAYVNEFNSNAIGVTGNEKQIADLARRYRVAYQIEKPKPGDDADIYDV 164

Query: 159 DHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            H+  + +FD  G    +    D  D+ ++ + +LI  
Sbjct: 165 THSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQ 202


>gi|322492741|emb|CBZ28019.1| putative electon transport protein SCO1/SCO2 [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 286

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 4/157 (2%)

Query: 23  SFSSKFVDGNRRFNSDVHLVA-QDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +  S              LV  + G   +   +  K   ++FGFTNC  VCP  ++++ R
Sbjct: 48  AVKSFDSPEGPSIGGPFSLVDVKTGKRVTDVDMKGKWLYIYFGFTNCPDVCPEEMAKMAR 107

Query: 82  LLKQVDPT--GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
           ++K +D           FI++DPKRDTP  +++++  FS RI+G+ G   +V   A+ +R
Sbjct: 108 VIKHLDKKVGKDYWQPIFISLDPKRDTPAKIREYLSDFSPRIMGLVGTQAEVEEAARQYR 167

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           +Y   +  E++  E+ Y VDH+  + L D  G     
Sbjct: 168 VYFA-IPDEEAMSEDDYLVDHSIIMYLIDPEGRFSDY 203


>gi|149187056|ref|ZP_01865362.1| Electron transport protein [Erythrobacter sp. SD-21]
 gi|148829267|gb|EDL47712.1| Electron transport protein [Erythrobacter sp. SD-21]
          Length = 203

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/198 (21%), Positives = 77/198 (38%), Gaps = 7/198 (3%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K   +     L A                       D  L+ +DG D S S    +   +
Sbjct: 9   KYASLPALLFLAACSSETPAPPPEEGPPLEGAALGGDFTLLGEDGEDVSWSDYDGQYRTI 68

Query: 62  FFGFTNCSAVCPTTLSRLD----RLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
           +FG+  C  VCPT   R         ++    G  +   F++VDP+RDTPEV+ +F   F
Sbjct: 69  YFGYAYCPDVCPTDNQRAMAGLKAFEEENPEAGAKIQPLFVSVDPERDTPEVLTEFTDAF 128

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
             R+IG++G    +   A  F ++       +      Y ++H+    LF   G  +  +
Sbjct: 129 HPRLIGMTGTKEQLDAAAAAFAVFYGR---GEDSPGGGYLIEHSNITYLFGPNGEPLATL 185

Query: 178 PYKDDSDSAIEKINRLIT 195
           P  +  ++   ++ + + 
Sbjct: 186 PTDEGPEAVAAELAKWVN 203


>gi|294666800|ref|ZP_06732034.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603461|gb|EFF46878.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 197

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/191 (23%), Positives = 73/191 (38%), Gaps = 3/191 (1%)

Query: 6   IILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGF 65
           ++LG   L    S  +    +       R      L   DGT      L    ++VF GF
Sbjct: 1   MLLGQKFLGGAPSSPWPPTKTITFYPQPRPLPQFSLRQSDGTQLVPGELKGHWTLVFLGF 60

Query: 66  TNCSAVCPTTLSRLDRLLKQVDPTGT--LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           T C  VCPTTL+ L    +Q +           F++VDP+RD P  + ++   F    + 
Sbjct: 61  TFCPDVCPTTLTDLAVAQQQWEAIPDGLRPRVLFVSVDPQRDPPARLGEYAHAFHKDTLA 120

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKS-GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
            + D   + R A         V  +        Y +DH+  + + D  G + G+I    D
Sbjct: 121 ATADVPALERFATALGFVFQKVPGKGYAQNSNDYSMDHSAGIAVLDPQGRLAGLIRPPLD 180

Query: 183 SDSAIEKINRL 193
             +    + +L
Sbjct: 181 PKAIAADLQQL 191


>gi|103488456|ref|YP_618017.1| electron transport protein SCO1/SenC [Sphingopyxis alaskensis
           RB2256]
 gi|98978533|gb|ABF54684.1| electron transport protein SCO1/SenC [Sphingopyxis alaskensis
           RB2256]
          Length = 215

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 83/191 (43%), Gaps = 10/191 (5%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           +A  I++    LA        +  ++      R      L  Q+G     S    +  ++
Sbjct: 13  RASLILVFGAALAGCDGSGGSAAPARPPLEGARIGGPFTLTDQNGRTVRDSDFAGRYRLI 72

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTG----TLLNAYFITVDPKRDTPEVMKKFVQRF 117
           +FG++ C  +CP  L +L R L + + T       +   FITVDP RDTPE +K FV R+
Sbjct: 73  YFGYSFCPDICPVDLQKLMRGLARFEKTDAARGARVAPLFITVDPARDTPEALKPFVARY 132

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
             R++G++G P  +   AK F +  N V        ++Y + H+    L    G  + ++
Sbjct: 133 HPRLLGLTGTPEQIAAAAKAFVVTYNKVPG---SAPDRYLMAHSQLAFLMGPDGKPLALL 189

Query: 178 P---YKDDSDS 185
           P      D D 
Sbjct: 190 PLDDPTTDPDE 200


>gi|254438609|ref|ZP_05052103.1| SCO1/SenC superfamily [Octadecabacter antarcticus 307]
 gi|198254055|gb|EDY78369.1| SCO1/SenC superfamily [Octadecabacter antarcticus 307]
          Length = 222

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/170 (24%), Positives = 76/170 (44%), Gaps = 4/170 (2%)

Query: 29  VDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDP 88
                       LV ++G   + + +   P++++FGFT C  VCP    R  + +  +D 
Sbjct: 57  QSAGGAIGGPFELVDENGVTVTDTDVITGPTLIYFGFTFCPDVCPLDNMRNAQAVDILDA 116

Query: 89  TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
            G  +   FI++DP+RDT +V+++F   F +R+IG++G    V   ++ +R Y     +E
Sbjct: 117 QGIEVTPVFISIDPERDTVDVVREFTNNFHERMIGLTGSLEQVRAASQAYRTYYAKQESE 176

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
                + Y VDHTT   L                ++   E ++  I   +
Sbjct: 177 D----DFYLVDHTTMSYLVFPEQGFQEFYRRDVTAEQMAESLSCFIEAAS 222


>gi|332141681|ref|YP_004427419.1| uncharacterized secreted protein of SCO1/SenC/PrrC family
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327551703|gb|AEA98421.1| uncharacterized secreted protein of SCO1/SenC/PrrC family
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 214

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/214 (22%), Positives = 94/214 (43%), Gaps = 22/214 (10%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF---------NSDVHLVAQDGTDFSLSS 53
            + + L   L    G +  +  +   V+G   +          S   LV+  G  F  SS
Sbjct: 4   RITVGLVAFLALCAGIVGALYIAPPSVEGEPEYFQTYPEPRAISPFSLVSHKGERFDTSS 63

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMK 111
           L  + S+VF G+T C  +CPTT++ L+ +  ++    +   +   F++VDPKRD+ E + 
Sbjct: 64  LKGQWSLVFVGYTFCPDICPTTMAELNNIYPELQALNSVEPIRIVFVSVDPKRDSVERLA 123

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
           ++V  F++  I ++G+   +    +N  +        +S     Y VDH+ +++L D   
Sbjct: 124 EYVSYFNEEFIALTGEHKTLFPFVRNLGMMYA---IAESTDNPNYLVDHSASVVLIDPEA 180

Query: 172 SIVGVIPYK--------DDSDSAIEKINRLITYG 197
            ++G    K         DS   +  +  +I+  
Sbjct: 181 RVIGRFKPKREPGKLSISDSQQILADMPVIISKQ 214


>gi|163745136|ref|ZP_02152496.1| SenC protein [Oceanibulbus indolifex HEL-45]
 gi|161381954|gb|EDQ06363.1| SenC protein [Oceanibulbus indolifex HEL-45]
          Length = 204

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 51/208 (24%), Positives = 90/208 (43%), Gaps = 15/208 (7%)

Query: 1   MKAL----GIILGTILLAVLGSI-------AYVSFSSKFVDGNRRFNSDVHLVAQDGTDF 49
           MK +     + +  + LA    +       AY S  S  V G         LV   G   
Sbjct: 1   MKQMIAFGAVGVAAVFLAGTAFMVLRGEDDAYASCRSSQVAGG-DIGGPFELVNGAGETV 59

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEV 109
           + + +  +P++++FG+T+C  VCP  + R     + ++  G  +   FITVDP RDTP+V
Sbjct: 60  TDTDVITEPALLYFGYTSCPDVCPLDVDRNAAATEILEERGQSITPVFITVDPARDTPKV 119

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           +  F +    R++G++G P  V   ++ +R Y     A++     +Y VDH+T   L   
Sbjct: 120 VGDFAEVMHPRMVGLTGSPEQVKAASQAYRTYYKAHPADE---SGEYLVDHSTFSYLVMP 176

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLITYG 197
              +V     +   +   + I   +   
Sbjct: 177 GEGVVDFFRREVRPEQMADSIGCFLDQS 204


>gi|157871307|ref|XP_001684203.1| electon transport protein SCO1/SCO2 [Leishmania major strain
           Friedlin]
 gi|68127271|emb|CAJ05482.1| putative electon transport protein SCO1/SCO2 [Leishmania major
           strain Friedlin]
          Length = 286

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 4/157 (2%)

Query: 23  SFSSKFVDGNRRFNSDVHLVA-QDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +  S              LV  + G   +   +  K   ++FGFTNC  VCP  ++++ R
Sbjct: 48  AVKSFDSPEGPSIGGPFSLVDVKTGRRVTDVDMKGKWLYIYFGFTNCPDVCPEEMAKMAR 107

Query: 82  LLKQVDPT--GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
           ++K +D           FI++DPKRDTP  +++++  FS RI+G+ G   +V   A+ +R
Sbjct: 108 VIKHLDKKVGKDYWQPIFISLDPKRDTPAKIREYLSDFSPRIMGLVGTQAEVEAAARQYR 167

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           +Y   +  E++  E+ Y VDH+  + L D  G     
Sbjct: 168 VYFA-IPDEEAMSEDDYLVDHSIIMYLIDPEGRFSDY 203


>gi|291615038|ref|YP_003525195.1| electron transport protein SCO1/SenC [Sideroxydans lithotrophicus
           ES-1]
 gi|291585150|gb|ADE12808.1| electron transport protein SCO1/SenC [Sideroxydans lithotrophicus
           ES-1]
          Length = 195

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/182 (26%), Positives = 84/182 (46%), Gaps = 4/182 (2%)

Query: 14  AVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCP 73
           A  G  +  S         +  ++D HL    G   SL+    K   +FFG+T+C  +CP
Sbjct: 16  ASCGEQSLPSPFQAGDVTAKYAHADFHLKDATGKPVSLADYRGKVVALFFGYTHCPQICP 75

Query: 74  TTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMR 133
           TTL+ L  ++K +      +   F+T+DP+RDTPE++ K+   F     G+ GD  +  +
Sbjct: 76  TTLAELAHMMKLLGKDADRVQVLFVTLDPQRDTPELLAKYPAAFYPTFKGLYGDSAETAQ 135

Query: 134 VAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
            AK F +     + +       Y +DH+         G  + + P+   SDS ++ +  L
Sbjct: 136 AAKAFGVTYEKHMNKD----GGYDLDHSAGTYFISPRGRPILLSPFWQHSDSWVQDVRIL 191

Query: 194 IT 195
           ++
Sbjct: 192 LS 193


>gi|260841240|ref|XP_002613836.1| hypothetical protein BRAFLDRAFT_208703 [Branchiostoma floridae]
 gi|229299226|gb|EEN69845.1| hypothetical protein BRAFLDRAFT_208703 [Branchiostoma floridae]
          Length = 205

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 85/199 (42%), Gaps = 10/199 (5%)

Query: 7   ILGTILLAVLGSI-----AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           ++G  LL     +       +        G       + +V   G   +      +  ++
Sbjct: 9   VIGAALLLFFNYLKREKELALEKERSKSLGKALIGGPISMVDHHGNPKTEKDYEGQWCLL 68

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA--YFITVDPKRDTPEVMKKFVQRFSD 119
           +FGFT+C  +CP  L ++ +++  +     L N    FI++DP+RD  + + ++V+ F  
Sbjct: 69  YFGFTHCPDICPDELDKMAQVVTDMANIKHLPNITPIFISIDPERDDVKSIAEYVKEFHP 128

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
            +IG++G    V +V+KNFR+Y +    +    +  Y VDHT  + L +     +     
Sbjct: 129 ELIGLTGSLEQVKQVSKNFRVYYSQGPVDD---DGDYIVDHTIIMYLMNPDWQFLDYYGK 185

Query: 180 KDDSDSAIEKINRLITYGN 198
             +SD  +  I   +    
Sbjct: 186 DKNSDQIVASIAGHMRKYR 204


>gi|167622191|ref|YP_001672485.1| electron transport protein SCO1/SenC [Shewanella halifaxensis
           HAW-EB4]
 gi|167352213|gb|ABZ74826.1| electron transport protein SCO1/SenC [Shewanella halifaxensis
           HAW-EB4]
          Length = 209

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/214 (22%), Positives = 92/214 (42%), Gaps = 22/214 (10%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFV-------DGNRRFNSDVHLVAQDGTDFSLSS 53
           M+   II   +++A     +    S K +         + +  +   L+ Q G  F+ + 
Sbjct: 1   MRLTWIITAILMVAAGVYASIGLNSPKPLALQTSFEYPSPQPLAPFSLIDQHGNTFTNAD 60

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K S+ F G+T+C  VCPTT+ +L      +   G  L   F++VDP+RD+   ++ +
Sbjct: 61  LNGKWSLFFIGYTSCPDVCPTTMGKLTSAYPSL-AQGEDLQVIFLSVDPQRDSTSTLESY 119

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++ F+   + ++G+   ++ V ++       V     G  E Y VDH+ +  L    G  
Sbjct: 120 IRFFNPEFVAVTGEHKQLLPVTRSLGFVYAMV-----GEGEDYQVDHSASFALVSPKGEK 174

Query: 174 VGVIPYKDDS---------DSAIEKINRLITYGN 198
           V +I  K  +            I  +N +I   +
Sbjct: 175 VAIIKPKSKTPGQLPQIKNRDLIHDVNAIIDKYS 208


>gi|33596112|ref|NP_883755.1| hypothetical protein BPP1457 [Bordetella parapertussis 12822]
 gi|33573115|emb|CAE36759.1| putative exported protein [Bordetella parapertussis]
          Length = 216

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/158 (26%), Positives = 81/158 (51%)

Query: 39  VHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFI 98
             L    G   S   L  K  ++FFG+ +C  VCPTT+++L  +L+Q+      +   F+
Sbjct: 57  FSLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPTTMAQLTAVLQQLGEQARDVRILFV 116

Query: 99  TVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFV 158
           +VDP RDTP++++ +V  F++  IG++G+   +  +A+ +R+       +     + Y V
Sbjct: 117 SVDPHRDTPDILQAYVNAFNNNAIGVTGNEKQIADLARRYRLAYQIEKPKPGDDADIYDV 176

Query: 159 DHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            H+  + +FD  G    +    D  D+ ++ + +LI  
Sbjct: 177 THSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQ 214


>gi|289663181|ref|ZP_06484762.1| putative SCO1/SenC family protein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289669403|ref|ZP_06490478.1| putative SCO1/SenC family protein [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 216

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/207 (23%), Positives = 77/207 (37%), Gaps = 15/207 (7%)

Query: 2   KALGIILGTILLAVLGSI------------AYVSFSSKFVDGNRRFNSDVHLVAQDGTDF 49
           +  GI+L   L A LG +             +    +       R      L   DGT  
Sbjct: 4   RNTGIVLLVALAAGLGMLLGQKFLGDAPSSPWPPTKTITFYPQPRPLPQFSLRQSDGTQL 63

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT--LLNAYFITVDPKRDTP 107
               L    ++VF GFT C  VCPTTL+ L    +Q +           F++VDP+RD P
Sbjct: 64  VPGELKGHWTLVFLGFTFCPDVCPTTLTDLAVAQQQWESIPDGLRPRVLFVSVDPQRDPP 123

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKS-GVEEKYFVDHTTALLL 166
             + ++   F    +  + D   + R A         V  +        Y +DH+  + +
Sbjct: 124 ARLGEYAHAFHKDTLAATADVPALERFAAALGFVFQKVPGKGYAQNPNDYSMDHSAGIAV 183

Query: 167 FDTAGSIVGVIPYKDDSDSAIEKINRL 193
            D  G + G+I    D  +    + +L
Sbjct: 184 LDPQGHLAGLIRPPLDPKAIAADLQQL 210


>gi|315425462|dbj|BAJ47125.1| electron transport protein SCO1/SenC [Candidatus Caldiarchaeum
           subterraneum]
          Length = 204

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/177 (28%), Positives = 83/177 (46%), Gaps = 3/177 (1%)

Query: 20  AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRL 79
               +         R   D  L  Q+G  F LSS+  K  +++FG+T+C  VCP  +++ 
Sbjct: 30  VLEPYKPAIEIPGERVLPDFTLTDQNGNPFKLSSVKGKAVLIYFGYTHCPDVCPLVMTKY 89

Query: 80  DRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
            +L+K +      +   FITVDP+RD  E MKK+V  +SDRII ++G P ++  VA+ + 
Sbjct: 90  GQLVKALGNRANDVALIFITVDPERDNVEAMKKYVAYYSDRIIALTGSPEEIDAVARLYN 149

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           +Y      ++      Y VDH   +L  D    +          +   + +  L+T 
Sbjct: 150 VYYKKYPPDEK---GNYLVDHYALVLGADRKHILRLAFTPDMPFEEYQKGVEWLLTK 203


>gi|47209425|emb|CAF95060.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 261

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/202 (22%), Positives = 87/202 (43%), Gaps = 15/202 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSD----------VHLVAQDGTDFSLSSL 54
            + +  +L + LG++ +   S K     RR                L+   G   S    
Sbjct: 62  RVAVTALLGSGLGAVWWWLDSEKQQQVQRRRVGQLRKVALGQGGFSLLDHQGQRRSKEDF 121

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKK 112
                +++FGFT+C  +CP  L +L  ++     DP+   +   FITVDP+RD    + +
Sbjct: 122 LGSWVLLYFGFTHCPDICPDELDKLSAVVATLDQDPSLPPVQPLFITVDPERDDVAALAR 181

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ F  R+IG++G   +V    +++R+Y +    ++   +  Y VDH+  + L    G 
Sbjct: 182 YVKDFHPRLIGLTGTSEEVKHAGRDYRVYASPGPKDE---DGDYIVDHSILIYLLSPDGL 238

Query: 173 IVGVIPYKDDSDSAIEKINRLI 194
            +       + D   + +   I
Sbjct: 239 FLDYYNRMKNQDQITQSVRNHI 260


>gi|332143394|ref|YP_004429132.1| uncharacterized secreted protein of SCO1/SenC/PrrC family
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327553416|gb|AEB00135.1| uncharacterized secreted protein of SCO1/SenC/PrrC family
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 214

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/214 (22%), Positives = 94/214 (43%), Gaps = 22/214 (10%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF---------NSDVHLVAQDGTDFSLSS 53
            + + L   L    G +  +  +   V+G   +          S   LV+  G  F  SS
Sbjct: 4   RITVGLVAFLALCAGIVGALYIAPPSVEGEPDYFQTYPEPRAISPFSLVSHKGERFDTSS 63

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMK 111
           L  + S+VF G+T C  +CPTT++ L+ +  ++    +   +   F++VDPKRD+ E + 
Sbjct: 64  LKGQWSLVFVGYTFCPDICPTTMAELNNIYPELQALNSVEPIRIVFVSVDPKRDSVERLA 123

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
           ++V  F++  I ++G+   +    +N  +        +S     Y VDH+ +++L D   
Sbjct: 124 EYVSYFNEEFIALTGEHKTLFPFVRNLGMMYA---IAESTDNPNYLVDHSASVVLIDPEA 180

Query: 172 SIVGVIPYK--------DDSDSAIEKINRLITYG 197
            ++G    K         DS   +  +  +I+  
Sbjct: 181 RVIGRFKPKREPGKLSISDSQQILADMPVIISKQ 214


>gi|126724552|ref|ZP_01740395.1| electron transport protein SCO1/SenC [Rhodobacterales bacterium
           HTCC2150]
 gi|126705716|gb|EBA04806.1| electron transport protein SCO1/SenC [Rhodobacterales bacterium
           HTCC2150]
          Length = 204

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/189 (24%), Positives = 79/189 (41%), Gaps = 9/189 (4%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFV------DGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
               ILL+ +G +     S+ F                  L+++ G   + + +  KP++
Sbjct: 11  AFVAILLSAMGILIARGPSTNFAGCESSGAVGGDIGGPFTLISESGDAVTDAEIITKPTL 70

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           V+FG+T C  VCP    R    L+ ++         FIT DP RDTPEV+ +F      +
Sbjct: 71  VYFGYTYCPDVCPLDAGRNAEALEVLENANIDAQGLFITFDPTRDTPEVLSEFTNYLHPK 130

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
           +IG++G    V   A  +R+Y     ++    EE Y +DH+    L       V      
Sbjct: 131 MIGLTGSQTQVEEAAAAYRVYFKKQPSDD---EEYYLMDHSNLTYLMMPDVGFVDFFRGD 187

Query: 181 DDSDSAIEK 189
             ++   +K
Sbjct: 188 VTAEEVAKK 196


>gi|115524953|ref|YP_781864.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           BisA53]
 gi|115518900|gb|ABJ06884.1| electron transport protein SCO1/SenC [Rhodopseudomonas palustris
           BisA53]
          Length = 196

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/193 (25%), Positives = 95/193 (49%), Gaps = 13/193 (6%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           + +   + L   L +  + + ++    G         L + +G   S  +L  +P  ++F
Sbjct: 15  IAVAFASCLAGGLPAHGWAAPAANGSWGT-------TLTSHNGAVLSGEALKGRPYAIYF 67

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD-RII 122
           G+T+C  +CPT++  +  +L Q+  +      YF+TVDP+RDTP ++K +++   D RII
Sbjct: 68  GYTHCPDICPTSMVDMTEVLGQLGESARDFRVYFVTVDPQRDTPALLKTYLEENFDRRII 127

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
           G++G P  +  VA  F           +G ++ Y + HT +  L D  G + G +P+   
Sbjct: 128 GLTGTPEAIATVANTFGAIYRK-----TGSDDNYTISHTASTFLIDRRGQLFGKMPHGGP 182

Query: 183 SDSAIEKINRLIT 195
            +  +E+I  L+ 
Sbjct: 183 IERKVEQIKELLA 195


>gi|170719318|ref|YP_001747006.1| electron transport protein SCO1/SenC [Pseudomonas putida W619]
 gi|169757321|gb|ACA70637.1| electron transport protein SCO1/SenC [Pseudomonas putida W619]
          Length = 210

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/208 (24%), Positives = 89/208 (42%), Gaps = 17/208 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF------------NSDVHLVAQDGTDF 49
           K + I++  + L +  ++  V   S   +                  +DV +  QDG   
Sbjct: 6   KTVFILVALVALIMGLTVNKVLNGSDQPNPTELIDAGIILLPQSRTVADVTMTNQDGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
            L  L  K S++FFG+T C  +CPTTL++L ++  +        L    ++VDP RDTP 
Sbjct: 66  QLDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSELSKEAADRLQVVLVSVDPNRDTPN 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F    +G++G   D  ++A    I        K G    Y VDH+  L +  
Sbjct: 126 QLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFIPADTSKPG----YTVDHSGNLAIVG 181

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G   G I    ++   + ++  L+  
Sbjct: 182 PDGRQRGFIRAPFNNQKLVAQLPGLVKR 209


>gi|146278990|ref|YP_001169149.1| electron transport protein SCO1/SenC [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557231|gb|ABP71844.1| electron transport protein SCO1/SenC [Rhodobacter sphaeroides ATCC
           17025]
          Length = 231

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 73/174 (41%), Gaps = 4/174 (2%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ 85
                          LV QDG   +   +  KP++V+FG+T C  VCP  ++R  + +  
Sbjct: 37  GANQVAGGAIGGPFTLVNQDGETVTDREVLAKPALVYFGYTFCPDVCPFDMARNAQAVDI 96

Query: 86  VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
           +   G  +   FI+VDP RDTPE +K F +      + ++G    V   ++ ++ +    
Sbjct: 97  LTEWGIDVTPVFISVDPARDTPEQLKFFAEAIHPATVALTGSGEQVKAASQAYKTFYRVQ 156

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNV 199
            AE     E Y +DH+T           V      D  +   E+++  +   +V
Sbjct: 157 EAED----EYYLIDHSTFTYFMLPGVGFVDFFKRDDTPEQIAERVSCFVNDSHV 206


>gi|296135533|ref|YP_003642775.1| electron transport protein SCO1/SenC [Thiomonas intermedia K12]
 gi|295795655|gb|ADG30445.1| electron transport protein SCO1/SenC [Thiomonas intermedia K12]
          Length = 208

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 81/161 (50%), Gaps = 3/161 (1%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
            N + +L    G   +  +   K  +++FG+T+C  VCPTT+  +  +++Q+ P G  + 
Sbjct: 48  PNLEFNLTNDLGQKVTAENYKGKVVLLYFGYTHCPDVCPTTMQLMSNVVQQLGPQGKDVR 107

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             F++VDPKRD+  ++K +   FS   +G++G    +  + + +R+  +     K   + 
Sbjct: 108 ILFVSVDPKRDSNTILKAYTAAFSPNAVGLTGTIKQIDDLTRRYRVAFS---YGKPDAQG 164

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            Y VDH+  + +F  +G I  +    +   + +  + +LI 
Sbjct: 165 NYVVDHSAGVYIFGRSGRIHLLGSDTNPPAAFVHDLKQLIA 205


>gi|311696672|gb|ADP99545.1| electron transport protein SCO1/SenC [marine bacterium HP15]
          Length = 223

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/215 (20%), Positives = 88/215 (40%), Gaps = 27/215 (12%)

Query: 1   MKA---LGIILGTILLAVLGSIAY-------------------VSFSSKFVDGNRRFNSD 38
           MK+   + + L  +LL V+                        ++  + +V    R  ++
Sbjct: 1   MKSSSSIRLTLFCLLLIVVLIFGLVVGRQVFLVGNEEPIPAPELTEFNTYVYDQPRQLTE 60

Query: 39  VHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFI 98
             L  ++G   +  SL  + +I F G+TNC  +CP  ++ L +  K +       +   +
Sbjct: 61  FTLTDENGETVTRESLRGRWTIAFVGYTNCPDICPAAMANLRQTDKLLSKELPQPDYLLV 120

Query: 99  TVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFV 158
           + DP+ DTPE +K +   F +   G++GD   +  +AK+              V+++  V
Sbjct: 121 SADPEHDTPEKLKAYTDFFGENFHGLTGDLDTLRELAKSLNAVF-----VHREVDDELLV 175

Query: 159 DHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
           DH+    L +  G +  VI    +  +  E   R+
Sbjct: 176 DHSGHFALLNPDGELAAVIQPPHNPHNLAEAFERI 210


>gi|294339662|emb|CAZ88022.1| putative Electron transport protein SCO1/SenC [Thiomonas sp. 3As]
          Length = 208

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 81/161 (50%), Gaps = 3/161 (1%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
            N + +L    G   +  +   K  +++FG+T+C  VCPTT+  +  +++Q+ P G  + 
Sbjct: 48  PNLEFNLTNDLGQKVTAENYKGKVVLLYFGYTHCPDVCPTTMQLMSNVVQQLGPEGKDVR 107

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             F++VDPKRD+  ++K +   FS   +G++G    +  + + +R+  +     K   + 
Sbjct: 108 ILFVSVDPKRDSNTILKAYTAAFSPNAVGLTGTIKQIDDLTRRYRVAFS---YGKPDAQG 164

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            Y VDH+  + +F  +G I  +    +   + +  + +LI 
Sbjct: 165 NYVVDHSAGVYIFGRSGRIHLLGSDTNPPAAFVHDLKQLIA 205


>gi|254560494|ref|YP_003067589.1| hypothetical protein METDI2037 [Methylobacterium extorquens DM4]
 gi|254267772|emb|CAX23619.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 215

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/186 (30%), Positives = 92/186 (49%), Gaps = 4/186 (2%)

Query: 13  LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           + ++ +                      L +  G      +L  KP +VFFGFT C  VC
Sbjct: 32  VGIVAATVAFLPRGDRPSALSVVGGPFRLESSKGGTVDSQALKGKPFLVFFGFTQCPNVC 91

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVM 132
           PTTL+ L  LL +    G  + AY+IT+DP+RDT  VM++++  F+DRI G+SG P  + 
Sbjct: 92  PTTLADLGTLLDEFGSQGGEIQAYYITLDPERDTQAVMREYMASFTDRITGLSGTPQQIE 151

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
           RVA+++R YV  V          Y ++HT  + + D  G   G +        A++++ +
Sbjct: 152 RVARDYRAYVKRVPL----PGGDYTLEHTLMVYMMDRDGGFAGPLDLNAGHALALKQLRK 207

Query: 193 LITYGN 198
           L++ G 
Sbjct: 208 LVSDGR 213


>gi|260773174|ref|ZP_05882090.1| cytochrome oxidase biogenesis protein Sco1/SenC/PrrC putative
           copper metallochaperone [Vibrio metschnikovii CIP 69.14]
 gi|260612313|gb|EEX37516.1| cytochrome oxidase biogenesis protein Sco1/SenC/PrrC putative
           copper metallochaperone [Vibrio metschnikovii CIP 69.14]
          Length = 208

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 83/201 (41%), Gaps = 9/201 (4%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNR----RFNSDVHLVAQDGTDFSLSSLYIKP 58
              +I G IL+A++ S+ YV +S+  +        +   +  L    G D +L     K 
Sbjct: 7   KYTLITGAILIAIVISL-YVKYSTVPIGERPVQPNQIGGNFSLHTALG-DINLDDYQGKV 64

Query: 59  SIVFFGFTNCSAVCPT-TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
            +++FG+ +C+ VCP                 G  +   FI+VDP RD    + +F Q F
Sbjct: 65  VVLYFGYLSCAEVCPASMGVMSAAFRMLPAEVGDEVQGLFISVDPSRDDLTSLHQFAQHF 124

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
             RI G +G   D+ ++   + +Y + V  + S +   Y VDH +   +    G  V  +
Sbjct: 125 DPRIKGATGTAEDINKITNQYGVYYDMVNMQNSAL--SYTVDHVSRFFVIAPNGQFVTSM 182

Query: 178 PYKDDSDSAIEKINRLITYGN 198
            Y         +I R +    
Sbjct: 183 SYSTTPTELAARIERTLQRYQ 203


>gi|163850809|ref|YP_001638852.1| electron transport protein SCO1/SenC [Methylobacterium extorquens
           PA1]
 gi|163662414|gb|ABY29781.1| electron transport protein SCO1/SenC [Methylobacterium extorquens
           PA1]
          Length = 215

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/186 (30%), Positives = 92/186 (49%), Gaps = 4/186 (2%)

Query: 13  LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           + ++ +                      L +  G      +L  KP +VFFGFT C  VC
Sbjct: 32  VGIVAATVAFLPRGDRPSALSVVGGPFRLESSKGGTVDSQALKGKPFLVFFGFTQCPNVC 91

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVM 132
           PTTL+ L  LL +    G  + AY+IT+DP+RDT  VM++++  F+DRI G+SG P  + 
Sbjct: 92  PTTLADLGTLLDEFGSQGGEIQAYYITLDPERDTQAVMREYMGSFTDRITGLSGTPQQIE 151

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
           RVA+++R YV  V          Y ++HT  + + D  G   G +        A++++ +
Sbjct: 152 RVARDYRAYVKRVPL----PGGDYTLEHTLMVYMMDRDGGFAGPLDLNAGHALALKQLRK 207

Query: 193 LITYGN 198
           L++ G 
Sbjct: 208 LVSDGR 213


>gi|239993292|ref|ZP_04713816.1| uncharacterized secreted protein of SCO1/SenC/PrrC family
           [Alteromonas macleodii ATCC 27126]
          Length = 214

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/212 (22%), Positives = 94/212 (44%), Gaps = 20/212 (9%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGN-------RRFNSDVHLVAQDGTDFSLSSLY 55
            +G++    L A +    Y++  +              R  S   L + +G  F  SSL 
Sbjct: 6   TVGLVAFLALCAGIVGALYIAPPNVESQPEYFQTYPEPRALSPFSLTSHEGEVFDNSSLE 65

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKF 113
            + S+VF G+T C  +CPTT++ L+ +  ++    +  L+   F++VDP RD+ E + ++
Sbjct: 66  GQWSLVFVGYTFCPDICPTTMAELNGIYPELKALNSVELIRIVFVSVDPNRDSIERLSEY 125

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           V  F++  I ++G+   +    +N  +        +S     Y VDH+ +++L D    +
Sbjct: 126 VSYFNEEFIAVTGEHKALFPFVRNLGMMYA---IAESTDNPNYLVDHSASVVLVDPEARV 182

Query: 174 VGVIPYK--------DDSDSAIEKINRLITYG 197
           +G    K         DS   +  +  +I+  
Sbjct: 183 IGRFKPKREPGKLSISDSQQILADMPIIISKQ 214


>gi|90075578|dbj|BAE87469.1| unnamed protein product [Macaca fascicularis]
          Length = 190

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/166 (25%), Positives = 80/166 (48%), Gaps = 5/166 (3%)

Query: 27  KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQV 86
           +   G         L    G   +      +  +++FGFT+C  VCP  L ++ +++ ++
Sbjct: 17  QRQIGKPLLGGPFSLTTHTGEHKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEI 76

Query: 87  DPTGTLLN--AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
           D   TL +    FI++DP+RDT E + K+V+ FS +++G++G   +V +VA+ +R+Y + 
Sbjct: 77  DSITTLPDLTPLFISIDPERDTKEAIAKYVKEFSPKLVGLTGTREEVDQVARAYRVYYSP 136

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
              ++   +E Y VDHT  + L    G  +               I
Sbjct: 137 GPKDE---DEDYIVDHTIIMYLVGPDGEFLDYFGQNKRKGEIAASI 179


>gi|58584801|ref|YP_198374.1| hypothetical protein Wbm0544 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419117|gb|AAW71132.1| Uncharacterized protein of SCO1/SenC/PrrC family, involved in
           biogenesis of respiratory system [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 204

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 91/208 (43%), Gaps = 20/208 (9%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNR-------RFNSDVHLVAQDGTDFSLSSL 54
           K + ++   ++   +  + Y  F+ K +           +   D  L+ QDG     +  
Sbjct: 3   KFVRLLSSILVALSVIFLGYCYFTKKGIFAPAVIHNAEVKIGGDFSLINQDGQVIRSNDF 62

Query: 55  YIKPSIVFFGFTNCSAVCPT-TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
             K  ++FFGF++C  +CP       + L K  + T   L  +FITVDP+ D+ E +K+F
Sbjct: 63  KDKYMMIFFGFSSCKKICPMNLGIISETLAKLDEKTSDKLQTFFITVDPECDSTEKLKEF 122

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
            Q+F  RI  ++G+   +  V  N+++Y + V  E+        ++H++ + L    G  
Sbjct: 123 QQQFDYRIQMLTGERKKIDEVIANYKVYTSKVGGEEG-------INHSSIIYLIGPGGKY 175

Query: 174 VGVIPYKDDSDS-----AIEKINRLITY 196
           V       +SD         +I + I  
Sbjct: 176 VTHFAADLNSDESQSDKIAAEIKKYINE 203


>gi|319645358|ref|ZP_07999591.1| hypothetical protein HMPREF1012_00624 [Bacillus sp. BT1B_CT2]
 gi|317393167|gb|EFV73961.1| hypothetical protein HMPREF1012_00624 [Bacillus sp. BT1B_CT2]
          Length = 196

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 74/200 (37%), Gaps = 14/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           M+ L  + G  L  +L        +SK  +             QDG   +L SL  +  +
Sbjct: 1   MEGLKNVFGIFLAGILTVFLSSCGTSKIDNPLNYDVQSFSFQNQDGKAVTLESLKGQVWV 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF--- 117
             F FTNC  +CP   S +  L KQ++           +VDP+ DTPE +KKF   +   
Sbjct: 61  ADFIFTNCETICPPMTSHMAELQKQMEEENLQARIVSFSVDPENDTPEKLKKFAANYPLS 120

Query: 118 SDRIIGISGDPIDVMRVA--KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                 ++G   + +     K+F+  V     E         V H ++  L D  G +V 
Sbjct: 121 FQNWDFLTGYSQEEIEKFALKSFKSIVKKPEDED-------QVIHQSSFYLVDQNGKVVK 173

Query: 176 VIPY--KDDSDSAIEKINRL 193
                     D  I  I  L
Sbjct: 174 DYDGARNTPYDEIIADIKTL 193


>gi|52080683|ref|YP_079474.1| hypothetical protein BL03304 [Bacillus licheniformis ATCC 14580]
 gi|52786056|ref|YP_091885.1| YpmQ [Bacillus licheniformis ATCC 14580]
 gi|52003894|gb|AAU23836.1| conserved hypothetical YpmQ [Bacillus licheniformis ATCC 14580]
 gi|52348558|gb|AAU41192.1| YpmQ [Bacillus licheniformis ATCC 14580]
          Length = 193

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 73/200 (36%), Gaps = 17/200 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    + G  L  +L        +SK  +             QDG   +L SL  +  +
Sbjct: 1   MKN---VFGIFLAGILTVFLSSCGTSKIDNPLNYDVQSFSFQNQDGKAVTLESLKGQVWV 57

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF--- 117
             F FTNC  +CP   S +  L KQ++           +VDP+ DTPE +KKF   +   
Sbjct: 58  ADFIFTNCETICPPMTSHMAELQKQMEEENLQARIVSFSVDPENDTPEKLKKFAANYPLS 117

Query: 118 SDRIIGISGDPIDVMRVA--KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                 ++G   + +     K+F+  V     E         V H ++  L D  G +V 
Sbjct: 118 FQNWDFLTGYSQEEIEKFALKSFKSIVKKPEDED-------QVIHQSSFYLVDQNGKVVK 170

Query: 176 VIPY--KDDSDSAIEKINRL 193
                     D  I  I  L
Sbjct: 171 DYDGARNTPYDEIIADIKTL 190


>gi|187924858|ref|YP_001896500.1| electron transporter SCO1/SenC [Burkholderia phytofirmans PsJN]
 gi|187716052|gb|ACD17276.1| electron transport protein SCO1/SenC [Burkholderia phytofirmans
           PsJN]
          Length = 204

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 52/198 (26%), Positives = 93/198 (46%), Gaps = 8/198 (4%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFN----SDVHLVAQDGTDFSLSSLYIK 57
           ++  +   T++L  L ++A  +  ++              D  L   DG   +  S   +
Sbjct: 6   RSARLFALTLMLGALTALAGCTHRTETWQLTNVSGHLPDLDFKLTGDDGKPVTGDSFKGR 65

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
            S+V+FG+T+C  VCP T+ RL ++L ++ P    +   FITVDP RDT + +  +V  F
Sbjct: 66  VSLVYFGYTHCPDVCPETMGRLMQVLGKLGPDAQKVRILFITVDPARDTAQALHDYVGAF 125

Query: 118 SD-RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
                 G++G    +  +AK +R+       EK      Y V H++A+ +FD+ G    +
Sbjct: 126 DSQHAEGLTGTDWQIESLAKRYRVAYQM---EKRDPSGNYEVTHSSAVYVFDSQGHARLL 182

Query: 177 IPYKDDSDSAIEKINRLI 194
               D  D+  + + R+I
Sbjct: 183 ATDHDTPDAIAQDLRRII 200


>gi|220934409|ref|YP_002513308.1| hypothetical protein Tgr7_1235 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995719|gb|ACL72321.1| Uncharacterized protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 226

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 81/174 (46%), Gaps = 4/174 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           ++  S       R   +  LV  +G  F+ +SL  + + +FFG+T C  +CP T++ L  
Sbjct: 48  LTLQSGTWLTEPRPLPEFELVDMNGEPFTRASLENQWTFLFFGYTYCPDICPMTMALLAS 107

Query: 82  LLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
             +++          A F++VDP+RDTPE +K +V  F    +G++G    +  + ++  
Sbjct: 108 TFEEIRRADPSVDPRAVFVSVDPERDTPEALKTYVPYFHQEFLGVTGPMEQLTPLTRSMG 167

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
           I      AE     + Y VDH+ +++L +  G    V+      ++      ++
Sbjct: 168 ILHRK--AEDPRDPDNYLVDHSASIILINPRGEFQAVLSAPHQVETLASDFLQI 219


>gi|254447330|ref|ZP_05060797.1| electron transport protein SCO1/SenC [gamma proteobacterium
           HTCC5015]
 gi|198263469|gb|EDY87747.1| electron transport protein SCO1/SenC [gamma proteobacterium
           HTCC5015]
          Length = 215

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/203 (22%), Positives = 90/203 (44%), Gaps = 13/203 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSK----FVDGNRRFNSDVH------LVAQDGTDFSL 51
           + L   +    +A+ G  A   +S +     ++    +  D        L A DG+ F+ 
Sbjct: 13  RRLITAILVAAVALGGGYALREYSERQAPLELENATLYPEDFRPFPTIRLTADDGSAFTN 72

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
           + L  + +++FFGFT+C  VCP TL+ +    +Q+      +   FI+VDP+RD  + + 
Sbjct: 73  AHLKGRWTLLFFGFTHCPDVCPNTLAVMADAYQQLGERQQDVQVVFISVDPERDRLDKLG 132

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            +VQ F    IG++     + ++A    I+     A++      Y VDH+ A+ + +  G
Sbjct: 133 SYVQYFDPDFIGVTSSEDKLQQLADGMDIFYKKQEADEH---GNYQVDHSGAVFVLNPDG 189

Query: 172 SIVGVIPYKDDSDSAIEKINRLI 194
               ++       +    +  ++
Sbjct: 190 RRHALMSAPHLPQAMASDLLTMM 212


>gi|159899946|ref|YP_001546193.1| electron transport protein SCO1/SenC [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159892985|gb|ABX06065.1| electron transport protein SCO1/SenC [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 201

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/184 (27%), Positives = 81/184 (44%), Gaps = 5/184 (2%)

Query: 16  LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT 75
            G+ +Y          N     D  L+ Q G DF L+    K  I+FFGFT C  VCP  
Sbjct: 22  CGTASYQIIRPID---NPTAAPDFTLIDQHGADFHLAEQRGKIVILFFGFTACPDVCPLA 78

Query: 76  LSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVA 135
           L    +  K++      +   F+TVDP+RD P  + ++V  F   I+G++G+   V  V 
Sbjct: 79  LGLSSQARKKLADDADKIQIAFVTVDPERDNPATIDRYVSLFDSTILGLNGETEVVEAVK 138

Query: 136 KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           K + ++        S ++  Y +DHT  L + D  G    +  +  D       +  ++ 
Sbjct: 139 KAYGVHAERRELPDSALQ--YTIDHTAGLYIIDQQGRWFAMANHDVDPTLLATDLETMLQ 196

Query: 196 YGNV 199
           Y +V
Sbjct: 197 YIDV 200


>gi|12851254|dbj|BAB28986.1| unnamed protein product [Mus musculus]
          Length = 229

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/186 (23%), Positives = 87/186 (46%), Gaps = 15/186 (8%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF----------NSDVHLVAQDGTDFSLS 52
              +++  +  A LG     + + K     ++             D  L+   G     +
Sbjct: 47  RTRLLITALFGAGLGWAWLAARAEKEQWRQQQRTEALRQAAVGQGDFSLLDHKGQPRCKA 106

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVM 110
               +  +++FGFT+C  +CP  L +L ++++  + +P   L+   FITVDP+RD    M
Sbjct: 107 DFRGQWVLMYFGFTHCPDICPDELEKLVQVVRKLEAEPDLPLVQPVFITVDPERDDVAAM 166

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            ++VQ F  R++G++G    V   ++N+R+Y +    ++   ++ Y VDH+ A+ L +  
Sbjct: 167 ARYVQEFHPRLLGLTGSTEQVAHASRNYRVYYSAGPKDE---DQDYIVDHSIAIYLLNPD 223

Query: 171 GSIVGV 176
           G     
Sbjct: 224 GLFTDY 229


>gi|84499301|ref|ZP_00997589.1| SCO1/2 family protein [Oceanicola batsensis HTCC2597]
 gi|84392445|gb|EAQ04656.1| SCO1/2 family protein [Oceanicola batsensis HTCC2597]
          Length = 203

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/189 (29%), Positives = 80/189 (42%), Gaps = 7/189 (3%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNS---DVHLVAQDGTDFSLSSLYIKPSIVFF 63
           I        +G        +    G R          L   +G      +L  + S+VFF
Sbjct: 14  IGAIATTLGIGWWRVDGPGADAPVGKRPLPLTEMSFRLTDHEGKSVGPQTLLGRASLVFF 73

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           GFT C  VCPTTLS +      +      LN   ITVDP+RDT E + ++V  F   I G
Sbjct: 74  GFTYCPEVCPTTLSDISIWFDGLGEDAADLNVVLITVDPERDTVEALAEYVGYFHPAIRG 133

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
            +G    V +   +FR+       E       Y ++HT+ + LFD  G  V +I Y +  
Sbjct: 134 WTGTTSQVDQATSDFRVRYEKRPME----GGGYTMNHTSGVFLFDADGRHVSIIDYHEPR 189

Query: 184 DSAIEKINR 192
           + A+ KI R
Sbjct: 190 EFALPKIRR 198


>gi|126172400|ref|YP_001048549.1| electron transport protein SCO1/SenC [Shewanella baltica OS155]
 gi|125995605|gb|ABN59680.1| electron transport protein SCO1/SenC [Shewanella baltica OS155]
          Length = 210

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 51/211 (24%), Positives = 88/211 (41%), Gaps = 21/211 (9%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSS 53
           M+   +++  +L+ + G  A      K ++             +   LV Q    F+ +S
Sbjct: 1   MQKRILVIAILLIGLGGLFAVKFNPPKPIELESGFLFPQAYELAPFELVDQHQQAFTNAS 60

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K S+ F GFT C  VCPTTL++L      ++     L   F++VDPKRDTP+ +  +
Sbjct: 61  LQGKWSLFFIGFTFCPDVCPTTLNKLAAAYPDLNKIA-PLQVVFLSVDPKRDTPDKLLTY 119

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           V  F+     ++G+   +  + ++  +    V     G  E Y VDH+   +L    G+ 
Sbjct: 120 VNFFNPEFKAVTGEQTQIFPLTRSLGLTYAMV-----GEGENYQVDHSAGYVLVSPQGTR 174

Query: 174 VGVIPY----KDDS----DSAIEKINRLITY 196
           V V               D  I    +++  
Sbjct: 175 VAVFKPTAALGKPPQVLNDEIISDFRKIVAQ 205


>gi|109157847|pdb|2GGT|A Chain A, Crystal Structure Of Human Sco1 Complexed With Nickel.
 gi|109157848|pdb|2GGT|B Chain B, Crystal Structure Of Human Sco1 Complexed With Nickel
          Length = 164

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 78/163 (47%), Gaps = 5/163 (3%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
                 L    G   +      +  +++FGFT+C  VCP  L ++ +++ ++D   TL +
Sbjct: 2   LGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPD 61

Query: 95  --AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGV 152
               FI++DP+RDT E +  +V+ FS +++G++G   +V +VA+ +R+Y +    ++   
Sbjct: 62  LTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDE--- 118

Query: 153 EEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           +E Y VDHT  + L    G  +               I   + 
Sbjct: 119 DEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMR 161


>gi|260576054|ref|ZP_05844048.1| electron transport protein SCO1/SenC [Rhodobacter sp. SW2]
 gi|259021753|gb|EEW25055.1| electron transport protein SCO1/SenC [Rhodobacter sp. SW2]
          Length = 197

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 41/161 (25%), Positives = 71/161 (44%), Gaps = 2/161 (1%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
               F     L   +G   + +    K  +VFFGFTNC  VCPTTL+ + +++  +    
Sbjct: 36  AEAAFRPTFSLPDAEGRLRTPADFAGKHLLVFFGFTNCPDVCPTTLAEVAQVMDDLGEQA 95

Query: 91  TLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKS 150
             +   FI+VDP+RD    +  F   F   I+G++GD       A++F+I+      + +
Sbjct: 96  ENVQPLFISVDPERDRRLGLAAFTAAFHPTILGLAGDTEQTRAAAESFKIFFER--QDDA 153

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKIN 191
              + Y + H+ AL L    G  +    Y   +   +  + 
Sbjct: 154 AAPDGYTMSHSPALYLIGPDGDWLRQFTYGTPATDILADLQ 194


>gi|239788417|dbj|BAH70892.1| ACYPI002226 [Acyrthosiphon pisum]
          Length = 280

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/162 (27%), Positives = 78/162 (48%), Gaps = 5/162 (3%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDP 88
           G  +      L+              K  +++FGF++C  +CP  L ++  ++   + + 
Sbjct: 89  GKAQIGGPFELLDGSNNIVKSEQFLGKWMLIYFGFSHCPDICPDELEKMALVVDNLEKED 148

Query: 89  TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
             T +   FITVDP RDTP+++ K+++ FS + IG+SG    + +V K +R+Y +     
Sbjct: 149 MNTGIQGIFITVDPDRDTPKIVDKYIKEFSSKFIGLSGTSEQIQQVCKRYRVYYS---PG 205

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
           K  V+  Y VDHT  + L +  G  +        +D  +E I
Sbjct: 206 KKDVDNDYIVDHTIIMYLVNPEGEFIDYFGQNKTADEIVEHI 247


>gi|254500006|ref|ZP_05112159.1| SCO1/SenC superfamily [Labrenzia alexandrii DFL-11]
 gi|222441473|gb|EEE48150.1| SCO1/SenC superfamily [Labrenzia alexandrii DFL-11]
          Length = 208

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 59/197 (29%), Positives = 87/197 (44%), Gaps = 7/197 (3%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSD---VHLVAQDGTDFSLSSLYIKPSIVFF 63
           ++    +  +G        +      R  +       L    G       L  + ++VFF
Sbjct: 14  VVAISFILFVGWWRVDGPGAPEPFIRRPLDLPAMEFRLTDHAGNAVGPEVLTGRATMVFF 73

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           GFT C  VCPTTLS +   L+ +      LN  FITVDP+RDT + M ++V  F   I G
Sbjct: 74  GFTFCPDVCPTTLSDISSWLEMMGDDSDALNVIFITVDPERDTVDAMAEYVGYFDANIRG 133

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
            SG    +   A  FR+    V  +     E Y ++HT ++ LF T G   G I Y +  
Sbjct: 134 WSGTNEQIAVAADMFRVTYEKVPTD----GEDYTMNHTASVFLFKTNGQFAGAIDYHETR 189

Query: 184 DSAIEKINRLITYGNVV 200
           ++A+ KI R +T    V
Sbjct: 190 ETAVPKIRRAMTEKEEV 206


>gi|88798509|ref|ZP_01114093.1| Sco1/SenC family protein [Reinekea sp. MED297]
 gi|88778609|gb|EAR09800.1| Sco1/SenC family protein [Reinekea sp. MED297]
          Length = 219

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 48/214 (22%), Positives = 88/214 (41%), Gaps = 22/214 (10%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGN---------------RRFNSDVHLVAQDG 46
           KA+ + +G ++  +   I  +      +  +                R   DV L    G
Sbjct: 11  KAVRLTVGILVAVIASIIVAIVLKFATMQPDLKAELERSHTLYFETPRLVPDVALTKHTG 70

Query: 47  TDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN--AYFITVDPKR 104
             FS+  L  +  ++ FG+T C  +CPT ++ + +   Q++  G       + +TVDP R
Sbjct: 71  EPFSVDQLKGQWDLINFGYTYCPDICPTNMADMKQARAQLEAQGLADQVRFWMVTVDPAR 130

Query: 105 DTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTAL 164
           DT E + ++V  +    IG++G   D+  +A             + G  E Y V H+   
Sbjct: 131 DTVEQLSQYVPYYHPEFIGLTGSLDDITTLATQLSAVFY-----QEGSGEGYTVAHSDNY 185

Query: 165 LLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
            L D  G  V ++         ++ ++ LIT G+
Sbjct: 186 ALIDPQGHFVALMRPPHKPSHIVDALSVLITQGS 219


>gi|85705752|ref|ZP_01036849.1| regulatory protein SenC [Roseovarius sp. 217]
 gi|85669742|gb|EAQ24606.1| regulatory protein SenC [Roseovarius sp. 217]
          Length = 209

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/210 (23%), Positives = 87/210 (41%), Gaps = 14/210 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGN-------------RRFNSDVHLVAQDGT 47
           M  L  +    +L     I YV    K  D                +      LV++ G 
Sbjct: 1   MTRLIAMSAAAVLIFGLGITYVMTMGKTGDDQFAQCRASNVAGGAAQIGGAFTLVSETGE 60

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTP 107
             +   +  +P++++FG+T C  VCP   +R    +  ++  G ++   FI++DPKRDTP
Sbjct: 61  TVTDKEVIDQPALIYFGYTFCPDVCPLDGARNAAAVDLLEERGAMVKPVFISIDPKRDTP 120

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           EVM ++ +    R++G++G    V   +K +R +       + G EE Y VDH+T   L 
Sbjct: 121 EVMAEYTEYLHPRMLGLTGSEEQVRAASKAYRTFFQAHKPTE-GEEEFYLVDHSTMTYLS 179

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
                 V         +   +++   I   
Sbjct: 180 LPQHGFVEFFRRDVTPEQMADRVQCFIDAS 209


>gi|160877422|ref|YP_001556738.1| electron transport protein SCO1/SenC [Shewanella baltica OS195]
 gi|160862944|gb|ABX51478.1| electron transport protein SCO1/SenC [Shewanella baltica OS195]
 gi|315269625|gb|ADT96478.1| electron transport protein SCO1/SenC [Shewanella baltica OS678]
          Length = 210

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 51/211 (24%), Positives = 88/211 (41%), Gaps = 21/211 (9%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSS 53
           M+   +++  +L+ + G  A      K ++             +   LV Q    F+ +S
Sbjct: 1   MQKRILVIAILLIGLGGLFAVKFNPPKPIELESGFLFPQAYELAPFELVDQHQQAFTNAS 60

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K S+ F GFT C  VCPTTL++L      ++     L   F++VDPKRDTP+ +  +
Sbjct: 61  LQGKWSLFFIGFTFCPDVCPTTLNKLAAAYPDLNKIA-PLQVVFLSVDPKRDTPDKLLTY 119

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           V  F+     ++G+   +  + ++  +    V     G  E Y VDH+   +L    G+ 
Sbjct: 120 VNFFNPEFKAVTGEQTQIFPLTRSLGLTYAMV-----GEGENYQVDHSAGYVLVSPQGTR 174

Query: 174 VGVIPY----KDDS----DSAIEKINRLITY 196
           V V               D  I    +++  
Sbjct: 175 VAVFKPTAALGKPPQVLNDEMISDFRKIVAQ 205


>gi|225677155|ref|ZP_03788154.1| SCO1/SenC family protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590822|gb|EEH12050.1| SCO1/SenC family protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 202

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 47/207 (22%), Positives = 90/207 (43%), Gaps = 20/207 (9%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFV-------DGNRRFNSDVHLVAQDGTDFSLSSL 54
           + + ++   +    +  + Y  F+ K +       +   +   D  L+ QDG     S  
Sbjct: 3   RFVRLLSNVLAALAVVFLGYCYFTKKGIFAPVAIHNAEVKIGGDFSLINQDGQILRSSDF 62

Query: 55  YIKPSIVFFGFTNCSAVCPT-TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
             K  ++FFGF++C   CP       + L K  + T   L  +FITVDP+ D+ E +K+F
Sbjct: 63  KDKYMMIFFGFSSCKRACPMNLGIISETLAKLDEKTNNKLQTFFITVDPEHDSTERLKEF 122

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
            Q+F  RI  ++G+   +  V   +++Y + V  E+        ++H++ + L    G  
Sbjct: 123 QQQFDHRIQMLTGEREKIDEVVAKYKVYASKVGGEE-------EINHSSIIYLIGPGGKY 175

Query: 174 VGVIPYKDDSDS-----AIEKINRLIT 195
           V       +SD       + +I + + 
Sbjct: 176 VTHFAADLNSDESQSDKILAEIRKYVN 202


>gi|153002687|ref|YP_001368368.1| electron transport protein SCO1/SenC [Shewanella baltica OS185]
 gi|151367305|gb|ABS10305.1| electron transport protein SCO1/SenC [Shewanella baltica OS185]
          Length = 210

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 51/211 (24%), Positives = 88/211 (41%), Gaps = 21/211 (9%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSS 53
           M+   +++  +L+ + G  A      K ++             +   LV Q    F+ +S
Sbjct: 1   MQKRILVIAILLIGLGGLFAVKFNPPKPIELESGFLFPQAYELAPFELVDQHKQAFTNAS 60

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K S+ F GFT C  VCPTTL++L      ++     L   F++VDPKRDTP+ +  +
Sbjct: 61  LQGKWSLFFIGFTFCPDVCPTTLNKLAAAYPDLNKIA-PLQVVFLSVDPKRDTPDKLLTY 119

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           V  F+     ++G+   +  + ++  +    V     G  E Y VDH+   +L    G+ 
Sbjct: 120 VNFFNPEFKAVTGEQTQIFPLTRSLGLTYAMV-----GEGENYQVDHSAGYVLVSPQGTR 174

Query: 174 VGVIPY----KDDS----DSAIEKINRLITY 196
           V V               D  I    +++  
Sbjct: 175 VAVFKPTAALGKPPQVLNDEMISDFRKIVAQ 205


>gi|154339455|ref|XP_001562419.1| electon transport protein SCO1/SCO2 [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134063002|emb|CAM39451.1| putative electon transport protein SCO1/SCO2 [Leishmania
           braziliensis MHOM/BR/75/M2904]
          Length = 286

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 75/157 (47%), Gaps = 4/157 (2%)

Query: 23  SFSSKFVDGNRRFNSDVHLVA-QDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +  S              LV  + G   + + L  K   ++FGFTNC  VCP  ++++ R
Sbjct: 48  AVKSFDSPEGPSIGGPFSLVDVKTGKRITDADLKGKWLYIYFGFTNCPDVCPEEMAKMAR 107

Query: 82  LLKQVDPT--GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
           ++  +D           FI++D KRDTP  +++++  FS RI+G+ G   +V   A+ +R
Sbjct: 108 VINHLDKKVGRDYWQPIFISLDSKRDTPAKIREYLSDFSPRIMGLVGTQAEVEEAARQYR 167

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           +Y   +  E+   E+ Y VDH+  + L D  G     
Sbjct: 168 VYFA-IPDEEVMSEDDYLVDHSIIMYLIDPEGRFSDY 203


>gi|84686770|ref|ZP_01014657.1| SCO1/2 family protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84665201|gb|EAQ11680.1| SCO1/2 family protein [Rhodobacterales bacterium HTCC2654]
          Length = 162

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 85/159 (53%), Gaps = 4/159 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
           +  L   +  +    +L  +P++VFFGFT C  VCPTTLS +   L+++    + +N  F
Sbjct: 2   EFRLTDHEENEVGPGNLIGRPTMVFFGFTYCPDVCPTTLSDISGWLEELGDEASEMNVVF 61

Query: 98  ITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYF 157
           ITVDP+RDT E M ++V  F   I G +G    + R A+ FR     V  E       Y 
Sbjct: 62  ITVDPERDTVEAMAEYVGYFHPVIRGWTGPEDQIARAAEGFRASFERVPTE----GGGYT 117

Query: 158 VDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           ++HT ++ LFD  G +V +I Y +  + A+ KI R +T 
Sbjct: 118 MNHTASVFLFDAEGELVTMIDYHEQREFAVPKIQRALTE 156


>gi|88705361|ref|ZP_01103072.1| Electron transport protein SCO1/SenC [Congregibacter litoralis
           KT71]
 gi|88700451|gb|EAQ97559.1| Electron transport protein SCO1/SenC [Congregibacter litoralis
           KT71]
          Length = 220

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 52/196 (26%), Positives = 84/196 (42%), Gaps = 16/196 (8%)

Query: 3   ALGIILGTILLAVLGSI-----------AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSL 51
            +  +L  +L+ V G I             +  +  ++    R   D  L    G  F+ 
Sbjct: 16  TIAAVLVFMLIVVAGFIHRIGQPRLMSDGELQANGLYLMDPPRDFGDFALTDHRGEPFTP 75

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVM 110
           +S   + ++VFFGFT+C  VCPTT++ LD+ + Q             I+VDP RDT E +
Sbjct: 76  ASFEGQWTLVFFGFTHCPDVCPTTMAFLDQFVGQLEGTEAKDTEVVMISVDPARDTVEKL 135

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
             +V  F++   G++G+ +D+ R A         V     G  E Y VDH+  ++L +  
Sbjct: 136 ATYVPYFNEDFTGVTGEFLDLFRFATALNTPFRKVP----GQGEDYQVDHSANVVLINPR 191

Query: 171 GSIVGVIPYKDDSDSA 186
           G   G      D    
Sbjct: 192 GHYHGFFKAPLDLAKM 207


>gi|149374354|ref|ZP_01892128.1| hypothetical protein MDG893_09916 [Marinobacter algicola DG893]
 gi|149361057|gb|EDM49507.1| hypothetical protein MDG893_09916 [Marinobacter algicola DG893]
          Length = 206

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/196 (25%), Positives = 93/196 (47%), Gaps = 6/196 (3%)

Query: 5   GIILGTILLAVLGSIA-YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
            I    + + + G +     +  K + G      +  L+   G   S +    +  ++FF
Sbjct: 15  AISTVVMAILLTGCLGNEEDWHGKNISGLMPEL-EFDLINSQGDPVSSNDYSGRVRMLFF 73

Query: 64  GFTNCSAVCPTTLSRLDRLLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           GFT+C  VCPTTL +L+++           +   F++VDP+RD PE + ++V  F D I+
Sbjct: 74  GFTSCPDVCPTTLQKLNQVTSGLSPELQEEVLTLFVSVDPQRDNPERLAEYVDFFGDDIV 133

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
           G++G+ + +  +AK +R        E+ G +  Y V H++A+ +FD  G+   +I     
Sbjct: 134 GLTGEELQLRELAKRYRTTFG---YEEPGPDGNYAVSHSSAIYVFDREGNPRLLIRPDLS 190

Query: 183 SDSAIEKINRLITYGN 198
            +     +  LI  G+
Sbjct: 191 GEEIRHDLVALIQEGS 206


>gi|329897108|ref|ZP_08271853.1| Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative
           copper metallochaperone [gamma proteobacterium IMCC3088]
 gi|328921432|gb|EGG28821.1| Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative
           copper metallochaperone [gamma proteobacterium IMCC3088]
          Length = 221

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/207 (23%), Positives = 90/207 (43%), Gaps = 17/207 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNS-----------DVHLVAQDGTDFS 50
           + + ++L  I+L V+G I+ +   +       + N            D  LV   G  F+
Sbjct: 12  RTVIVVLAFIVLIVVGFISRIFQPTILSPAEMQANGTMVFQQPRQVTDFSLVDHTGAPFT 71

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPE 108
             S+  + ++VFFGFT C  +CPTT+  L+  ++  +            +TVDP RD+ E
Sbjct: 72  RESVTGQWTLVFFGFTFCPDICPTTMVELNEFMQLIEGTEVEDQFQVVMVTVDPGRDSVE 131

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +  +V  F+   +G++G+ +D+ R A         V     G  E Y +DH+  ++L +
Sbjct: 132 QLASYVPFFNPDFLGVTGEFLDIHRFATELNTPFRRVP----GGGENYQMDHSANIVLIN 187

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLIT 195
             G   G +    D       +  ++ 
Sbjct: 188 PRGDYHGFVKAPLDLPKMKLTLRSMVA 214


>gi|217975264|ref|YP_002360015.1| electron transport protein SCO1/SenC [Shewanella baltica OS223]
 gi|217500399|gb|ACK48592.1| electron transport protein SCO1/SenC [Shewanella baltica OS223]
          Length = 210

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 52/211 (24%), Positives = 89/211 (42%), Gaps = 21/211 (9%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSS 53
           M+   +++  +L+ + G  A      K ++             +   LV Q    F+ +S
Sbjct: 1   MQKRILVIAILLIGLGGLFAVKFNPPKPIELESGFLFPQAYELAPFELVDQHQQAFTNAS 60

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K S+ F GFT C  VCPTTL++L      ++     L   F++VDPKRDTP+ +  +
Sbjct: 61  LQGKWSLFFIGFTFCPDVCPTTLNKLAAAYPDLNKIA-PLQVVFLSVDPKRDTPDKLLTY 119

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           V  F+     ++G+   +  + ++  +    V     G  E Y VDH+   +L    G+ 
Sbjct: 120 VNFFNPEFKAVTGEQTQIFPLTRSLGLTYAMV-----GEGENYQVDHSAGYVLVSPQGTR 174

Query: 174 VGVIPY----KDDS----DSAIEKINRLITY 196
           V V               D  I    +++T 
Sbjct: 175 VAVFKPTAALGKPPQVLNDEMISDFRKIVTQ 205


>gi|157963818|ref|YP_001503852.1| electron transport protein SCO1/SenC [Shewanella pealeana ATCC
           700345]
 gi|157848818|gb|ABV89317.1| electron transport protein SCO1/SenC [Shewanella pealeana ATCC
           700345]
          Length = 209

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/214 (23%), Positives = 87/214 (40%), Gaps = 22/214 (10%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFV-------DGNRRFNSDVHLVAQDGTDFSLSS 53
           MK   II   +++A     +      K +              +   L  Q G  FS + 
Sbjct: 1   MKLTWIIAAVLMVAAGVYASIQLAQPKNLALQTSFEYPAPLPLAPFSLTDQRGNSFSNTD 60

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K S+ F G+T+C  VCPTT+ +L     ++      L   F++VDP+RD+ E ++ +
Sbjct: 61  LLGKWSLFFIGYTSCPDVCPTTMGKLSSAYPKLTDKA-ELQVIFLSVDPQRDSTETLENY 119

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++ F+   I ++G+   +  V ++       V     G    Y VDH+ +  L    G  
Sbjct: 120 IKFFNPEFIAVTGEHSQLFPVTRSLGFVYAMV-----GNGPDYQVDHSASFALVSPQGEK 174

Query: 174 VGVIPYKDDS---------DSAIEKINRLITYGN 198
           + +I  K  S            I  +N +I   +
Sbjct: 175 IAIIKPKSSSPGKLPQIKNSDLIHDVNAIIDKYS 208


>gi|294654394|ref|XP_002769958.1| DEHA2A02442p [Debaryomyces hansenii CBS767]
 gi|199428847|emb|CAR65351.1| DEHA2A02442p [Debaryomyces hansenii]
          Length = 308

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 54/173 (31%), Positives = 88/173 (50%), Gaps = 6/173 (3%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI---KPSIVFFGFTNCSAVCPTTLSRLDRL 82
           +K   G      + +L+  +   F+  +L     K SI++FGFT+C  VCP  L +L  +
Sbjct: 116 AKRGYGKPLIGGNFNLIDTEENAFTQENLKNDQKKFSIIYFGFTHCPDVCPDELDKLGVM 175

Query: 83  LKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
           L +  +     L   FIT DP RD+PE++K+++  F   IIG++G   +V    K +R+Y
Sbjct: 176 LDELKEKDNIELQPIFITCDPARDSPEIIKEYLSDFHPSIIGLTGPYENVKNACKKYRVY 235

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            +     K    + Y VDH+    L D+ G+ V VI  + +++   EKI   I
Sbjct: 236 FSTPPDVK--PGQDYLVDHSIFFYLMDSEGNFVDVIGREAEAEEGAEKIRTHI 286


>gi|119471374|ref|ZP_01613846.1| putative SCO1/SenC family protein (copper-binding protein)
           [Alteromonadales bacterium TW-7]
 gi|119445650|gb|EAW26934.1| putative SCO1/SenC family protein (copper-binding protein)
           [Alteromonadales bacterium TW-7]
          Length = 203

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 46/184 (25%), Positives = 89/184 (48%), Gaps = 8/184 (4%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS---SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK L +++  +L   L + +  +     +  V  N +  SD  L  Q G   + +    +
Sbjct: 1   MKRLWLLVIVVLSLFLSACSSENDPQNLNALVYENAKSLSDFTLKNQHGEPVTKAQFKGQ 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
            ++VF G+T+C  +CP TL++L+ + K++      L  +F++VDP RDT E  K+++  F
Sbjct: 61  WNLVFLGYTSCPDICPLTLAKLNAVYKELKA-DYPLQIWFVSVDPNRDTAEKRKQYIDYF 119

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           +   + +SG+  D+  V +   +        K      Y VDH+ ++ L D  G++  + 
Sbjct: 120 NPNFLAVSGEHKDLFPVVRELGLIYAISDTTK----ADYAVDHSASVALVDDTGALRAIF 175

Query: 178 PYKD 181
             + 
Sbjct: 176 KPEF 179


>gi|166712637|ref|ZP_02243844.1| putative SCO1/SenC family protein [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 216

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 71/185 (38%), Gaps = 3/185 (1%)

Query: 12  LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAV 71
            L    S  +    +       R      L   DGT      L    ++VF GFT C  V
Sbjct: 26  FLGGAPSSPWPPTKTITFYPQPRPLPQFSLRQSDGTQLVSGELNGHWTLVFLGFTFCPDV 85

Query: 72  CPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPI 129
           CPTTL+ L    +Q +  P G      F++VDP+RD P  + ++   F    +  + D  
Sbjct: 86  CPTTLTDLAVAQQQWETIPDGLRPRVLFVSVDPQRDPPARLGEYAHAFHKDTLAATADVP 145

Query: 130 DVMRVAKNFRIYVNNVLAEKS-GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIE 188
            + R A         V  +        Y +DH+  + + D  G + G+I    D  +   
Sbjct: 146 ALERFATALGFVFKKVPGKGYAQNPNDYSMDHSAGIAVLDPQGRLAGLIRPPLDPKAIAT 205

Query: 189 KINRL 193
            + +L
Sbjct: 206 DLQQL 210


>gi|221641012|ref|YP_002527274.1| electron transport protein SCO1/SenC [Rhodobacter sphaeroides
           KD131]
 gi|221161793|gb|ACM02773.1| Electron transport protein SCO1/SenC precursor [Rhodobacter
           sphaeroides KD131]
          Length = 246

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 4/174 (2%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ 85
                          LV Q+G   +   +  KPS+V+FG+T C  VCP  ++R  + +  
Sbjct: 52  GANQVAGGAIGGPFTLVDQEGRTVTDREVLAKPSLVYFGYTFCPDVCPFDMARNAQAVDI 111

Query: 86  VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
           +   G  +   FI++DPKRDTPE +K F +      I ++G    V   ++ ++ +    
Sbjct: 112 LTEWGIEVTPVFISIDPKRDTPEQLKFFAEAIHPDTIALTGTEAQVKAASQAYKTFYRV- 170

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNV 199
              +   ++ Y +DH+T           V     +D  +   E+I+      +V
Sbjct: 171 ---QESDDDYYLIDHSTFTYFMLPGTGFVDFFKREDTPEQIAERISCFANDSHV 221


>gi|94496656|ref|ZP_01303232.1| Electron transport protein [Sphingomonas sp. SKA58]
 gi|94424016|gb|EAT09041.1| Electron transport protein [Sphingomonas sp. SKA58]
          Length = 217

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 14/194 (7%)

Query: 1   MKALGIILGTILLAVLGSI-------AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
           M    +     +LA+L +        A  + +++      R      L  QDG       
Sbjct: 6   MNKAILTCALPMLALLSACDMGGGNAASNNGAAQGDLAGARIGGPFTLTDQDGKQVRWDD 65

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTL----LNAYFITVDPKRDTPEV 109
              +  +V+FG+T C  +CP  L R+ +   Q +         +    I+VDP RDTP V
Sbjct: 66  FKGQYRLVYFGYTYCPDICPVDLQRIMQGFAQFEKASPQLAAKVQPMLISVDPARDTPAV 125

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           +K +V  F  R+IG++G P  + +VAK+F +       E+S     Y V H+    LF  
Sbjct: 126 LKTYVAAFHPRLIGLTGTPDQIAKVAKDFAVIYGK---EESAGASDYLVSHSRTPYLFGP 182

Query: 170 AGSIVGVIPYKDDS 183
            G  + ++P  D +
Sbjct: 183 DGQPIALVPVDDPA 196


>gi|218529630|ref|YP_002420446.1| electron transporter SCO1/SenC [Methylobacterium chloromethanicum
           CM4]
 gi|218521933|gb|ACK82518.1| electron transport protein SCO1/SenC [Methylobacterium
           chloromethanicum CM4]
          Length = 215

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 92/186 (49%), Gaps = 4/186 (2%)

Query: 13  LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           + ++ +                      L +  G      +L  KP +VFFGFT C  VC
Sbjct: 32  VGIVAATVAFLPRGDKPSALSVVGGPFRLESSKGGTVDSQALKGKPFLVFFGFTQCPNVC 91

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVM 132
           PTTL+ L  LL +    G  + AY+IT+DP+RDT  VM++++  F+DRI G+SG P  + 
Sbjct: 92  PTTLADLGTLLDEFGSQGGEIQAYYITLDPERDTQAVMREYMASFTDRITGLSGTPQQIE 151

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
           RVA+++R Y+  V          Y ++HT  + + D  G   G +        A++++ +
Sbjct: 152 RVARDYRAYLKRVPL----PGGDYTLEHTLMVYMMDRDGGFAGPLDLNAGHALALKQLRK 207

Query: 193 LITYGN 198
           L++ G 
Sbjct: 208 LVSDGR 213


>gi|156094840|ref|XP_001613456.1| cloroquine resistance associated protein Cg3 [Plasmodium vivax
           SaI-1]
 gi|148802330|gb|EDL43729.1| cloroquine resistance associated protein Cg3, putative [Plasmodium
           vivax]
          Length = 253

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 80/201 (39%), Gaps = 28/201 (13%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +  +     G      D  L+  DG   +      K  +++FGFT C  +CP  L +   
Sbjct: 43  IGLTQVEYIGKPLIGGDFTLINHDGKVVTNEDFKKKFCLIYFGFTYCPDICPQELEKQTI 102

Query: 82  LLKQV-DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
           +++++    G ++   FI+VDP RDT   +K +   FSDR++G++G    + RVAK FR+
Sbjct: 103 VIERIVKKYGDVITPVFISVDPNRDTLAQVKHYCSSFSDRLVGLTGTKEQIRRVAKLFRV 162

Query: 141 YVNNVL---------------------------AEKSGVEEKYFVDHTTALLLFDTAGSI 173
           Y N  +                                    Y +DH+    L D  G  
Sbjct: 163 YYNEHVVGEEQTEEQTEKQKERQTDTQTEAQSGDPPRAPSYNYLIDHSIIHYLLDADGKF 222

Query: 174 VGVIPYKDDSDSAIEKINRLI 194
           V        +   +E+I+  +
Sbjct: 223 VDFFGKNCTTSEMVERISHYV 243


>gi|304412260|ref|ZP_07393868.1| electron transport protein SCO1/SenC [Shewanella baltica OS183]
 gi|307306044|ref|ZP_07585789.1| electron transport protein SCO1/SenC [Shewanella baltica BA175]
 gi|304349295|gb|EFM13705.1| electron transport protein SCO1/SenC [Shewanella baltica OS183]
 gi|306910917|gb|EFN41344.1| electron transport protein SCO1/SenC [Shewanella baltica BA175]
          Length = 210

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 50/211 (23%), Positives = 88/211 (41%), Gaps = 21/211 (9%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSS 53
           M+   +++  +L+ + G  A      K ++             +   LV Q    F+ +S
Sbjct: 1   MQKRILVIAILLIGLGGLFAVKFNPPKPIELESGFLFPQAYELAPFELVDQHQQAFTNAS 60

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K ++ F GFT C  VCPTTL++L      ++     L   F++VDPKRDTP+ +  +
Sbjct: 61  LQGKWNLFFIGFTFCPDVCPTTLNKLAAAYPDLNKIA-PLQVVFLSVDPKRDTPDKLLTY 119

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           V  F+     ++G+   +  + ++  +    V     G  E Y VDH+   +L    G+ 
Sbjct: 120 VNFFNPEFKAVTGEQTQIFPLTRSLGLTYAMV-----GEGENYQVDHSAGYVLVSPQGTR 174

Query: 174 VGVIPY----KDDS----DSAIEKINRLITY 196
           V V               D  I    +++  
Sbjct: 175 VAVFKPTAALGKPPQVLNDEMISDFRKIVAQ 205


>gi|77462059|ref|YP_351563.1| PrrC [Rhodobacter sphaeroides 2.4.1]
 gi|126460948|ref|YP_001042062.1| electron transport protein SCO1/SenC [Rhodobacter sphaeroides ATCC
           17029]
 gi|733128|gb|AAA86722.1| membrane-anchored regulatory protein [Rhodobacter sphaeroides]
 gi|77386477|gb|ABA77662.1| PrrC [Rhodobacter sphaeroides 2.4.1]
 gi|126102612|gb|ABN75290.1| electron transport protein SCO1/SenC [Rhodobacter sphaeroides ATCC
           17029]
          Length = 231

 Score =  108 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 4/174 (2%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ 85
                          LV Q+G   +   +  KPS+V+FG+T C  VCP  ++R  + +  
Sbjct: 37  GANQVAGGAIGGPFTLVDQEGRTVTDREVLAKPSLVYFGYTFCPDVCPFDMARNAQAVDI 96

Query: 86  VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
           +   G  +   FI++DPKRDTPE +K F +      I ++G    V   ++ ++ +    
Sbjct: 97  LTEWGIEVTPVFISIDPKRDTPEQLKFFAEAIHPDTIALTGTEAQVKAASQAYKTFYRV- 155

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGNV 199
              +   ++ Y +DH+T           V     +D  +   E+I+      +V
Sbjct: 156 ---QESDDDYYLIDHSTFTYFMLPGTGFVDFFKREDTPEQIAERISCFANDSHV 206


>gi|171058678|ref|YP_001791027.1| electron transport protein SCO1/SenC [Leptothrix cholodnii SP-6]
 gi|170776123|gb|ACB34262.1| electron transport protein SCO1/SenC [Leptothrix cholodnii SP-6]
          Length = 197

 Score =  108 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 51/178 (28%), Positives = 84/178 (47%), Gaps = 6/178 (3%)

Query: 20  AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRL 79
           A   F +  + G+  +     L A DG + SL+    +  +VFFGFT C  VCPT LSR 
Sbjct: 25  APPPFKNLDITGS-DYARSFDLQAPDGRNRSLADFKGRLVMVFFGFTQCPDVCPTALSRA 83

Query: 80  DRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
             + + +      L   FITVDP+RDT E++ +++  F    + + GD +    VA+ F+
Sbjct: 84  VAVRQMLGADAERLQVIFITVDPERDTAELLSQYMAAFDPSFLALRGDLVRTTEVAREFK 143

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
           ++ N V          Y +DHT    +FDT G +   + +   ++     +  L+   
Sbjct: 144 VFFNKVP-----TGSSYTMDHTALSYVFDTQGRLRLAVRHSQGAEDVAHDLKLLLHES 196


>gi|170695439|ref|ZP_02886584.1| electron transport protein SCO1/SenC [Burkholderia graminis C4D1M]
 gi|170139630|gb|EDT07813.1| electron transport protein SCO1/SenC [Burkholderia graminis C4D1M]
          Length = 196

 Score =  108 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 50/197 (25%), Positives = 87/197 (44%), Gaps = 4/197 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           M          ++A+ G                  + D  L   DG   + +S   + S+
Sbjct: 1   MSTAKACALVTMIALAGCTNRAEPWHLTNVSGHLPDLDFSLTGDDGRPVTGASFKGRTSL 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS-D 119
           V+FG+T+C  VCP T+ RL ++L ++ P    +   F+TVDP RDTP+ +  +V  F   
Sbjct: 61  VYFGYTHCPDVCPETMGRLMQVLDKLGPDAQKVRILFVTVDPARDTPQALHDYVGAFDSK 120

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
              G++G    +  +AK +R+       EK      Y V H++A+ +FD  G    +   
Sbjct: 121 HAEGLTGTDRQIESLAKRYRVAYQM---EKRDPNGSYEVTHSSAVYVFDAEGRARLLATD 177

Query: 180 KDDSDSAIEKINRLITY 196
            D  D+  + + R++  
Sbjct: 178 NDTPDAIAQDLRRIVDQ 194


>gi|328855879|gb|EGG05003.1| hypothetical protein MELLADRAFT_37143 [Melampsora larici-populina
           98AG31]
          Length = 213

 Score =  108 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 47/203 (23%), Positives = 87/203 (42%), Gaps = 17/203 (8%)

Query: 9   GTILLAVLGSIAYVSF------------SSKFVDGNRRFNSDVHLVAQ-DGTDFSLSSLY 55
              +L  LG + Y               + +   G  +      L+   +G  F+   L 
Sbjct: 1   SLFILTGLGLLIYFKNEKIKVEERKAEETKQKSIGKVKVGGPFELLNVGNGQRFNQDDLL 60

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ--VDPTGTLLNAYFITVDPKRDTPEVMKKF 113
            K S+++FGFTNC  +CP  L ++  ++ +   D     +   F++VDP RDTPE + ++
Sbjct: 61  GKFSLIYFGFTNCPDICPEELDKMCDVVNRINQDQFKVPIQPIFVSVDPNRDTPEAIIQY 120

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++ F   +IG++G    + ++ K +R+Y +          + Y VDH+    L    G+ 
Sbjct: 121 LKDFHSSMIGLTGSYESIKKMCKVYRVYFSTPP--NLKPTDDYLVDHSIFFYLMAPNGNF 178

Query: 174 VGVIPYKDDSDSAIEKINRLITY 196
           V         D    K+N+ +  
Sbjct: 179 VDAFGKIFSKDEVYTKVNKYMNE 201


>gi|296532651|ref|ZP_06895350.1| electron transport protein SCO1/SenC [Roseomonas cervicalis ATCC
           49957]
 gi|296267022|gb|EFH12948.1| electron transport protein SCO1/SenC [Roseomonas cervicalis ATCC
           49957]
          Length = 209

 Score =  108 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 49/201 (24%), Positives = 88/201 (43%), Gaps = 13/201 (6%)

Query: 4   LGIILGTILLAVLGSIA--YVSFSSKFVDGN------RRFNSDVHLVAQDGTDFSLSSLY 55
           + + +G  +   LG +A  ++  + +   G+          S   L    G   + ++  
Sbjct: 8   ITLAVGMPISGGLGWLASEWMLPTPRPAPGSRSSGLGAPMGSPFALTEHTGRQVTDATYA 67

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
            K  +VFFGFT+C  +CPT L  +   +          +   FI+VD  RDTPE++  +V
Sbjct: 68  GKVRLVFFGFTHCPDICPTGLGYMADAMDGLTPAEAARVQPLFISVDAGRDTPELLAGYV 127

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  R++G+SG   +V + A+ F      V        + Y +DH+ ++ L    G + 
Sbjct: 128 AAFHPRLVGLSGTEPEVAQAARAFGTLYAKVPTG----GDSYVMDHSASIYLIGADGRLQ 183

Query: 175 GVIPYKDDSDSAIEKINRLIT 195
           G +   +   +AI KI   + 
Sbjct: 184 GFLDTHEPPATAIGKIRLALA 204


>gi|301108041|ref|XP_002903102.1| SCO1 family protein [Phytophthora infestans T30-4]
 gi|262097474|gb|EEY55526.1| SCO1 family protein [Phytophthora infestans T30-4]
          Length = 228

 Score =  108 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 48/198 (24%), Positives = 78/198 (39%), Gaps = 15/198 (7%)

Query: 9   GTILLAVLG-SIAYVSFSSKFV-----------DGNRRFNSDVHLVAQD-GTDFSLSSLY 55
           G  L  ++G    Y  +S K              G         LV  D     + +S  
Sbjct: 28  GLALAGIVGSGAVYYYYSEKDRLQTQSTSKVTSVGKPLLGGPWTLVDCDTRRAVTDASFR 87

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTPEVMKKFV 114
            K S+++FGFT+C  +CP  L R+  +L  ++          F+TVDPKRDT   M+ + 
Sbjct: 88  GKYSLLYFGFTHCPDICPNELVRIGDVLDTLEAENCPEVVPLFVTVDPKRDTIAQMQAYK 147

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  +   ++G    V  + K +R+Y +     +   ++ Y VDH+  + L    G  +
Sbjct: 148 ADFHPKFKMLTGTRDQVADITKAYRVYFSKADENEDDDDD-YLVDHSIVMYLVGPDGEFL 206

Query: 175 GVIPYKDDSDSAIEKINR 192
                    D    KI  
Sbjct: 207 DFFTQAARVDDIAAKIKT 224


>gi|325921319|ref|ZP_08183178.1| hypothetical protein SCO1/SenC/PrrC [Xanthomonas gardneri ATCC
           19865]
 gi|325548204|gb|EGD19199.1| hypothetical protein SCO1/SenC/PrrC [Xanthomonas gardneri ATCC
           19865]
          Length = 216

 Score =  108 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/185 (24%), Positives = 70/185 (37%), Gaps = 3/185 (1%)

Query: 12  LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAV 71
            L    S  +    +       R      L   DGT      L    ++VF GFT C  V
Sbjct: 26  FLGAAPSSPWPPTKTITFYPQPRTLPQFSLRQSDGTQLVPGELKGHWTLVFLGFTFCPDV 85

Query: 72  CPTTLSRLDRLLKQV--DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPI 129
           CPTTL+ L    +Q    P G      F++VDP+RD P  + ++   F    +  + D  
Sbjct: 86  CPTTLTDLAVAQQQWASIPDGLRPRVLFVSVDPQRDPPARLGEYAHAFHKDTLAATADVP 145

Query: 130 DVMRVAKNFRIYVNNVLAEKS-GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIE 188
            + R A         V  +        Y +DH+  + + D  G + G+I    D  +   
Sbjct: 146 ALERFATALGFVFQKVPGKGFAQNPNDYSMDHSAGIAVLDPQGRLAGLIRPPLDPKAIAA 205

Query: 189 KINRL 193
            + +L
Sbjct: 206 DLQQL 210


>gi|293604958|ref|ZP_06687355.1| SCO1/SenC family protein [Achromobacter piechaudii ATCC 43553]
 gi|292816786|gb|EFF75870.1| SCO1/SenC family protein [Achromobacter piechaudii ATCC 43553]
          Length = 204

 Score =  108 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 91/201 (45%), Gaps = 8/201 (3%)

Query: 1   MKAL-------GIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
           M+ L       G++L   +         V ++   V G+        L    G   S   
Sbjct: 1   MRHLLTGRAWRGLLLALCVFLAACGDRNVDWTLYNVKGHLPDLK-FSLPGAGGKTISSDD 59

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K  ++FFG+ +C  +CPTT+++L  +L+ +      +   F++VDP RDTP++++ +
Sbjct: 60  LKGKTVLLFFGYASCPDICPTTMAQLTAVLQNLGDKAKNVRIVFVSVDPHRDTPDILQAY 119

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           V  F++  IG++GD   V  +A+ +R+             + Y V H+  + +FD  G  
Sbjct: 120 VNAFNNNAIGVTGDEKQVADLARRYRVAYQIEKPRAGDDADMYEVTHSRGVYIFDKDGRA 179

Query: 174 VGVIPYKDDSDSAIEKINRLI 194
             +    D  ++    + +LI
Sbjct: 180 RLLASDTDSVEALTHDVAQLI 200


>gi|90415428|ref|ZP_01223362.1| hypothetical protein GB2207_08931 [marine gamma proteobacterium
           HTCC2207]
 gi|90332751|gb|EAS47921.1| hypothetical protein GB2207_08931 [marine gamma proteobacterium
           HTCC2207]
          Length = 214

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 90/200 (45%), Gaps = 17/200 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGN------------RRFNSDVHLVAQDGTDF 49
           K   +++   ++ V+   A+       +                R  SD  L+  +G  F
Sbjct: 8   KLTVLVILCFIVLVIFGFAWKMRQPVPMSAEDLRVNGAIELSTPRIFSDFDLIDHNGDAF 67

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL-NAYFITVDPKRDTPE 108
           +L +     SIVFFGFTNC  +CPTTL+ L+ + + +  +         +++DP+RDT E
Sbjct: 68  TLENFKGVWSIVFFGFTNCPDICPTTLATLNAMYEDLGDSEKENLQIVMVSLDPERDTVE 127

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            M  +V  F++  +G++G P  +++++    I    V       E+ Y VDH+T ++L +
Sbjct: 128 KMALYVPYFNEDFVGVTGSPYSILQLSTQLTIAYTKVDLG----EDNYTVDHSTQVVLIN 183

Query: 169 TAGSIVGVIPYKDDSDSAIE 188
             G   G         +  +
Sbjct: 184 PKGHYHGFFKAPHGEVAMRQ 203


>gi|144898038|emb|CAM74902.1| Electron transport protein SCO1/SenC [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 188

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 2/163 (1%)

Query: 33  RRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-T 91
           + F+    L   DG   +  S   K  ++ FG+T C  VCPT LS +   L  + P    
Sbjct: 22  QEFSGRFLLETHDGKRVNDESFKGKVRMMAFGYTFCPDVCPTALSTMAAALDLLGPQRAE 81

Query: 92  LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSG 151
            +   F+TVDPKRDT   +K ++  F    IG++G        A++FR+           
Sbjct: 82  QVVPLFVTVDPKRDTRAQLKDYMSAFGPSFIGLTGTVQMTDAAARSFRVRYEIHQPADKD 141

Query: 152 VEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
             + Y VDH+  + + D  G     + +  +++   +++ ++I
Sbjct: 142 S-DHYVVDHSAGIFIMDRNGGFAAKLGHTANAEDVADRLRQII 183


>gi|126738534|ref|ZP_01754239.1| regulatory protein SenC [Roseobacter sp. SK209-2-6]
 gi|126720333|gb|EBA17039.1| regulatory protein SenC [Roseobacter sp. SK209-2-6]
          Length = 207

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 78/172 (45%), Gaps = 4/172 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           SS+   G       + L+  +G   +   ++ +PSI++FG+T C  VCP  +SR    + 
Sbjct: 39  SSQIAGGTAAIGGPLELLNANGETVTEKEIFTEPSILYFGYTFCPDVCPMDVSRNAETID 98

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            +   G      F+++DP RDTPEV+  F     +++IG++G    V   ++ ++ Y   
Sbjct: 99  LLAEQGISTTPVFVSIDPDRDTPEVVGDFAFNIHEKMIGLTGSMEQVKAASRAYKTYFKK 158

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
               + G E+ Y VDH+T   L              +  +   EK++  +  
Sbjct: 159 ----QDGDEDYYLVDHSTFSYLVLPGEGFAEFFRRDETPEQIAEKVSCFVEN 206


>gi|57238886|ref|YP_180022.1| SCO2 like-protein [Ehrlichia ruminantium str. Welgevonden]
 gi|58578815|ref|YP_197027.1| SCO2 like-protein [Ehrlichia ruminantium str. Welgevonden]
 gi|58616874|ref|YP_196073.1| SCO2 like-protein [Ehrlichia ruminantium str. Gardel]
 gi|5163241|gb|AAD40617.1|AF117728_1 major antigenic protein 2 [Ehrlichia ruminantium]
 gi|5163243|gb|AAD40618.1|AF117729_1 major antigenic protein 2 [Ehrlichia ruminantium]
 gi|57160965|emb|CAH57871.1| major antigenic protein 2 [Ehrlichia ruminantium str. Welgevonden]
 gi|58416486|emb|CAI27599.1| SCO2 like-protein [Ehrlichia ruminantium str. Gardel]
 gi|58417441|emb|CAI26645.1| SCO2 like-protein [Ehrlichia ruminantium str. Welgevonden]
          Length = 209

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 48/210 (22%), Positives = 87/210 (41%), Gaps = 21/210 (10%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGT 47
           MKA+  IL   LL     + Y   + +              +      N+   L+ QDG 
Sbjct: 5   MKAIKFILNLCLLFAAIFLGYSYITKQGIFQPKLHDSPDVNISNKADINTSFSLINQDGI 64

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTP 107
             S      K  +V FGF++C  +CP  L     +L Q+      L   FIT+DP +DT 
Sbjct: 65  TISSKDFLGKHMLVLFGFSSCKTICPMELGLASTILDQLGNEADKLQVVFITIDPTKDTV 124

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E +K+F + F  RI  ++G+   + ++ + +++YV          +    ++H+  + + 
Sbjct: 125 ETLKEFHKNFDSRIQMLTGNIEAINQIVQGYKVYV-------GQPDNDNQINHSGIMYIV 177

Query: 168 DTAGSIVGVIPYKD-DSDSAIEKINRLITY 196
           D  G  +          +  ++K+  LI  
Sbjct: 178 DKKGEYLAHFVPDLKSKEPQVDKLLSLIKQ 207


>gi|261331042|emb|CBH14031.1| electon transport protein SCO1/SCO2, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 386

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 43/151 (28%), Positives = 73/151 (48%), Gaps = 3/151 (1%)

Query: 28  FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD 87
                        L+  DG  ++      K   ++FGFTNC  VCP  +++L R+++ +D
Sbjct: 170 DSPEGPSIGGPFSLIGVDGRRYTEKDFLGKWLYIYFGFTNCPDVCPEEMAKLSRVVQHLD 229

Query: 88  PT--GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
                      FI++DP RDTPE ++ ++  F+ RI+G+ G   +V  VA+ +R+Y   +
Sbjct: 230 KKVGRDYWQPIFISLDPHRDTPEKIRDYLADFNPRILGLVGTQEEVESVARQYRVYFA-L 288

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
             E    E+ Y VDH+  + L +  G     
Sbjct: 289 PDETVLSEDDYLVDHSIIMYLMNPEGKFCDY 319


>gi|5163237|gb|AAD40615.1|AF117726_1 major antigenic protein 2 [Ehrlichia ruminantium]
          Length = 209

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 48/210 (22%), Positives = 87/210 (41%), Gaps = 21/210 (10%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGT 47
           MKA+  IL   LL     + Y   + +              +      N+   L+ QDG 
Sbjct: 5   MKAIKFILNLCLLFAAIFLGYSYITKQGIFQPKLHDSPDVNISNKADINTSFSLINQDGI 64

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTP 107
             S      K  +V FGF++C  +CP  L     +L Q+      L   FIT+DP +DT 
Sbjct: 65  TISSKDFLGKHMLVLFGFSSCKTICPMELGLASTILDQLGNEAGKLQVVFITIDPTKDTV 124

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E +K+F + F  RI  ++G+   + ++ + +++YV          +    ++H+  + + 
Sbjct: 125 ETLKEFHKNFDSRIQMLTGNIEAINQIVQGYKVYV-------GQPDNDNQINHSGIMYIV 177

Query: 168 DTAGSIVGVIPYKD-DSDSAIEKINRLITY 196
           D  G  +          +  ++K+  LI  
Sbjct: 178 DKKGEYLAHFVPDLKSKEPQVDKLLSLIKQ 207


>gi|114561437|ref|YP_748950.1| electron transport protein SCO1/SenC [Shewanella frigidimarina
           NCIMB 400]
 gi|114332730|gb|ABI70112.1| electron transport protein SCO1/SenC [Shewanella frigidimarina
           NCIMB 400]
          Length = 204

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 51/205 (24%), Positives = 93/205 (45%), Gaps = 14/205 (6%)

Query: 6   IILGTILLAVLGSIAY-------VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           I +G +LLA++G + Y       +   + +V   +R  +   L  Q G  F+  ++  K 
Sbjct: 2   IAVGLMLLALVGGVVYQQTQTEPMPLETSYVFEQQRPLAPFTLADQYGNAFTNQTVQGKW 61

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS 118
           S+ F G+T C  VCPTTL++L     Q+    + +   F++ DPKRDT      ++  F+
Sbjct: 62  SLFFIGYTACPDVCPTTLNKLAAAYPQLQKIASNVQVVFVSADPKRDTQAKRLDYINFFN 121

Query: 119 DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
                +S +  D+   +++       V     G +  Y VDH+ + +L    G  + V  
Sbjct: 122 KDFKAVSAEHTDLFPFSRDLGFVYAMV-----GEDSDYQVDHSASYVLVSPRGEKIAVFK 176

Query: 179 YKDDSDSAIEKIN-RLIT-YGNVVK 201
            K       + +N  LI+ +  +V+
Sbjct: 177 PKPQPGQLAQILNAELISDFSQIVQ 201


>gi|325117624|emb|CBZ53176.1| putative SCO1/SenC domain-containing protein [Neospora caninum
           Liverpool]
          Length = 197

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 43/178 (24%), Positives = 69/178 (38%), Gaps = 4/178 (2%)

Query: 20  AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRL 79
           A+   +     G         LV   G             +++FGFT C  +CP  L ++
Sbjct: 13  AHAFLTESDTVGKPLLGGPWTLVDMQGRVRGSEEFEGAYQLLYFGFTFCPDICPQELEKM 72

Query: 80  DRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNF 138
            +++       G ++   FITVDPKRDT   +K + + F  R++G +G P  +  V + F
Sbjct: 73  AQVIDIIDKEFGEIVQPIFITVDPKRDTVAQVKSYCEEFHPRLLGFTGTPAQIKDVTRKF 132

Query: 139 RIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           R+Y N         +  Y VDH+         G                E+I + I  
Sbjct: 133 RVYYNE---GIKSSDADYLVDHSIIQYFMGKNGKFKDFFGKNMTVKEIAERIAKHIKQ 187


>gi|116193185|ref|XP_001222405.1| hypothetical protein CHGG_06310 [Chaetomium globosum CBS 148.51]
 gi|88182223|gb|EAQ89691.1| hypothetical protein CHGG_06310 [Chaetomium globosum CBS 148.51]
          Length = 277

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 7/189 (3%)

Query: 9   GTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNC 68
           G + +     + +   + K     +R       V   G       L  + S+V+FGFT+C
Sbjct: 87  GLLFIVTGAGLVWYFENEKDRMQRKRIAEANKGV---GKP-KDQDLKGRYSLVYFGFTHC 142

Query: 69  SAVCPTTLSRLDRLLKQVDPTGT-LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGD 127
             +CP  L ++ R+   V+     ++   F+T DP RD P+ MK+++  F  + IG++G 
Sbjct: 143 PDICPEELDKMARMFDLVEQQRPGVMTPLFVTCDPARDGPKEMKEYLAEFHPKFIGLTGT 202

Query: 128 PIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAI 187
              +  + K +R+Y +     K    + Y VDH+    L D  G  V  +  +   D A 
Sbjct: 203 YEQIKAMCKAYRVYFSTPSEVK--PGQDYLVDHSIYFYLMDPEGDFVEALGRQHSPDQAA 260

Query: 188 EKINRLITY 196
           + I   +  
Sbjct: 261 KVILDHMKE 269


>gi|317403807|gb|EFV84285.1| exported protein [Achromobacter xylosoxidans C54]
          Length = 204

 Score =  107 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 93/201 (46%), Gaps = 8/201 (3%)

Query: 1   MKAL-------GIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSS 53
           M+ L       G+ L   +L        V ++   V G+        L    G   S   
Sbjct: 1   MRHLLTGRAWRGLFLALCMLLAACGDRNVDWTLYNVKGHLPDLK-FSLPGAGGKTVSSDD 59

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K  ++FFG+ +C  +CPTT+++L  +L+ +      +   F++VDP RDTP++++ +
Sbjct: 60  LKGKTVLLFFGYASCPDICPTTMAQLTAVLQNLGDKARDVRIVFVSVDPHRDTPDILQAY 119

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           V  F+++ IG++G+   V  +A+ +R+             ++Y V H+  + +FD  G  
Sbjct: 120 VNAFNNQAIGVTGNEKQVADLARRYRVAYQIEKPRPGDDADQYEVTHSRGVYIFDNQGRA 179

Query: 174 VGVIPYKDDSDSAIEKINRLI 194
             +    D  ++  + +  LI
Sbjct: 180 RLLASDTDSIEAMTKDLRLLI 200


>gi|325274016|ref|ZP_08140173.1| electron transport protein SCO1/SenC [Pseudomonas sp. TJI-51]
 gi|324100843|gb|EGB98532.1| electron transport protein SCO1/SenC [Pseudomonas sp. TJI-51]
          Length = 210

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/208 (24%), Positives = 86/208 (41%), Gaps = 18/208 (8%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVD-------------GNRRFNSDVHLVAQDGTDF 49
               +L  ++  ++G       + +                   R  +DV +  QDG   
Sbjct: 6   KTVFVLVALVALIMGLTVNKVLNGRDQPNPAELIDAGIILLPQSRAVADVTMTNQDGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
            L  L  K S++FFG+T C  +CPTTL++L ++  +        L    ++VDP RDTP 
Sbjct: 66  QLDELKGKWSLLFFGYTYCPDICPTTLAQLRQVKSELPKDAVDRLQVVLVSVDPNRDTPN 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F    IG++G   D  ++A    I        K G    Y VDH+  L +  
Sbjct: 126 QLKQYLAYFDKDFIGVAGSIEDTQKLANALSIPFIPADTSKPG----YTVDHSGNLAVVG 181

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G   G I    ++   + ++  L+  
Sbjct: 182 PDGRQRGFIRAPFNNQKLVAQLPGLVKR 209


>gi|311692981|gb|ADP95854.1| electron transport protein SCO1/SenC [marine bacterium HP15]
          Length = 207

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/191 (26%), Positives = 91/191 (47%), Gaps = 5/191 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
           ++ ++LL    +     ++ K + G      +  L+   G   S      +  ++FFGFT
Sbjct: 19  LIASLLLTGCFANDEEDWNGKNISGLMPEL-EFDLINSQGESVSGEDYSGRVRMLFFGFT 77

Query: 67  NCSAVCPTTLSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTPEVMKKFVQRFSDRIIGIS 125
           +C  VCPT L +L++    + PT        F++VDPKRDTPE + K+V  F D I+G++
Sbjct: 78  SCPDVCPTALQKLNQATSGLAPTLQDEVLTLFVSVDPKRDTPERLAKYVDFFGDNIVGLT 137

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
           G+   +  +AK +R        ++   +  Y V H++A+ +FD  G+   +I      + 
Sbjct: 138 GNEPQLRELAKRYRTTFG---YDEPDPDGNYAVSHSSAIYVFDREGNPRLLIRPDLSGEE 194

Query: 186 AIEKINRLITY 196
               +  LI  
Sbjct: 195 IRHDLVALIQE 205


>gi|301632420|ref|XP_002945283.1| PREDICTED: SCO2-like protein RF_0960-like [Xenopus (Silurana)
           tropicalis]
          Length = 148

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/148 (29%), Positives = 71/148 (47%), Gaps = 3/148 (2%)

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPE 108
            SL     K  +VFFG+T C  VCPT+L  L    + +   G  L   F+TVDP+RDT E
Sbjct: 2   RSLQDFRGKAVVVFFGYTQCPDVCPTSLQELAEAKQLLGAEGERLQGIFVTVDPERDTAE 61

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
           +++ ++  F    + + G P  +  VAK+F++Y   V  +       Y +DH+    ++D
Sbjct: 62  ILQFYMGSFDPGFLALRGSPEQLAAVAKDFKVYYKRVEGK---TPTSYTMDHSAGSYIYD 118

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
            AG +     Y     +  E +  L+  
Sbjct: 119 PAGRLRVYHRYGSGPQALAEDVRTLLRE 146


>gi|294852743|ref|ZP_06793416.1| electron transporter SCO1/SenC [Brucella sp. NVSL 07-0026]
 gi|294821332|gb|EFG38331.1| electron transporter SCO1/SenC [Brucella sp. NVSL 07-0026]
          Length = 201

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 65/173 (37%), Positives = 92/173 (53%), Gaps = 4/173 (2%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    I   + + V+   A  +F          F    +LV  DG  FS   L   P++
Sbjct: 1   MKKFLPIFIVVFIIVIIGAAGFNFVRDKQAAKEPFGGSFNLVTMDGKPFSEKDLRATPAV 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           VFFGFT+C  VCPTTL  LD  LKQ+ P    + AYF+TVDP+RDT +VM  +V   +DR
Sbjct: 61  VFFGFTHCPDVCPTTLYELDGWLKQLGPEAGDIKAYFVTVDPERDTQDVMNTYVSNVTDR 120

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           I+GI+G P ++  + K++ +Y   V  E       Y +DHT ++ L D  G+ 
Sbjct: 121 IMGITGTPDNIAEMVKSYHVYARKVPIED----GDYTMDHTASIFLLDKGGAF 169


>gi|82594523|ref|XP_725461.1| hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
 gi|23480476|gb|EAA17026.1| Plasmodium falciparum CG3 [Plasmodium yoelii yoelii]
          Length = 286

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/178 (24%), Positives = 79/178 (44%), Gaps = 9/178 (5%)

Query: 28  FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQV- 86
              G      +  L+  +G   +  +   K  +++ GF+ C  +CP  L +   + +++ 
Sbjct: 102 ENIGKPLIGGNFTLIDYNGNIVTNQTFKGKYCLIYXGFSYCPDICPQELEKQTIVFEKIS 161

Query: 87  DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVL 146
              G +L   FITVDP RDT   +  + + F+ ++IG++G    +  VAK FR+Y N  +
Sbjct: 162 KKYGDILTPIFITVDPNRDTVAQINYYCKSFNSKLIGLTGTKDLIKHVAKLFRVYYNEHV 221

Query: 147 AE--------KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            E            +  Y +DH+    L DT G  V         +  +E+I++ +  
Sbjct: 222 TETGSQNQTVNDQNKYNYLIDHSIIHYLLDTEGKFVDFFGKNCTINEMVERISQYLDE 279


>gi|326478725|gb|EGE02735.1| hypothetical protein TEQG_01772 [Trichophyton equinum CBS 127.97]
          Length = 254

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 76/175 (43%), Gaps = 16/175 (9%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVD-----------GNRRFNSDVHLVAQDGTDFSLSSLYI 56
               +L   G I Y  +    ++           G  R      L   +G  F+  +L  
Sbjct: 82  AVLFVLTGAGMIVYFQYEKARLERERIVEMSKGVGKPRVGGPFVLKDLNGETFTEENLKG 141

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQ---VDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           K S V+FGFT+C  +CP  L ++  ++ +         ++   FIT DP RD+PEV++ +
Sbjct: 142 KYSFVYFGFTHCPDICPDELDKMAEIIDEVRARSNGQEVMRPVFITCDPARDSPEVLRGY 201

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
           +  F   IIG++G    V  V + +R+Y +    +     E Y VDH+    L  
Sbjct: 202 LNEFHKDIIGLTGTYEQVKDVCRQYRVYFST--PQNIKPGEDYLVDHSIYFYLMG 254


>gi|269468094|gb|EEZ79804.1| electron transport protein SCO1/SenC [uncultured SUP05 cluster
           bacterium]
          Length = 224

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/223 (21%), Positives = 81/223 (36%), Gaps = 27/223 (12%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD-------------GNRRFNSDVHLVAQDGT 47
           M    +++    +  +G   + + ++                    +   +  LV  +  
Sbjct: 1   MSKTTLLITIAFIVSIGVAVFSTNTNTDYQFLKRQLKVSHVLHNTNKVLPNFSLVDHNQH 60

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ--VDPTGTLLNAYFITVDPKRD 105
            F+      K +++ F +T+C  VCPT L  +  L          T+     IT DPKRD
Sbjct: 61  LFNNDRFKGKWTLLTFIYTHCPDVCPTILMDMSMLKSILIQRGVETVPEFVAITFDPKRD 120

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEK------------SGVE 153
           TPEV+K ++  F    +G+SGD   + ++ K F  Y    +                   
Sbjct: 121 TPEVLKTYITHFDKDFLGVSGDQTQIDQLIKPFGTYYERSIEVDGKTVIIPNGQAMPESV 180

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
             Y ++HT  L L    G I    P      +  + I  LI+ 
Sbjct: 181 TSYSINHTAWLYLISPDGEIFAGFPTPHKPHNMADDIELLISN 223


>gi|56698677|ref|YP_169054.1| regulatory protein SenC [Ruegeria pomeroyi DSS-3]
 gi|56680414|gb|AAV97080.1| regulatory protein SenC [Ruegeria pomeroyi DSS-3]
          Length = 206

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 76/170 (44%), Gaps = 4/170 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           + +   G         LV   G   +   +  +PS+++FG+T C  VCP   SR    + 
Sbjct: 38  AGQIAGGAETIGGPFELVNAKGETVTDKDVITEPSLLYFGYTFCPDVCPLDTSRNAEAVD 97

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            ++  G ++   FI++D  RDTPEV+  F     +R+IG++G P  V   ++ ++ Y   
Sbjct: 98  ILEGRGQMVTPVFISIDADRDTPEVVGDFAANLHERMIGLTGSPEQVKAASQAYKTYYR- 156

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
               +   +E Y VDH+T   L       V      + ++   +++   +
Sbjct: 157 ---AQDKSDEYYLVDHSTFSYLVLPEHGFVEFFRRDETAEKMADRVGCFL 203


>gi|226942262|ref|YP_002797335.1| electron transport protein SCO1/SenC [Azotobacter vinelandii DJ]
 gi|226717189|gb|ACO76360.1| Electron transport protein SCO1/SenC [Azotobacter vinelandii DJ]
          Length = 211

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 57/206 (27%), Positives = 92/206 (44%), Gaps = 17/206 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDF 49
           K + I++  I + +  + + V    +  D               R    + L  QDG   
Sbjct: 6   KTVLILVALIAIVLGLTFSKVLNGPRQADSAQLLEAGIVLLPQGRPLPALSLTDQDGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           +L SL  K S+VFFG+T C  +CPTTL++L +L  Q    T   L    ++VDP+RDTP 
Sbjct: 66  ALQSLTGKWSLVFFGYTFCPDICPTTLAQLRQLESQLPPATRERLQVVMVSVDPQRDTPA 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F     G++G+  D+ R+A    I             E Y VDH+  L L  
Sbjct: 126 QLKQYLAFFDPDYRGLTGELADIQRLANTLGIPF----IPGDPSRENYTVDHSGNLALLG 181

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLI 194
             G+  G +    +     E++  L+
Sbjct: 182 PDGTQRGFVRAPLNVAKLAERLPLLV 207


>gi|323526843|ref|YP_004228996.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1001]
 gi|323383845|gb|ADX55936.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1001]
          Length = 244

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 53/200 (26%), Positives = 90/200 (45%), Gaps = 8/200 (4%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFN----SDVHLVAQDGTDFSLSSLYIK 57
           + L   +    LA + ++A  + +                D  L   DG   + +S   +
Sbjct: 46  RRLAPAVWAGALAAMVALAGCTNAGPPWHLTNVSGHLPDLDFSLTGDDGRPVTGASFRGR 105

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
            S+V+FG+T+C  VCP T+ RL  +L ++ P    +   FITVDP RDTP+ +  +V  F
Sbjct: 106 ASLVYFGYTHCPDVCPETMGRLMEVLAKLGPDAQKVRILFITVDPARDTPQALHDYVGAF 165

Query: 118 S-DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
                 G++G    +  +AK +R+       EK      Y V H++A+ +FD  G    +
Sbjct: 166 DSKHAEGLTGTDWQIESLAKRYRVAYQM---EKRDPSGNYEVTHSSAVYVFDAQGRARLL 222

Query: 177 IPYKDDSDSAIEKINRLITY 196
               D  D+  E + R++  
Sbjct: 223 ATDNDTPDAIAEDLRRIVDQ 242


>gi|5163239|gb|AAD40616.1|AF117727_1 major antigenic protein 2 [Ehrlichia ruminantium]
 gi|289923|gb|AAA50280.1| immunodominant protein [Ehrlichia ruminantium]
          Length = 209

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/210 (22%), Positives = 87/210 (41%), Gaps = 21/210 (10%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSK-------------FVDGNRRFNSDVHLVAQDGT 47
           MKA+  IL   LL     + Y   + +              +      N+   L+ QDG 
Sbjct: 5   MKAIKFILNLCLLFAAIFLGYSYITKQGIFQPKLHDSPDVNISNKADINTSFSLINQDGI 64

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTP 107
             S      K  +V FGF++C  +CP  L     +L Q+      L   FIT+DP +DT 
Sbjct: 65  TISSKDFLGKHMLVLFGFSSCKTICPMELGLASTILDQLGNESDKLQVVFITIDPTKDTV 124

Query: 108 EVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
           E +K+F + F  RI  ++G+   + ++ + +++YV          +    ++H+  + + 
Sbjct: 125 ETLKEFHKNFDSRIQMLTGNIEAINQIVQGYKVYV-------GQPDNDNQINHSGIMYIV 177

Query: 168 DTAGSIVGVIPYKD-DSDSAIEKINRLITY 196
           D  G  +          +  ++K+  LI  
Sbjct: 178 DKKGEYLTHFVPDLKSKEPQVDKLLSLIKQ 207


>gi|21328710|gb|AAM48716.1| senC protein [uncultured marine proteobacterium]
          Length = 207

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 74/167 (44%), Gaps = 3/167 (1%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
                     L+   G   + + +  +P++V+FG+T C  VCP  ++R    ++ +   G
Sbjct: 44  AGGSIGGPFELIDHRGQMVTDAQVLDQPALVYFGYTFCPDVCPMDVARNVVAVEILADAG 103

Query: 91  TLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKS 150
             +   FIT+DP RDT E +  FV      ++G++G    + + A+ +++Y     ++  
Sbjct: 104 LTVKPVFITIDPDRDTVEYLADFVANNHPEMVGLTGTAEQIAKAARAYKVYYRKQPSQD- 162

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
             EE Y +DH++   L       V  +      +   +++  ++   
Sbjct: 163 --EEYYLMDHSSFSYLMVPGFGFVDFLRSDLPPEVVADRVACVLKAS 207


>gi|114320966|ref|YP_742649.1| electron transport protein SCO1/SenC [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227360|gb|ABI57159.1| electron transport protein SCO1/SenC [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 207

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/151 (27%), Positives = 75/151 (49%), Gaps = 5/151 (3%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTL 92
               D  L+++ G   SLS    K  +++FG+  C  VCP +L+R+   L+Q  D     
Sbjct: 50  PVGGDFTLISKQGE-VSLSDFEGKLVLIYFGYVFCPDVCPDSLARVAAALEQLDDEARAQ 108

Query: 93  LNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGV 152
           +   F+++DP+RDT + +  + + F + I+G++GDP  +  +A  +      V  E    
Sbjct: 109 VQPLFVSIDPERDTLDHLDHYARWFHEDIVGLTGDPEVIREIADRYGAAYRKVEEEGQA- 167

Query: 153 EEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
              Y VDH++   L D  G +  ++P+  D 
Sbjct: 168 --GYLVDHSSFFYLVDRQGELDEILPHGMDP 196


>gi|148545385|ref|YP_001265487.1| electron transport protein SCO1/SenC [Pseudomonas putida F1]
 gi|148509443|gb|ABQ76303.1| electron transport protein SCO1/SenC [Pseudomonas putida F1]
          Length = 210

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/208 (24%), Positives = 86/208 (41%), Gaps = 18/208 (8%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVD-------------GNRRFNSDVHLVAQDGTDF 49
               IL  ++  +LG       + +                   R  +DV +  QDG   
Sbjct: 6   KTVFILVALVALILGLTVNKVLNGRDQPNPAELIDAGIILLPQSRAVADVTMTNQDGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
            +  L  K S++FFG+T C  +CPTTL++L ++  +    T   L    ++VDP RDTP 
Sbjct: 66  QMDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSELPKDTVDRLQVVLVSVDPNRDTPN 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F    +G++G   D  ++A    I        K G    Y VDH+  L +  
Sbjct: 126 QLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFIPADTSKPG----YTVDHSGNLAIVG 181

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G   G I    ++     ++  L+  
Sbjct: 182 PDGRQRGFIRAPFNNQKLGAQLPGLVKR 209


>gi|239787432|emb|CAX83904.1| Electron transport protein SCO1/SenC [uncultured bacterium]
          Length = 233

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 66/167 (39%), Gaps = 4/167 (2%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLL---KQVD 87
              R      L   +   F+L  L  + + +FFG+T+C  VCP ++  L  +    +   
Sbjct: 59  PTPRELKPFTLTDHEERAFTLDQLKGQWTFLFFGYTHCPDVCPVSMGALAEVWTLLQSTS 118

Query: 88  PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLA 147
                +   F++VDP RDT   +K++V  F    +G++G    +   AK    Y +    
Sbjct: 119 NGLKNVRGVFVSVDPDRDTLPHLKEYVGYFHPDFLGVTGTHETIRGFAKQLGAYYSLPEK 178

Query: 148 EKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD-SDSAIEKINRL 193
           ++     +  + HT+   L D  G    +   +        E   ++
Sbjct: 179 KEGSDSSEQTISHTSVFFLLDPEGRFAAMFQPQMHMPARVAELFVKI 225


>gi|307730510|ref|YP_003907734.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1003]
 gi|307585045|gb|ADN58443.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1003]
          Length = 194

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 52/194 (26%), Positives = 88/194 (45%), Gaps = 4/194 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           LG      ++A+ G                  + D  L   DG   + +S   + S+V+F
Sbjct: 2   LGAAALLTMIALAGCSQRAEPWHLTNVSGHLPDLDFSLTGDDGRPVTGASFKGRASLVYF 61

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS-DRII 122
           G+T+C  VCP T+ RL ++L ++ P    +   FITVDP RDTP+ +  +V  F      
Sbjct: 62  GYTHCPDVCPETMGRLMQVLGKLGPDAQKVRILFITVDPARDTPQALHDYVGAFDTTHAE 121

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
           G++G    +  +AK +R+       EK      Y V H++A+ +FD  G    +    D 
Sbjct: 122 GLTGTDWQIESLAKRYRVAYQM---EKRDPNGNYEVTHSSAVYVFDAQGRARLLATDNDT 178

Query: 183 SDSAIEKINRLITY 196
            D+  + + R++  
Sbjct: 179 PDAIAQDLRRIVDQ 192


>gi|70942870|ref|XP_741549.1| Cg3 protein [Plasmodium chabaudi chabaudi]
 gi|56520000|emb|CAH76418.1| Cg3 protein, putative [Plasmodium chabaudi chabaudi]
          Length = 288

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/189 (22%), Positives = 84/189 (44%), Gaps = 9/189 (4%)

Query: 17  GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTL 76
           G   ++  +     G      +  L+  +G   +  +   K  +++FGF+ C  +CP  L
Sbjct: 89  GGKNHIGKTRVENIGKPLIGGNFTLIDYNGNIVTNQTFKGKYCLIYFGFSYCPDICPQEL 148

Query: 77  SRLDRLLKQV-DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVA 135
            +   + +++    G ++   FITVDP RDT   +  + + F+ ++IG++G    +  VA
Sbjct: 149 EKQTIVFEKISKKYGDIVTPIFITVDPNRDTVAQINYYCKSFNPKLIGLTGTKDLIKHVA 208

Query: 136 KNFRIYVNNVLAEKSGVEE--------KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAI 187
           K FR+Y N  + +     +         Y +DH+    L DT G  V         +  +
Sbjct: 209 KLFRVYYNEHITDMGNTNQTVTNQNKYNYLIDHSIIHYLLDTEGKFVDFFGKNCTINEMV 268

Query: 188 EKINRLITY 196
           ++I++ +  
Sbjct: 269 DRISQYLDE 277


>gi|209736062|gb|ACI68900.1| SCO1 protein homolog, mitochondrial precursor [Salmo salar]
          Length = 304

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/188 (22%), Positives = 82/188 (43%), Gaps = 12/188 (6%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           K+L I      + + G   +     + ++       G         LV Q+         
Sbjct: 99  KSLAITFAFGGVLLAGMKYFKKEKEELIERERTKSMGKPALGGPFSLVDQNNKPCKSEDF 158

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG--TLLNAYFITVDPKRDTPEVMKK 112
             +  +++FGFT+C  +CP  + ++  ++ ++D       L    IT+DP RDTPE M  
Sbjct: 159 LSQWVLIYFGFTHCPDICPDEIEKMIEVVDEIDRIQSLPNLTPILITIDPDRDTPEAMGT 218

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V+ FS ++IG++G    + +V++ +R+Y +    ++   +  Y VDHT  + L    G 
Sbjct: 219 YVKEFSPKLIGLTGTMPQIDQVSRAYRVYYSQGPKDE---DNDYIVDHTIIMYLVGPDGE 275

Query: 173 IVGVIPYK 180
                   
Sbjct: 276 FKEYFGQN 283


>gi|188580632|ref|YP_001924077.1| electron transport protein SCO1/SenC [Methylobacterium populi
           BJ001]
 gi|179344130|gb|ACB79542.1| electron transport protein SCO1/SenC [Methylobacterium populi
           BJ001]
          Length = 211

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 53/186 (28%), Positives = 90/186 (48%), Gaps = 4/186 (2%)

Query: 13  LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           + ++ +                      L +  G      +L  KP +VFFGFT C  +C
Sbjct: 28  VGIVAATVAFLPRGDRPSALSVIGGPFRLESSKGGVVDSQALKGKPFLVFFGFTQCPNIC 87

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVM 132
           PTTL+ L  LL      G  + AY+IT+DP+RDT  +M++++  F+DRI G++G P  + 
Sbjct: 88  PTTLADLGTLLDTFGAEGGDVQAYYITLDPERDTQAMMQEYMASFTDRITGLTGTPQQIE 147

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
           RVA+++R  V  V          Y ++HT  + + D  G   G +        A++++ +
Sbjct: 148 RVARDYRASVKRVPL----PGGDYTLEHTLMVYMMDRNGGFAGPLDLNAGHALALKQLRK 203

Query: 193 LITYGN 198
           L++ G 
Sbjct: 204 LVSDGR 209


>gi|114777658|ref|ZP_01452618.1| Electron transport protein SCO1/SenC [Mariprofundus ferrooxydans
           PV-1]
 gi|114551874|gb|EAU54408.1| Electron transport protein SCO1/SenC [Mariprofundus ferrooxydans
           PV-1]
          Length = 199

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 89/201 (44%), Gaps = 11/201 (5%)

Query: 1   MKALGIILGTILLAVL------GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSL 54
           MK    ++  I + +L      G   +     +     +R   D  L++ DG   SL   
Sbjct: 2   MKKHWKLISAISVMLLFAAGVAGWSVWHHARPEIPGYLKRMGGDFTLMSADG-PVSLHDY 60

Query: 55  YIKPSIVFFGFTNCSAVC-PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
             +  +V+FG+T+C  VC          +        +     F++VDP+RD P+++KK+
Sbjct: 61  RGRVVLVYFGYTHCPDVCPMALGVIASAMHALKGSEASHAAGIFVSVDPRRDHPDLLKKY 120

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
              F   I+G++G    + +VA+N+ +  +     K+  +E Y V+H+T + L +  G I
Sbjct: 121 TAFFDPHIVGVTGSNTVLNQVAQNWHVSFSVP---KAAADENYTVEHSTFIYLVNAKGQI 177

Query: 174 VGVIPYKDDSDSAIEKINRLI 194
           V +   K       + + R +
Sbjct: 178 VELFDEKTSPKLIAQAMRRWL 198


>gi|91784559|ref|YP_559765.1| electron transport protein SCO1/SenC [Burkholderia xenovorans
           LB400]
 gi|91688513|gb|ABE31713.1| Electron transport protein SCO1/SenC [Burkholderia xenovorans
           LB400]
          Length = 219

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 52/195 (26%), Positives = 92/195 (47%), Gaps = 8/195 (4%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGNRRFN----SDVHLVAQDGTDFSLSSLYIKPSI 60
            +   T++L  L ++A  +   +              D  L   DG   + +S   + S+
Sbjct: 24  RLFALTLMLGALTALAGCTHRQETWQLTNVTGHLPDLDFTLTGDDGRAVNGASFKGRTSL 83

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
           V+FG+T+C  VCP T+ RL ++L ++ P    +   F+TVDP RDT + +  +V  F  +
Sbjct: 84  VYFGYTHCPDVCPETMGRLMQVLGKLGPDAQKVRILFVTVDPARDTAQALHDYVGAFDPK 143

Query: 121 I-IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
              G++G    +  +AK +R+       EK      Y V H++A+ +FD+ G    +   
Sbjct: 144 HAEGLTGTDRQIESLAKRYRVAYQM---EKRDPHGNYEVTHSSAVYVFDSQGHARLLATD 200

Query: 180 KDDSDSAIEKINRLI 194
            D  D+  E + R+I
Sbjct: 201 HDTPDAIAEDLRRII 215


>gi|326404784|ref|YP_004284866.1| SenC protein [Acidiphilium multivorum AIU301]
 gi|325051646|dbj|BAJ81984.1| SenC protein [Acidiphilium multivorum AIU301]
          Length = 240

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 74/168 (44%), Gaps = 3/168 (1%)

Query: 29  VDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDP 88
           +           L  Q G   + +S   +  +V+FG++ C   CP TL ++  ++  +  
Sbjct: 76  ISPGAPIGGPFTLTNQFGQAMTPASFRGRWMLVYFGYSRCPDDCPLTLEKMAIMMNALGK 135

Query: 89  TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAE 148
               +   FITVDP  DTP V++ ++ +FS++IIG++G   ++ +VA+ +  Y N     
Sbjct: 136 LAKHVAPVFITVDPTHDTPAVLRTYLPKFSNKIIGLTGPVPEIAKVAREYDAYFN---TT 192

Query: 149 KSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
                 +  + H+T + L    G    + P        +  + + I  
Sbjct: 193 DHEASGQSLISHSTFIYLMAPNGKFENLFPVSITVPQLVHIMKKAIAQ 240


>gi|26986856|ref|NP_742281.1| electron transport protein SCO1/SenC [Pseudomonas putida KT2440]
 gi|24981456|gb|AAN65745.1|AE016200_9 Sco1/SenC family protein [Pseudomonas putida KT2440]
 gi|313496482|gb|ADR57848.1| Electron transport protein SCO1/SenC [Pseudomonas putida BIRD-1]
          Length = 210

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/208 (24%), Positives = 85/208 (40%), Gaps = 18/208 (8%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVD-------------GNRRFNSDVHLVAQDGTDF 49
               IL  ++  +LG       + +                   R  +DV +  QDG   
Sbjct: 6   KTVFILVALVALILGLTVNKVLNGRDQPNPAELIDAGIILLPQSRAVADVTMTNQDGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
            +  L  K S++FFG+T C  +CPTTL++L ++  +        L    ++VDP RDTP 
Sbjct: 66  QMDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSELPKDAVDRLQVVLVSVDPNRDTPN 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F    +G++G   D  ++A    I        K G    Y VDH+  L +  
Sbjct: 126 QLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFIPADTSKPG----YTVDHSGNLAIVG 181

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G   G I    ++     ++  L+  
Sbjct: 182 PDGRQRGFIRAPFNNQKLGAQLPGLVKR 209


>gi|219849603|ref|YP_002464036.1| electron transport protein SCO1/SenC [Chloroflexus aggregans DSM
           9485]
 gi|219543862|gb|ACL25600.1| electron transport protein SCO1/SenC [Chloroflexus aggregans DSM
           9485]
          Length = 193

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/184 (26%), Positives = 82/184 (44%), Gaps = 4/184 (2%)

Query: 14  AVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCP 73
                    S ++          SD  L A  G + SLS L  +P +++FG+T C   CP
Sbjct: 13  GACAVTGPSSTTTPTKIDRPTVLSDFTLPASTGGELSLSDLRGQPVLLYFGYTRCPDYCP 72

Query: 74  TTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMR 133
            TL    R+  ++ P G  ++   I+VDP  DTP+V+  +++ F +  IG+ GD   + R
Sbjct: 73  ITLGEFRRVRDELGPNGMRVHFVLISVDPANDTPDVLAAYLRGFGEGFIGLQGDDATLRR 132

Query: 134 VAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
           ++K + +   +             VDH+TA  L D  G +  V  Y   +   +  I  L
Sbjct: 133 ISKEYGLTYRHGGGHHGNSG----VDHSTASYLIDQKGRLRVVYQYGTAASVYVNDIRAL 188

Query: 194 ITYG 197
           ++  
Sbjct: 189 LSEQ 192


>gi|71278890|ref|YP_266995.1| SCO1/SenC family protein [Colwellia psychrerythraea 34H]
 gi|71144630|gb|AAZ25103.1| SCO1/SenC family protein [Colwellia psychrerythraea 34H]
          Length = 222

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/210 (21%), Positives = 90/210 (42%), Gaps = 19/210 (9%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFV--------DGNRRFNSDVHLVAQDGTDFSLSS 53
           K +  I+  + +    +  Y+   +K +            R  S   L  + G  F+   
Sbjct: 3   KHIYTIIALLSICAGAAGFYLINKTKQLSLPEYALHYQQARPISAFTLTDELGQPFNNEQ 62

Query: 54  LYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKF 113
           L  K S+VFFG+T+C  VCPTTL  L+ + + +    +      ++VDPKRD+ E ++++
Sbjct: 63  LQDKWSLVFFGYTSCPDVCPTTLQNLNFIYEDLTNIASNSQVLLVSVDPKRDSREKLEQY 122

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYV-------NNVLAEKSGVEEKYFVDHTTALLL 166
           +  F+     +  +   +   ++N  +         +    E    +E Y+VDH+ +L+L
Sbjct: 123 IGYFNPNFKALRAEHDVLFPFSRNLGLMYAITSKEASKDKVEVPAGDEDYWVDHSASLVL 182

Query: 167 FDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            + AG I  +       +  +  +  +   
Sbjct: 183 INPAGKIAAIFR----PEQVVGDVPSIDNE 208


>gi|254464602|ref|ZP_05078013.1| electron transport protein SCO1/SenC [Rhodobacterales bacterium
           Y4I]
 gi|206685510|gb|EDZ45992.1| electron transport protein SCO1/SenC [Rhodobacterales bacterium
           Y4I]
          Length = 206

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/173 (26%), Positives = 72/173 (41%), Gaps = 4/173 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           SS+   G         L+   G   +   +  +PSIV+FG+T C  VCP   +R    + 
Sbjct: 38  SSQIAGGADTIGGAFELINSRGETVTDKDVITEPSIVYFGYTFCPDVCPMDAARNADAVD 97

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            +   G  +   FI++DP RDTPE +  F     +++IG++G    V   +K ++ Y   
Sbjct: 98  LLAERGISVTPVFISIDPDRDTPEAVGDFAANLHEKMIGLTGSLEQVRAASKAYKTYFKK 157

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
                 G E+ Y VDH+T   L       V      + ++    K    I   
Sbjct: 158 ----NEGDEDYYLVDHSTFSYLVLPEEGFVEFFGRDETAEQMAGKAACFIEKI 206


>gi|221051980|ref|XP_002257566.1| Cg3-like protein [Plasmodium knowlesi strain H]
 gi|193807396|emb|CAQ37902.1| Cg3-like protein [Plasmodium knowlesi strain H]
          Length = 289

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 15/188 (7%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +  +     G      D  L   DG   +      K  +++FGFT C  +CP  L +   
Sbjct: 79  IGVTKVENIGMPLIGGDFTLFNHDGKVVTNEDFKKKFCLIYFGFTYCPDICPQELEKQTI 138

Query: 82  LLKQV-DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
           +++++    G ++   FI+VDPKRDT   +K +   FS++++G++G    + +VAK FR+
Sbjct: 139 VIEKIVKKYGDVITPVFISVDPKRDTLAQVKHYCSSFSNKLVGLTGTKEQIKKVAKLFRV 198

Query: 141 YVNNVLAEKS--------------GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSA 186
           Y N  + +                     Y +DH+    L D  G  V        +   
Sbjct: 199 YYNEHIVDDQTAKTDTKSGDPSNIANNYNYLIDHSIIHYLLDVDGKFVDFFGKNCTTSEM 258

Query: 187 IEKINRLI 194
           +++I+  I
Sbjct: 259 VDRISHYI 266


>gi|255584850|ref|XP_002533141.1| Protein sco1, putative [Ricinus communis]
 gi|223527052|gb|EEF29237.1| Protein sco1, putative [Ricinus communis]
          Length = 251

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/182 (19%), Positives = 78/182 (42%), Gaps = 5/182 (2%)

Query: 16  LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT 75
           L S  Y    +K    ++       L+  D    +         + +FG+T    V P  
Sbjct: 71  LFSFFYYFGGNKCGVDDKGIGGPFTLIDSDNRVVTEQEFLGNWYLFYFGYTFSPDVGPEQ 130

Query: 76  LSRLDRLLKQVDPTGTLLNA-YFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRV 134
           +  + + +  ++          F+T+DP+RDTP  ++ +++ F  RI+G++G    V ++
Sbjct: 131 VQVMAKAIDILEKKKNHKVFPVFVTIDPQRDTPSHLRAYLKEFDSRIVGLTGPVGAVRQM 190

Query: 135 AKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           A+ +R++   V  E     + Y V+ +  + L +    + G    +  ++   E+I + +
Sbjct: 191 AQEYRVFFRKVEEE----GDDYLVECSNYIYLLNPNMEVAGRFGIEYTAEELSEEILKEL 246

Query: 195 TY 196
             
Sbjct: 247 EK 248


>gi|120556186|ref|YP_960537.1| electron transport protein SCO1/SenC [Marinobacter aquaeolei VT8]
 gi|120326035|gb|ABM20350.1| electron transport protein SCO1/SenC [Marinobacter aquaeolei VT8]
          Length = 211

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 88/191 (46%), Gaps = 5/191 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
           ++ ++LL          ++ K + G      +  L+   G   S      +  ++FFGFT
Sbjct: 23  LIASLLLTGCFGNDEEDWNGKNISGLMPEL-EFDLINSQGKSVSGDDYSGRVRMLFFGFT 81

Query: 67  NCSAVCPTTLSRLDRLLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGIS 125
           +C  VCPT L +L+++           +   F++VDPKRDTPE + K+V  F D I+G++
Sbjct: 82  SCPDVCPTALQKLNQVTSGLDPELQDEVLTLFVSVDPKRDTPERLAKYVDFFGDNIVGLT 141

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
           G    +  +AK +R        ++   +  Y V H++A+ +FD  G+   ++      + 
Sbjct: 142 GKEPQLRELAKRYRTTFG---YDEPDADGNYAVSHSSAIYVFDREGNPRLLMRPDLSGEE 198

Query: 186 AIEKINRLITY 196
               +  LI  
Sbjct: 199 IRHDLAALIQE 209


>gi|21231985|ref|NP_637902.1| hypothetical protein XCC2554 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767888|ref|YP_242650.1| hypothetical protein XC_1564 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21113719|gb|AAM41826.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573220|gb|AAY48630.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 216

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 69/185 (37%), Gaps = 3/185 (1%)

Query: 12  LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAV 71
            L       +    +       R      L   DGT      L    ++VF GFT C  V
Sbjct: 26  FLGGTPRSPWPPTQTITFYPQPRPLPQFSLRQSDGTQLVPGELNGHWTLVFLGFTFCPDV 85

Query: 72  CPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPI 129
           CPTTL+ L    +Q +  P        F++VDP+RD P  + ++   F    +  + D  
Sbjct: 86  CPTTLTDLAVAQRQWESVPESLRPRVLFVSVDPQRDPPARLGEYAHAFHKDTLAATADEP 145

Query: 130 DVMRVAKNFRIYVNNVLAEKS-GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIE 188
            + R A         V  +        Y +DH+  + + D  G + G+I    D  +   
Sbjct: 146 SLERFATALGFVFQKVPGKNFAQNPNDYSMDHSAGIAVLDPQGRLAGLIRPPLDPKAIAA 205

Query: 189 KINRL 193
            + +L
Sbjct: 206 DLQQL 210


>gi|119385504|ref|YP_916560.1| electron transport protein SCO1/SenC [Paracoccus denitrificans
           PD1222]
 gi|119375271|gb|ABL70864.1| electron transport protein SCO1/SenC [Paracoccus denitrificans
           PD1222]
          Length = 216

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 53/206 (25%), Positives = 89/206 (43%), Gaps = 20/206 (9%)

Query: 1   MKALG-----IILGTILLAVLGSIAYVSFSSKFVDGNRR------------FNSDVHLVA 43
           M+ +G     +ILG++    +    ++  S    D                  +   L  
Sbjct: 1   MRRMGKDRTILILGSLAAVTVLVTGWLWLSRGEADPFAPCRKDVTQGGLDGLGAPFELTD 60

Query: 44  QDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPK 103
           Q+G   S   +  KP++++FG+T C  VCP   +R    +  ++  G  +   FI+VDPK
Sbjct: 61  QNGRRVSDRQVLAKPALLYFGYTYCPDVCPLDSARNAEAVAMLEEQGMQVTPVFISVDPK 120

Query: 104 RDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTA 163
           RDTPEV++ F     +R+IG++G   ++  V+K +R Y      E     E Y VDH T 
Sbjct: 121 RDTPEVLRDFAGAMHERMIGLTGTAAEIDAVSKAWRNYYKLNDQED---PENYLVDHMTN 177

Query: 164 LLLFDTAGSIVGVIPYKDDSDSAIEK 189
             L       V +   +  +    E+
Sbjct: 178 TYLVIPGSGTVELFGRELSAQDLAER 203


>gi|308047916|ref|YP_003911482.1| electron transport protein SCO1/SenC [Ferrimonas balearica DSM
           9799]
 gi|307630106|gb|ADN74408.1| electron transport protein SCO1/SenC [Ferrimonas balearica DSM
           9799]
          Length = 214

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/212 (21%), Positives = 87/212 (41%), Gaps = 21/212 (9%)

Query: 1   MKAL--GIILGTILLAVLGSIAYVSFSSKFVD------GNRRFNSDVHLVAQDGTDFSLS 52
           MKA    I+L  ++  V G    +   +   +         R   +  L   +G  F  +
Sbjct: 1   MKASNQWIVLLGLVALVAGLSLSLKGPAPRPEVSALWLEQARPLPEFSLTDHNGQPFDRA 60

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPT--GTLLNAYFITVDPKRDTPEVM 110
            L  + S+ F G+T+C  VCPTT+S L R+  +++       +    ++VDP RD PE +
Sbjct: 61  RLEGQWSLFFVGYTSCPDVCPTTMSDLARVYPKLEERLGEKPVQVVLLSVDPGRDDPEKL 120

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
            ++V+ F    + ++G+   +    ++  +    V         +Y VDH+  L+L +  
Sbjct: 121 GQYVEFFRPGFMAVTGEHAQLFPFTQSLGLVYALVDNPN---GGEYLVDHSADLVLINPE 177

Query: 171 GSIVGVIPY--------KDDSDSAIEKINRLI 194
           G+I              K       + +  +I
Sbjct: 178 GAIEAFFRPSGELGTLRKVSMAQLEQDLPVII 209


>gi|296158216|ref|ZP_06841048.1| electron transport protein SCO1/SenC [Burkholderia sp. Ch1-1]
 gi|295891552|gb|EFG71338.1| electron transport protein SCO1/SenC [Burkholderia sp. Ch1-1]
          Length = 189

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 52/185 (28%), Positives = 84/185 (45%), Gaps = 4/185 (2%)

Query: 11  ILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSA 70
            L A+ G                  + D  L   DG   +  S   + S+V+FG+T+C  
Sbjct: 4   ALAALAGCTHRQETWQLTNVTGHLPDLDFTLTGDDGRAVNADSFKGRTSLVYFGYTHCPD 63

Query: 71  VCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD-RIIGISGDPI 129
           VCP T+ RL ++L ++ P    +   FITVDP RDT + +  +V  F      G++G   
Sbjct: 64  VCPETMGRLMQVLGKLGPDAQKVRILFITVDPARDTAQALHDYVGAFDPQHAEGLTGTDW 123

Query: 130 DVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEK 189
            +  +AK +R+       EK      Y V H++A+ +FD+ G    +    D  D+  E 
Sbjct: 124 QIESLAKRYRVAYQM---EKHDPHGNYEVTHSSAVYVFDSQGRARLLATDHDTPDAIAED 180

Query: 190 INRLI 194
           + R+I
Sbjct: 181 LRRII 185


>gi|104779378|ref|YP_605876.1| Sco1/SenC family electron transport protein [Pseudomonas
           entomophila L48]
 gi|95108365|emb|CAK13059.1| putative electron transport protein, Sco1/SenC family [Pseudomonas
           entomophila L48]
          Length = 210

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 90/208 (43%), Gaps = 17/208 (8%)

Query: 2   KALGIILGTILLAVLGSI------------AYVSFSSKFVDGNRRFNSDVHLVAQDGTDF 49
           K + I++  + L +  ++              +  +   +    R   DV +  Q+G   
Sbjct: 6   KTVFILVALVALIMGLTVNKVLSDRGQLNPTELIDAGIILLPQSRTVPDVKMTDQNGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           +L  L  K S++FFG+T C  +CPTTL++L ++  +        L    ++VDP RDTP 
Sbjct: 66  ALDQLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSELPKEAIERLQVVLVSVDPHRDTPN 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F    +G++G   D  ++A    I        K G    Y VDH+  L +  
Sbjct: 126 QLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFIPADTSKPG----YTVDHSGNLAVVG 181

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G   G I    ++   + ++  L+  
Sbjct: 182 PDGRQRGFIRAPFNNQKLVAQLPGLVER 209


>gi|58582886|ref|YP_201902.1| hypothetical protein XOO3263 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84624748|ref|YP_452120.1| hypothetical protein XOO_3091 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188577726|ref|YP_001914655.1| SCO1/SenC superfamily [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|58427480|gb|AAW76517.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84368688|dbj|BAE69846.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188522178|gb|ACD60123.1| SCO1/SenC superfamily [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 216

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 69/185 (37%), Gaps = 3/185 (1%)

Query: 12  LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAV 71
            L    S  +    +       R      L   DGT      L    ++VF GFT C  V
Sbjct: 26  FLGDAPSSPWPPTKTITFYPQPRPLPQFSLRQSDGTQLVPGELNGHWTLVFLGFTFCPDV 85

Query: 72  CPTTLSRLDRLLKQVDPTGT--LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPI 129
           CPTTL+ L    +Q +           F++VDP+RD P  + ++   F    +  + D  
Sbjct: 86  CPTTLTDLAVAQQQWESIPDGLRPRVLFVSVDPQRDPPARLGEYAHAFHKDTLAATADVP 145

Query: 130 DVMRVAKNFRIYVNNVLAEKS-GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIE 188
            + R A         V  +        Y +DH+  + + D  G + G+I    D  +   
Sbjct: 146 ALERFATALGFVFKKVPGKGYAQNPNDYSMDHSAGIAVLDPQGRLAGLIRPPLDPKAIAA 205

Query: 189 KINRL 193
            + +L
Sbjct: 206 DLQQL 210


>gi|71744096|ref|XP_803555.1| electon transport protein SCO1/SCO2 [Trypanosoma brucei TREU927]
 gi|70830843|gb|EAN76348.1| electon transport protein SCO1/SCO2, putative [Trypanosoma brucei]
          Length = 323

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/151 (28%), Positives = 73/151 (48%), Gaps = 3/151 (1%)

Query: 28  FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD 87
                        L+  DG  ++      K   ++FGFTNC  VCP  +++L R+++ +D
Sbjct: 107 DSPEGPSIGGPFSLIGVDGRRYTEKDFLGKWLYIYFGFTNCPDVCPEEMAKLSRVVQHLD 166

Query: 88  PT--GTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
                      FI++DP RDTPE ++ ++  F+ RI+G+ G   +V  VA+ +R+Y   +
Sbjct: 167 KKVGRDYWQPIFISLDPHRDTPEKIRDYLADFNPRILGLVGTQEEVESVARQYRVYFA-L 225

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
             E    E+ Y VDH+  + L +  G     
Sbjct: 226 PDETVLSEDDYLVDHSIIMYLMNPEGKFCDY 256


>gi|308814166|ref|XP_003084388.1| putative SCO1 protein (ISS) [Ostreococcus tauri]
 gi|116056273|emb|CAL56656.1| putative SCO1 protein (ISS) [Ostreococcus tauri]
          Length = 313

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/180 (23%), Positives = 72/180 (40%), Gaps = 15/180 (8%)

Query: 24  FSSKFVDGNRRFNSDVHLVAQ-DGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRL 82
           F +    G         LV   +G  F+  +L  + +I++FGFT+C  VCP  L ++  +
Sbjct: 64  FQTVVAGGKAAVGGAFTLVNAANGKAFTDENLRGRFAILYFGFTHCPDVCPDELEKVAAV 123

Query: 83  LKQ------------VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPID 130
           +                     +   FIT+DP RD    + ++V+ F  ++IG++G    
Sbjct: 124 VDDVDARLREAKEHVDGDDTLTVQPVFITIDPYRDDKRRVAEYVKEFHPKMIGLTGTEKQ 183

Query: 131 VMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
               A+ +R+Y      EK+     Y VDH+    L D  G  V             + I
Sbjct: 184 TADAARKYRVYFRKTGDEKAKS--DYLVDHSIITYLVDPNGDFVTFYGKNTTEKEVADSI 241


>gi|60593905|pdb|1WP0|A Chain A, Human Sco1
 gi|60593906|pdb|1WP0|B Chain B, Human Sco1
 gi|60593907|pdb|1WP0|C Chain C, Human Sco1
          Length = 165

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/156 (26%), Positives = 75/156 (48%), Gaps = 5/156 (3%)

Query: 37  SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN-- 94
               L    G   +      +  +++FGFT+C  VCP  L +  +++ ++D   TL +  
Sbjct: 2   GPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKXIQVVDEIDSITTLPDLT 61

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FI++DP+RDT E +  +V+ FS +++G++G   +V +VA+ +R+Y +    ++   +E
Sbjct: 62  PLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDE---DE 118

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
            Y VDHT    L    G  +               I
Sbjct: 119 DYIVDHTIIXYLIGPDGEFLDYFGQNKRKGEIAASI 154


>gi|53804687|ref|YP_113656.1| SCO1/SenC family protein [Methylococcus capsulatus str. Bath]
 gi|53758448|gb|AAU92739.1| SCO1/SenC family protein [Methylococcus capsulatus str. Bath]
          Length = 220

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 85/195 (43%), Gaps = 7/195 (3%)

Query: 6   IILGTILLAVLGSIAYVSFSSKFVDG----NRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           I   T+ L +     +   +   V G      R  +D  L   DG  F+ + L  + ++V
Sbjct: 25  IAAVTLALGLSAWHEHAERAGALVSGTLLREPRPVADFVLTGDDGRPFTRTDLAGRWTVV 84

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           F G+T+C+ VCPTTLS L     ++   G  L   F++VDP+RDTP+ ++++V+ F    
Sbjct: 85  FVGYTHCADVCPTTLSHLKAARSRLGGEGERLTVLFVSVDPERDTPDSLRRYVRYFDQGF 144

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
              +G    +  + +          A      E Y +DH+  L+L D    +VG +    
Sbjct: 145 RAATGTVEALTALGRQLGFVFFRNSAAD---GEGYGIDHSAELMLLDPKVRLVGYLIPPF 201

Query: 182 DSDSAIEKINRLITY 196
             ++       ++  
Sbjct: 202 RIEALAADFETILGK 216


>gi|149375585|ref|ZP_01893354.1| electron transport protein SCO1/SenC [Marinobacter algicola DG893]
 gi|149359987|gb|EDM48442.1| electron transport protein SCO1/SenC [Marinobacter algicola DG893]
          Length = 222

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 76/168 (45%), Gaps = 5/168 (2%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ 85
           + +V  N R  ++  L+ + G   + +SL  K +  F G+TNC  +CP  ++ L +  K 
Sbjct: 46  NAYVYENSRKLAEFELLNEQGETVTRNSLQGKWTFAFVGYTNCPDICPAAMATLRKTDKI 105

Query: 86  VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
           +           I+ DP+ DTP+ +K +V  F D   G++GD   +  +A++     +  
Sbjct: 106 LPEELPQPEFLLISADPEHDTPQRLKDYVGFFGDDFHGLTGDIETLRALARSMNAVFS-- 163

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
                 V+ +  V+H+    L +  G ++ V+    + +   E    +
Sbjct: 164 ---HRQVDGERLVEHSGHFTLINPDGEMIAVLQPPHNPEDLAEAYREI 208


>gi|221506856|gb|EEE32473.1| SCO1/SenC domain-containing protein, putative [Toxoplasma gondii
           VEG]
          Length = 187

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/173 (24%), Positives = 68/173 (39%), Gaps = 4/173 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           +     G         LV   G             +++FGFT C  +CP  L ++ +++ 
Sbjct: 8   TESDTVGKPLLGGPWTLVDMHGRVRGSEEFEGAYQLLYFGFTFCPDICPQELEKMAQVID 67

Query: 85  Q-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVN 143
                 G ++   FITVDP+RDT   +K + + F  R+IG +G P  +  V + FR+Y N
Sbjct: 68  IIDKEFGEVVQPLFITVDPQRDTVAQVKSYCEEFHPRLIGFTGTPAQIKDVTRKFRVYYN 127

Query: 144 NVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
                    +  Y VDH+         G            +   E+I + I  
Sbjct: 128 E---GIKSSDADYLVDHSIIQYFMGKNGKFKDFFGKNMTVNEIAERIAKHIKQ 177


>gi|188991004|ref|YP_001903014.1| Putative SCO1/SenC family protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732764|emb|CAP50958.1| Putative SCO1/SenC family protein [Xanthomonas campestris pv.
           campestris]
          Length = 216

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 69/185 (37%), Gaps = 3/185 (1%)

Query: 12  LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAV 71
            L       +    +       R      L   DGT      L    ++VF GFT C  V
Sbjct: 26  FLGGTPRSPWPPTQTITFYPQPRPLPRFSLRQSDGTQLVPGELNGHWTLVFLGFTFCPDV 85

Query: 72  CPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPI 129
           CPTTL+ L    +Q +  P        F++VDP+RD P  + ++   F    +  + D  
Sbjct: 86  CPTTLTDLAVAQRQWESVPESLRPRVLFVSVDPQRDPPARLGEYAHAFHKDTLAATADEP 145

Query: 130 DVMRVAKNFRIYVNNVLAEKS-GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIE 188
            + R A         V  +        Y +DH+  + + D  G + G+I    D  +   
Sbjct: 146 SLERFATALGFVFQKVPGKNFAQNPNDYSMDHSAGIAVLDPQGRLAGLIRPPLDPKAIAA 205

Query: 189 KINRL 193
            + +L
Sbjct: 206 DLQQL 210


>gi|110677850|ref|YP_680857.1| SenC protein [Roseobacter denitrificans OCh 114]
 gi|3298367|dbj|BAA31476.1| SenC [Roseobacter denitrificans]
 gi|109453966|gb|ABG30171.1| SenC protein [Roseobacter denitrificans OCh 114]
          Length = 207

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/159 (28%), Positives = 74/159 (46%), Gaps = 4/159 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              LV   G   + + +  +PSI++FG+T C  VCP  ++R    ++ ++  G  +   F
Sbjct: 52  PFELVNAQGETVTDADVITEPSILYFGYTFCPDVCPLDVARNAVAVEVLEENGMSVTPVF 111

Query: 98  ITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYF 157
           I++DPKRDTPEV+  F     +R+IG++G P  V   +  +R Y         G E+ Y 
Sbjct: 112 ISIDPKRDTPEVVGDFAANMHERMIGLTGSPEQVKAASTAYRTYYKAHE----GDEDYYL 167

Query: 158 VDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           VDH+T   L       V     +   +   E +   +  
Sbjct: 168 VDHSTFSYLVLPEHGFVEFFRREVAPEQMAETVACFVEN 206


>gi|254511825|ref|ZP_05123892.1| regulatory protein SenC [Rhodobacteraceae bacterium KLH11]
 gi|221535536|gb|EEE38524.1| regulatory protein SenC [Rhodobacteraceae bacterium KLH11]
          Length = 205

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/206 (21%), Positives = 87/206 (42%), Gaps = 15/206 (7%)

Query: 2   KALGIILGTILLAVLGSIAYVSF-----------SSKFVDGNRRFNSDVHLVAQDGTDFS 50
           +   I+   +L   LG++  ++            SS+   G         L+   G   +
Sbjct: 3   RLYAILATVVLAVGLGAMWLLTRGGSDDRFAQCRSSQIAGGAAAIGGPFELINGKGETVT 62

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
            + +  +P++++FG+T C  VCP  +SR    +  +   G  +   FI++DP RDTPEV+
Sbjct: 63  DTDVITEPTLIYFGYTFCPDVCPFDMSRNAEAIDILAERGQSVTPLFISIDPDRDTPEVV 122

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
             +     +R+I ++G P  V   ++ ++ Y N         +E Y VDH+T   L    
Sbjct: 123 DDYAFNLHERLIALTGSPEQVKAASQAYKTYYNAHDK----SDEYYLVDHSTFTYLVTPE 178

Query: 171 GSIVGVIPYKDDSDSAIEKINRLITY 196
              +      + +    +K+   +  
Sbjct: 179 DGFLEFFKRDETAQQMADKVGCFLDQ 204


>gi|83956114|ref|ZP_00964596.1| hypothetical protein NAS141_02936 [Sulfitobacter sp. NAS-14.1]
 gi|83839680|gb|EAP78859.1| hypothetical protein NAS141_02936 [Sulfitobacter sp. NAS-14.1]
          Length = 331

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 74/184 (40%), Gaps = 10/184 (5%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNR--------RFNSDVHLVAQDGTDFSLS 52
           MK + I L +I+   +        S +                 +D  L   +G      
Sbjct: 1   MKKVRITLWSIVAVAVAIAGGFWVSERGQIPIAAARVSVAESLLADFELTDHNGMMQVDE 60

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKK 112
               +  ++FFG +N    CP +L+ + +++  +   G  +   F TVDP+RD   V+  
Sbjct: 61  DFRGRWILIFFGLSNSPDDCPMSLATIAQVMGDLGAKGEAVQPLFTTVDPERDMLNVLAS 120

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           ++ +F   I+G+SG    +   AK  +I       E     + Y + HT++ LL D    
Sbjct: 121 YIPQFGPNILGLSGPQEQIQHTAKAIKICYQR--TEDEAAPDGYTMRHTSSFLLLDPQCE 178

Query: 173 IVGV 176
            V +
Sbjct: 179 FVRI 182


>gi|170721076|ref|YP_001748764.1| electron transport protein SCO1/SenC [Pseudomonas putida W619]
 gi|169759079|gb|ACA72395.1| electron transport protein SCO1/SenC [Pseudomonas putida W619]
          Length = 202

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 54/174 (31%), Positives = 88/174 (50%), Gaps = 6/174 (3%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           + F       N        L    G D +LSS Y    ++FFGFT C AVCPTTL+R  +
Sbjct: 31  LEFKYGKNMSNEILGRKFRLKDTKGNDVTLSSFYGSMPMIFFGFTQCPAVCPTTLARAAQ 90

Query: 82  LLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
           + KQ       L    FIT+DP+RDTPEV+  +V+ F    + ++G P ++  VAK F++
Sbjct: 91  IRKQLRGRDRDLFQVVFITLDPERDTPEVLDAYVKAFDPSFMALTGTPEEIAEVAKEFKV 150

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +   V A      + Y + H++   ++DT G++   + +  ++    E +  L+
Sbjct: 151 FYEKVPA-----GDTYTISHSSTSYVYDTRGTLRLSLGHSLNAKECAEDLVTLM 199


>gi|298245962|ref|ZP_06969768.1| electron transport protein SCO1/SenC [Ktedonobacter racemifer DSM
           44963]
 gi|297553443|gb|EFH87308.1| electron transport protein SCO1/SenC [Ktedonobacter racemifer DSM
           44963]
          Length = 214

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 38/209 (18%), Positives = 66/209 (31%), Gaps = 28/209 (13%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDG----------------NRRFNSDVHLVAQDGTDFS 50
           +L   +L V+  + Y   S+                              L+ Q G   S
Sbjct: 15  VLSLAVLVVIFVLVYQRVSADKASSVDAPSVTTSGLQGTDLGGAAAPGFTLIDQHGKTVS 74

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
           L+    +P +V F FT C   CP    +L    + +      +    I+ DP+ DTP+  
Sbjct: 75  LADFKGQPVVVTFMFTRCPDQCPLEAQKLHSTFQLLGNDAGHVTMLAISTDPQNDTPQAA 134

Query: 111 KKFVQRF---SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
             F Q           ++G    +  V  N+ +Y N               DH+  + + 
Sbjct: 135 SNFTQAHSLDQSNWHFLTGSSQQLSPVWSNYHVYAN---------SNGNTADHSLGIYVL 185

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           D  G            D     + +L++ 
Sbjct: 186 DKQGHERVFQDTSFTPDQLASNLKKLLSE 214


>gi|170724539|ref|YP_001758565.1| electron transport protein SCO1/SenC [Shewanella woodyi ATCC 51908]
 gi|169809886|gb|ACA84470.1| electron transport protein SCO1/SenC [Shewanella woodyi ATCC 51908]
          Length = 214

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 58/214 (27%), Positives = 94/214 (43%), Gaps = 21/214 (9%)

Query: 2   KALGIILGTIL---LAVLGSIAYVSFSS---------KFVDGNRRFNSDVHLVAQDGTDF 49
           K L +++ TI    L  LG  A + F S          F+    +  +   L  Q G  F
Sbjct: 3   KRLTVVISTIFGLALLGLGVAAAIQFKSHRAEPELATSFIFPTAKKLAPFSLKDQHGNLF 62

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEV 109
           S S L  K S+ F G+T+C  VCPTT+ +L     ++      L   F++VDP+RDT E 
Sbjct: 63  SNSQLADKWSLFFIGYTSCPDVCPTTMGKLSAAYPELLK-DIDLQIIFLSVDPQRDTQEK 121

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           +  ++  F+     I+G+   +  + ++       V     G  E Y VDH+ ++ L   
Sbjct: 122 LLAYMDFFNPEFTAITGEHAQLFPLTRDLGFVYAMV-----GEGENYQVDHSASMALISP 176

Query: 170 AGSIVGVI-PYKDDSDSAIEKI-NRLITY-GNVV 200
            G  V +I P      +  + +   LI+  G +V
Sbjct: 177 EGRKVAIIKPKSSTPGTLPQILTKNLISDIGKIV 210


>gi|119776624|ref|YP_929364.1| electron transport protein SCO1/SenC [Shewanella amazonensis SB2B]
 gi|119769124|gb|ABM01695.1| electron transport protein SCO1/SenC [Shewanella amazonensis SB2B]
          Length = 211

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 82/198 (41%), Gaps = 18/198 (9%)

Query: 1   MKALGIILGTILLAVLGSIAY------------VSFSSKFVDGNRRFNSDVHLVAQDGTD 48
           MK   ++    L+ + G                 +  + +V    +      L  Q G  
Sbjct: 1   MKKSWMMAVFFLVGMGGLTLLINSGDTSDSQTPPTLDTGYVFPAPKPLPPFKLTDQLGQT 60

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPE 108
           F    L  K S++F G+T+C  +CPTT+S+L     ++      L   F++VDP RDTP 
Sbjct: 61  FDNQRLMGKWSLIFLGYTSCPDICPTTMSKLAAAYPEL-NQENSLQVIFLSVDPARDTPT 119

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            + ++   F    + ++G+  ++  + ++  +    V     G    Y VDH+ ++++  
Sbjct: 120 RLAQYAAFFHPDFLAVTGEHSELYSLTRSLGMVYTMV-----GDGPDYQVDHSASIVVIS 174

Query: 169 TAGSIVGVIPYKDDSDSA 186
             G    V   K+D  S 
Sbjct: 175 PKGERYAVFKPKNDGQSI 192


>gi|296115716|ref|ZP_06834342.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295977693|gb|EFG84445.1| electron transport transmembrane protein Sco1/SenC/PrrC
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 222

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 44/167 (26%), Positives = 77/167 (46%), Gaps = 1/167 (0%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
                     L+       +  S + + ++++FG+T+C  VCP TL+ +   L ++   G
Sbjct: 57  PVEEIGGPYTLLDDTNHVVTQQSFHGRYTLLYFGYTHCLDVCPLTLATVTAALDRLGARG 116

Query: 91  TLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKS 150
             +   FI++DP RDTP  +  +V  FS RI G++GDP  +  VA  F + V        
Sbjct: 117 EQVVPVFISIDPARDTPARVHDYVTSFSPRITGLTGDPQAIHAVAAEFHVMV-RPRQATP 175

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYG 197
                Y +DH++ L L D    +V + P    ++    ++  L+  G
Sbjct: 176 ATAGNYQLDHSSMLFLMDGQNHMVSMFPVDSSAEEIATRLRNLLPAG 222


>gi|18420515|ref|NP_568068.1| electron transport SCO1/SenC family protein [Arabidopsis thaliana]
 gi|21593335|gb|AAM65284.1| unknown [Arabidopsis thaliana]
 gi|87116634|gb|ABD19681.1| At4g39740 [Arabidopsis thaliana]
          Length = 276

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/172 (19%), Positives = 77/172 (44%), Gaps = 5/172 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
            S              LV+ +    + +    K  +++FG++    V P  L  + + + 
Sbjct: 105 GSNTTVKGPIIGGPFTLVSTENKIVTENDFCGKWVLLYFGYSFSPDVGPEQLKMMSKAVD 164

Query: 85  QVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVN 143
           +++      +   F+T+DP+RDTP  +  +++ F  RI+G++G    + ++A+ +R+Y  
Sbjct: 165 KLESKHNEKILPVFVTLDPQRDTPSHLHAYLKEFDSRILGLTGTASAMRQMAQEYRVYFK 224

Query: 144 NVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            V  +     E Y VD +  + L +    IV     + + D   +++ + + 
Sbjct: 225 KVQED----GEDYLVDTSHNMYLINPKMEIVRCFGVEYNPDELSQELLKEVA 272


>gi|332175865|gb|AEE25119.1| electron transport protein SCO1/SenC [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 212

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 83/196 (42%), Gaps = 13/196 (6%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           +G ++   +            +    R      L   +G   +  SL  + ++VF G+T 
Sbjct: 16  VGIVIAVNIAPPKSDETQYINLYPQARALPAFSLTDSNGQSLTNESLQSQWTLVFVGYTF 75

Query: 68  CSAVCPTTLSRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGIS 125
           C  +CPTTLS L  +  ++        +   FI+VDP RDT E + +++  F    I  +
Sbjct: 76  CPDICPTTLSDLSSIYPELQAIEGQYPVKVAFISVDPARDTTERLAEYINFFEPDFIAAT 135

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD---- 181
           G+  D+    +   +  +     ++  +E Y VDH+++++L +  G +VG    +     
Sbjct: 136 GEHADLFPFVRAMGMMYS---TSQNTDDENYLVDHSSSVVLVNPQGHVVGRFKPEFAAGK 192

Query: 182 ----DSDSAIEKINRL 193
               DS   +  +  L
Sbjct: 193 VAVSDSKRILHDMKIL 208


>gi|307293607|ref|ZP_07573451.1| electron transport protein SCO1/SenC [Sphingobium chlorophenolicum
           L-1]
 gi|306879758|gb|EFN10975.1| electron transport protein SCO1/SenC [Sphingobium chlorophenolicum
           L-1]
          Length = 213

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 49/195 (25%), Positives = 84/195 (43%), Gaps = 15/195 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGN--------RRFNSDVHLVAQDGTDFSLS 52
           M    I L      +L +    +  +     +            +   L  QDG      
Sbjct: 1   MNKALISLALPFATLLAACNMGAGGNASSGPDNVQGDLHGASIGAPFTLTNQDGKKVRWD 60

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT----LLNAYFITVDPKRDTPE 108
               +  +V+FG+T C  VCP  L R+ +   + +         +    I++DP+RDTP 
Sbjct: 61  DYKGQYRLVYFGYTYCPDVCPVDLQRIMQGFAKFEKDKPALAAKVQPMLISLDPERDTPA 120

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
           V+K +V  F  R+IG++G P ++ +VAK+F +  N    E++     Y V H+    LF 
Sbjct: 121 VLKTYVAAFHPRLIGLTGTPDEIAKVAKDFVVIYNK---EEAKGASDYLVSHSRTPYLFG 177

Query: 169 TAGSIVGVIPYKDDS 183
             G+ V ++P  D +
Sbjct: 178 PDGAPVALVPVDDPA 192


>gi|237831363|ref|XP_002364979.1| SCO1/SenC domain-containing protein [Toxoplasma gondii ME49]
 gi|211962643|gb|EEA97838.1| SCO1/SenC domain-containing protein [Toxoplasma gondii ME49]
 gi|221487170|gb|EEE25416.1| SCO1/SenC domain-containing protein, putative [Toxoplasma gondii
           GT1]
          Length = 184

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/173 (24%), Positives = 68/173 (39%), Gaps = 4/173 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           +     G         LV   G             +++FGFT C  +CP  L ++ +++ 
Sbjct: 5   TESDTVGKPLLGGPWTLVDMHGRVRGSEEFEGAYQLLYFGFTFCPDICPQELEKMAQVID 64

Query: 85  Q-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVN 143
                 G ++   FITVDP+RDT   +K + + F  R+IG +G P  +  V + FR+Y N
Sbjct: 65  IIDKEFGEVVQPLFITVDPQRDTVAQVKSYCEEFHPRLIGFTGTPAQIKDVTRKFRVYYN 124

Query: 144 NVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
                    +  Y VDH+         G            +   E+I + I  
Sbjct: 125 ---EGIKSSDADYLVDHSIIQYFMGKNGKFKDFFGKNMTVNEIAERIAKHIKQ 174


>gi|170696188|ref|ZP_02887322.1| electron transport protein SCO1/SenC [Burkholderia graminis C4D1M]
 gi|170138916|gb|EDT07110.1| electron transport protein SCO1/SenC [Burkholderia graminis C4D1M]
          Length = 219

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 88/200 (44%), Gaps = 9/200 (4%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFV-----DGNRRFNSDVHLVAQ-DGTDFSLSSLYI 56
            + I +  + L +LGS A      +         N+  + D  L    DG   +      
Sbjct: 23  NISIRILCVSLVMLGSCALAGCQREEPWRLTMVDNQMPSLDFTLTRAKDGRTVTSKDYRG 82

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           +  ++ FG+T C  VCPTTLS L   L ++      +   F+TVDP RDT + +K++   
Sbjct: 83  QIVVLEFGYTFCPDVCPTTLSNLTAALTRLGDKAKAVRVLFVTVDPDRDTLDSLKRYEAA 142

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           FS ++ G+ G    +  +A  +R+  +   ++      +Y V H++ + +FD  G I  +
Sbjct: 143 FSPQVDGLRGTESQLEYLAHRYRVAYSVSPSKD---PGEYQVMHSSIIFIFDKTGRIKLL 199

Query: 177 IPYKDDSDSAIEKINRLITY 196
               D+       + +L+  
Sbjct: 200 STNPDNVGDLAHDLGQLVDE 219


>gi|255602138|ref|XP_002537822.1| sco1/senc, putative [Ricinus communis]
 gi|223514942|gb|EEF24561.1| sco1/senc, putative [Ricinus communis]
          Length = 337

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/155 (27%), Positives = 69/155 (44%), Gaps = 5/155 (3%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ 85
                   R   D  L    G   +LS    K   + FGFT+C AVCPTTL+ L  +  +
Sbjct: 172 KSGEFSPPRMAPDFTLQGSTGKPLTLSDYRGKVVALGFGFTSCPAVCPTTLAELAAVRTK 231

Query: 86  VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
           +   G      ++TVDP+RDT + M+ ++  F    +G +G    +  V K + +     
Sbjct: 232 LGAQGKDFQVVYVTVDPERDTADRMRPYLTAFDPTFVGATGPAAQLAEVRKAYGVTAVR- 290

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
               +G    Y  +H++ + L D +G +  + PY 
Sbjct: 291 ----TGSGANYGFNHSSFVYLVDRSGKLRALSPYG 321


>gi|209517205|ref|ZP_03266050.1| electron transport protein SCO1/SenC [Burkholderia sp. H160]
 gi|209502341|gb|EEA02352.1| electron transport protein SCO1/SenC [Burkholderia sp. H160]
          Length = 226

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 51/195 (26%), Positives = 87/195 (44%), Gaps = 4/195 (2%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFG 64
            +     L A+ G                  + D  L    G   S ++   + S+V+FG
Sbjct: 35  TLGTLIALAALTGCTQRAEPWQLTNVTGHLPDLDFTLTDDAGRPVSAAAFKGRASLVYFG 94

Query: 65  FTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS-DRIIG 123
           +T+C  VCP T+ RL ++L ++ P    +   FITVDP RDTP+ +  +V  F      G
Sbjct: 95  YTHCPDVCPETMGRLMQVLGKLGPDAQKVRILFITVDPARDTPQALHDYVGAFDAQHAEG 154

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           ++G    +  +AK +R+       EK      Y V H++A+ +FD+ G    +    D  
Sbjct: 155 LTGTDSQIESLAKRYRVAYQM---EKRDPNGSYEVTHSSAVYVFDSQGHARLLATDHDTP 211

Query: 184 DSAIEKINRLITYGN 198
           D+  + + R+I   +
Sbjct: 212 DAIAQDLRRVIDDQS 226


>gi|325188069|emb|CCA22612.1| SCO1 family protein putative [Albugo laibachii Nc14]
          Length = 274

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 81/205 (39%), Gaps = 16/205 (7%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFV-----------DGNRRFNSDVHLVAQD-GTDFSL 51
           +      +   V   + Y  F+ K              G         LV  D     + 
Sbjct: 68  ITWTGLALATIVGSGVVYYYFNEKDRLQTQTTTKVVSVGKPLLGGPWTLVDCDTRRAVTD 127

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEV 109
           +S   +  +++FGFT+C  +CP  L R+  +L   + DP    +   F+TVDP+RD+   
Sbjct: 128 ASFRGQHLLLYFGFTHCPDICPNELVRIGNVLDNLKRDPKCPDVLPLFVTVDPRRDSIVQ 187

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN--VLAEKSGVEEKYFVDHTTALLLF 167
           M+ + Q F   +  ++G P  V  + + +R++ +      E    +E Y VDH+  + L 
Sbjct: 188 MQAYKQDFHPSMKMLTGTPDQVRDITRAYRVFFSKATETEENDDEDEDYLVDHSIVMYLV 247

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINR 192
              G  +            +EKI  
Sbjct: 248 GPDGEFLDFFTQSARVSDIVEKIKS 272


>gi|295677159|ref|YP_003605683.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1002]
 gi|295437002|gb|ADG16172.1| electron transport protein SCO1/SenC [Burkholderia sp. CCGE1002]
          Length = 208

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 83/191 (43%), Gaps = 4/191 (2%)

Query: 9   GTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNC 68
              L  + G                  + D  L    G     +S   + S+V+FG+T+C
Sbjct: 21  LVALATLTGCTQRAEPWRLTNVTGHLPDLDFRLTDDTGRPVDAASFKGRTSLVYFGYTHC 80

Query: 69  SAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS-DRIIGISGD 127
             VCP T+ RL ++L ++ P    +   FITVDP RDTP  +  +V  F      G++G 
Sbjct: 81  PDVCPETMGRLVQVLGKLGPEAQKVRILFITVDPARDTPRALHDYVGAFDAKHAEGLTGT 140

Query: 128 PIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAI 187
              +  +AK +R+       EK      Y V H++A+ +FD+ G    +    D  D+  
Sbjct: 141 DWQIESLAKRYRVAYQM---EKRDPNGNYEVTHSSAVYVFDSQGRARLLATDHDTPDAIA 197

Query: 188 EKINRLITYGN 198
           + + R+I   +
Sbjct: 198 QDLRRIIDDQS 208


>gi|88607263|ref|YP_505606.1| major surface protein 5 [Anaplasma phagocytophilum HZ]
 gi|88598326|gb|ABD43796.1| major surface protein 5 [Anaplasma phagocytophilum HZ]
          Length = 209

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 22/198 (11%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVD--------------GNRRFNSDVH-LVAQD 45
           MK    +   +LL     + Y   + K +                     +    L+ Q+
Sbjct: 1   MKTFKTVSNLLLLVATVFLGYSYVNKKGIFSDMGAKLSSTDTVVEQAPILASFTDLINQE 60

Query: 46  GTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRD 105
           G   S +    K  ++ FGF++C  +CP  L  + +LL ++  T   L A FIT+DPK D
Sbjct: 61  GQVVSSTDFAGKHMLLMFGFSSCKHICPAELGMVSQLLNKLGETADKLQAVFITIDPKND 120

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALL 165
           T E + ++ + F  RI  ++GD   +  V  N+++YV          + +  ++H++ L 
Sbjct: 121 TVERLNEYHKAFDSRIQMLTGDEEVIRNVVNNYKVYV-------GESDSEGDINHSSFLY 173

Query: 166 LFDTAGSIVGVIPYKDDS 183
           L D  G  VG      D 
Sbjct: 174 LVDADGRYVGHFAPDFDE 191


>gi|298485197|ref|ZP_07003291.1| Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative
           copper metallochaperone [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160309|gb|EFI01336.1| Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative
           copper metallochaperone [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 219

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 50/208 (24%), Positives = 91/208 (43%), Gaps = 18/208 (8%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFN-------------SDVHLVAQDGTDF 49
               I   I+  VLG I          +G    N               + +  Q+G   
Sbjct: 15  KTVFIAAAIVALVLGLILSQLLPGSGSEGQAALNDAGIVLLPKSRQLPALSMSDQNGAAV 74

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           +L  L  K +++FFG+T C  +CPTTL+++ ++  +  +     +    ++VDP+RDTP+
Sbjct: 75  ALDDLKGKWTLMFFGYTFCPDICPTTLAQIKQIRTELPEKVVERMRVVLVSVDPERDTPQ 134

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F  + IG++    D+  +A    I        K      YFVDH+  L L  
Sbjct: 135 QLKQYLGYFDPQYIGLTAPVADIQTLANAVSIPFIPADTSK----ANYFVDHSGNLALIG 190

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G+  G I    ++   ++++ RL+  
Sbjct: 191 PDGTQRGFIRAPLNNQKLVKQLPRLLER 218


>gi|325915514|ref|ZP_08177825.1| hypothetical protein SCO1/SenC/PrrC [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538230|gb|EGD09915.1| hypothetical protein SCO1/SenC/PrrC [Xanthomonas vesicatoria ATCC
           35937]
          Length = 216

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/185 (22%), Positives = 67/185 (36%), Gaps = 3/185 (1%)

Query: 12  LLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAV 71
                    +    +       R      L   DGT      L    ++VF GFT C  V
Sbjct: 26  FFGGAPRSPWPPTQTITFYPQPRPLPQFSLRQSDGTQLVPGELNGHWTLVFLGFTFCPDV 85

Query: 72  CPTTLSRLDRLLKQVDPTGT--LLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPI 129
           CPTTL+ L    +Q +           F++VDP+RD P  + ++   F    +  + D  
Sbjct: 86  CPTTLTDLAVAQQQWESIPDGLRPRLLFVSVDPQRDPPARLGEYAHAFHKDTLAATADVP 145

Query: 130 DVMRVAKNFRIYVNNVLAEKSG-VEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIE 188
            + R A         V  +        Y +DH+  + + D  G + G+I    D  +   
Sbjct: 146 ALQRFATALGFVFQKVPGKNFDQNPNDYSMDHSAGIAVLDPQGRLTGLIRPPLDPKAIAA 205

Query: 189 KINRL 193
            + +L
Sbjct: 206 DLQQL 210


>gi|254515979|ref|ZP_05128039.1| hypothetical protein NOR53_3187 [gamma proteobacterium NOR5-3]
 gi|219675701|gb|EED32067.1| hypothetical protein NOR53_3187 [gamma proteobacterium NOR5-3]
          Length = 223

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 52/196 (26%), Positives = 86/196 (43%), Gaps = 16/196 (8%)

Query: 3   ALGIILGTILLAVLGSI-----------AYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSL 51
            + ++L  +L+ V G I             +  +  ++    R   D  L+   G  F+ 
Sbjct: 19  TVVLVLTFMLIVVAGFIHRIGQPRLMSDGELQANGLYLMDPPRDFGDFALMDHRGEPFTP 78

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVM 110
           +SL  + +++FFGFT C  +CPTT++ LD+ + Q             I+VDP RDT E +
Sbjct: 79  ASLKDQWTLLFFGFTYCPDICPTTMAFLDQFVGQLEGTEAKDTQVVMISVDPARDTVEQL 138

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
             +V  F+    G++G+ +DV R A         V    +G  E Y VDH+  ++L +  
Sbjct: 139 ATYVPYFNKDFTGVTGEFLDVFRFATALNTPFRKV----AGQGEDYQVDHSANVVLINPR 194

Query: 171 GSIVGVIPYKDDSDSA 186
           G   G      D    
Sbjct: 195 GHYHGFFKAPLDLAKM 210


>gi|241601922|ref|XP_002405071.1| cytochrome C oxidase assembly protein, putative [Ixodes scapularis]
 gi|215500565|gb|EEC10059.1| cytochrome C oxidase assembly protein, putative [Ixodes scapularis]
          Length = 149

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 39/151 (25%), Positives = 79/151 (52%), Gaps = 5/151 (3%)

Query: 45  DGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKR 104
           +G   +++    K  ++FFGFT C  VCPT L+R   + +Q+   G  L   FI++DP+R
Sbjct: 1   EGQRRTMADYRGKIVLIFFGFTQCPDVCPTALTRAVEIKEQLGEDGDKLQVLFISIDPER 60

Query: 105 DTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTAL 164
           DTPE+++ ++Q F    + +     ++ + A +F+++   V          Y +DH+   
Sbjct: 61  DTPELLRAYMQAFDPGFVALRPTEEELAKTASDFKVFYQKVP-----TGSSYTMDHSALT 115

Query: 165 LLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            ++DT G +   + +   ++ A+  I +++ 
Sbjct: 116 YVYDTQGKLQIALRHTQTAEEAVADIRQVLA 146


>gi|325913866|ref|ZP_08176225.1| hypothetical protein SCO1/SenC/PrrC [Xanthomonas vesicatoria ATCC
           35937]
 gi|325539941|gb|EGD11578.1| hypothetical protein SCO1/SenC/PrrC [Xanthomonas vesicatoria ATCC
           35937]
          Length = 153

 Score =  104 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 47/157 (29%), Positives = 81/157 (51%), Gaps = 5/157 (3%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
           D +L   +GT   L S   +  ++FFGFT+C  VCPTTL+R  ++ +++      +   F
Sbjct: 2   DFYLYDTEGTPRPLRSFRGRALVLFFGFTHCPDVCPTTLARAAQVKRKLGADAAKVQFAF 61

Query: 98  ITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYF 157
            T+DP+RD P V++ +V+ F    IG++G   D+   A N ++    V      +   Y 
Sbjct: 62  ATLDPQRDKPNVLRTYVRAFDPDFIGLTGSEGDIRVAAGNLKVSYAKVP-----MGPTYT 116

Query: 158 VDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +DH+T   LFD  G +   + +    DS +  I +++
Sbjct: 117 IDHSTRSFLFDRDGQLRVGLAHAQTVDSVVHDIRQVL 153


>gi|163857336|ref|YP_001631634.1| SCO1/SenC/PrrC family protein [Bordetella petrii DSM 12804]
 gi|163261064|emb|CAP43366.1| SCO1/SenC/PrrC family protein [Bordetella petrii]
          Length = 204

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 45/192 (23%), Positives = 94/192 (48%), Gaps = 1/192 (0%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
              ++L +  L         +++   + G+   +    L    G   S   L  K  ++F
Sbjct: 10  WRALLLASCTLLAACGDKAANWTLYDIKGHLP-DLSFQLDGAGGKKVSSDDLQGKTVLLF 68

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+ +C  +CPTT+++L  +L+Q+      +   F++VDP RDTP++++ +V  F+++ I
Sbjct: 69  FGYASCPDICPTTMAQLTAVLQQLGEQADKVRIVFVSVDPHRDTPDILQAYVDAFNNKAI 128

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
           G++G+   +  +A+ +R+             + Y V H+  + +FD AG    +    D 
Sbjct: 129 GVTGNEKQIADLARRYRVAYQIEKPRPGDAADVYDVTHSRGVYIFDNAGKARLLASDTDS 188

Query: 183 SDSAIEKINRLI 194
            D+ ++ + +LI
Sbjct: 189 IDAIVKDLRQLI 200


>gi|88810237|ref|ZP_01125494.1| Electron transport protein SCO1/SenC [Nitrococcus mobilis Nb-231]
 gi|88791867|gb|EAR22977.1| Electron transport protein SCO1/SenC [Nitrococcus mobilis Nb-231]
          Length = 205

 Score =  104 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 47/194 (24%), Positives = 95/194 (48%), Gaps = 4/194 (2%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           + + +++G +LL    + +   F    + G++   +       +G   +   L  K   +
Sbjct: 13  REILMLVGVLLLTAC-NPSPHEFRLTDISGSQAKLALFKAPTAEGKRLTAEDLRGKIVAL 71

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
            FG+T+C  +CPT+L++L  +++++      L   F+TVDPKRDTP V+++++  F+ R 
Sbjct: 72  SFGYTHCPDICPTSLAKLQAVVQRLGEAADDLRVVFVTVDPKRDTPAVLERYIHSFNPRF 131

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           I +  DP  + ++   + +  +     +      Y V+HT+ LL+FD  G +  +  + D
Sbjct: 132 IALRPDPEALPKLTSRYHLTYS---YGEPDAAGNYPVNHTSTLLIFDQTGRMRLMGRHDD 188

Query: 182 DSDSAIEKINRLIT 195
           +       I  LI 
Sbjct: 189 NPKDIAGDIAYLIN 202


>gi|163748819|ref|ZP_02156071.1| SCO1/SenC family protein [Shewanella benthica KT99]
 gi|161331593|gb|EDQ02398.1| SCO1/SenC family protein [Shewanella benthica KT99]
          Length = 230

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 49/180 (27%), Positives = 79/180 (43%), Gaps = 15/180 (8%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ 85
           S FV    +  +   L  Q G  F+ S L  K S+ F G+T+C  VCPTT+ +L     +
Sbjct: 50  SSFVFPIAKPLAPFSLTDQYGNAFTNSQLNDKWSLFFIGYTSCPDVCPTTMGKLTAAYPK 109

Query: 86  VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
           +      L   F++VDP+RDT   +  ++  F+   I I+G+   +  + ++       +
Sbjct: 110 LLENA-DLQVIFLSVDPQRDTQAKLLSYMNFFNPEFIAITGEHAQLFPLTRDLGFVYAMI 168

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS---------DSAIEKINRLITY 196
                G EE Y VDH+ ++ L    G+ V +I  K             + I  I  LI  
Sbjct: 169 -----GEEEDYLVDHSASMALISPDGNKVAIIKPKSSVPGKLPLISNKNLIADIRTLIAN 223


>gi|294010042|ref|YP_003543502.1| uncharacterized protein Sco1 [Sphingobium japonicum UT26S]
 gi|292673372|dbj|BAI94890.1| uncharacterized protein Sco1 [Sphingobium japonicum UT26S]
          Length = 218

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 52/194 (26%), Positives = 83/194 (42%), Gaps = 15/194 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGN--------RRFNSDVHLVAQDGTDFSLS 52
           M    I L     A+L +    +  +     +            +   L  QDG      
Sbjct: 6   MNKALISLTLPFAALLAACNMGAGGNASSGDDSAQGDLHGASIGAPFTLTDQDGKKVRWD 65

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT----LLNAYFITVDPKRDTPE 108
               +  +V+FG+T C  VCP  L R+ +   + +         +   FI+VDP RDTP 
Sbjct: 66  DFKGRYRLVYFGYTYCPDVCPVDLQRILQGFAKFEKAKPALAARVQPIFISVDPDRDTPA 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
           V+K +V  F  R+IG++G P ++ +VAK+F +  N    E++     Y V H+    LF 
Sbjct: 126 VLKTYVAAFHPRLIGLTGTPDEIAKVAKDFVVLYNK---EEAKGASGYLVSHSRTPYLFG 182

Query: 169 TAGSIVGVIPYKDD 182
             G  V ++P  D 
Sbjct: 183 GDGEPVALVPVDDP 196


>gi|294085442|ref|YP_003552202.1| electron transport protein SCO1/SenC [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665017|gb|ADE40118.1| electron transport protein SCO1/SenC [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 221

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 54/200 (27%), Positives = 90/200 (45%), Gaps = 11/200 (5%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFN----SDVHLVAQDGTDFSLSSLYIK 57
           +   +I+G +L A L    ++  + +       F     S   L+ Q+    + +    +
Sbjct: 25  RPFLLIVGILLFAGLAGGIFMLANRQAETSGLGFPDFEDSSFTLLDQNAQKVANADFAGR 84

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT---LLNAYFITVDPKRDTPEVMKKFV 114
           P  +FFG++ C  VCP TL+ L   L +V   G     L   F+TVDP+RDTPE +  ++
Sbjct: 85  PIALFFGYSYCPDVCPMTLTVLGSALDEVKAAGMSGDDLQILFMTVDPERDTPEQLAAYL 144

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F  ++ G++GD   V +   NF  Y   V             DH++A+ L+   G   
Sbjct: 145 SLFDMKVTGLTGDKTSVAKALGNFGAYAQQVET----SSGDILFDHSSAVYLYRANGKFK 200

Query: 175 GVIPYKDDSDSAIEKINRLI 194
           G I Y +     +EKI  ++
Sbjct: 201 GTIVYNEPHRFVVEKIKSIL 220


>gi|294675601|ref|YP_003576216.1| electron transport protein SenC [Rhodobacter capsulatus SB 1003]
 gi|294474421|gb|ADE83809.1| electron transport protein SenC [Rhodobacter capsulatus SB 1003]
          Length = 221

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 70/174 (40%), Gaps = 4/174 (2%)

Query: 21  YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLD 80
           + +        + +      L+++ G   +   +  KPS+V+FG++ C  VCP   +R  
Sbjct: 36  FAACRKGTGSASAQIGGPFTLISETGATVTDRDVITKPSLVYFGYSYCPDVCPIDSTRNA 95

Query: 81  RLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
             +  +   G  +   FI+VD  RDTP V+ +F    S ++IG++G P  +    K +R 
Sbjct: 96  AAVDLLAERGHDVTPVFISVDAARDTPPVLTEFTDLMSPKMIGLTGTPEQIDAAVKAYRA 155

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           Y                VDH+T   L D     +         +   + +   +
Sbjct: 156 YYLIRNPGDPAT----LVDHSTQTYLMDPKLGFLDFYDRDATPEMVADSVGCFL 205


>gi|269836071|ref|YP_003318299.1| electron transport protein SCO1/SenC [Sphaerobacter thermophilus
           DSM 20745]
 gi|269785334|gb|ACZ37477.1| electron transport protein SCO1/SenC [Sphaerobacter thermophilus
           DSM 20745]
          Length = 232

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 82/222 (36%), Gaps = 30/222 (13%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGN---RRFNSDVHLVAQDGTDFSLSSLYIKP 58
           + +G  L  +L   L ++      S+ + G    +    D  L    G   SLS L  K 
Sbjct: 9   RRIGPTLTLVLFLGLVTLLAACGGSRELTGTDLGQEPAPDFTLTDHRGQTVSLSQLRGKA 68

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             + F +T+C  +CP     L +  +Q  +     +    ITVDP RDTPEV++++ +R 
Sbjct: 69  VALTFIYTHCPDICPLITQHLRQAYEQLPEDAQERVALVAITVDPARDTPEVLQEYSERH 128

Query: 118 ----SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKS----------------------G 151
               +     ++ D   +  V  ++ +    ++A+                         
Sbjct: 129 GLAENPAWFALTADAATLEPVWASYYVDSGAMMADDHAGADAHGGQGEHGDHADHEATPA 188

Query: 152 VEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
             +     HT A+ L D  G+   ++      +   + +  L
Sbjct: 189 AGDGQQFTHTDAIFLIDRDGNWRVLLRSGTPPEEIADNLEIL 230


>gi|71907473|ref|YP_285060.1| electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
 gi|71847094|gb|AAZ46590.1| Electron transport protein SCO1/SenC [Dechloromonas aromatica RCB]
          Length = 185

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/170 (24%), Positives = 78/170 (45%), Gaps = 5/170 (2%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ 85
            +  D      +D  L A DG      +L  K  +V+FG+TNC  +CP +L+   + LK 
Sbjct: 20  QQARDPKLPAGADFVLQAADG-PVDSKALRGKVLLVYFGYTNCPDICPASLAAGGQALKA 78

Query: 86  -VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
                 + +    I+VDP+RDT + +K++   F   +IG++G   ++  + K +      
Sbjct: 79  LSSEERSRVKLIMISVDPERDTIKHLKEYTAFFHPEMIGVTGSIEEIAALTKAYGAGYMK 138

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              +    +  Y VDHTT+  +    G +  V+     +D  +  + +L+
Sbjct: 139 ---QAKRTDGSYAVDHTTSTYVVGPDGKLSSVLELGASTDKVVAAVRKLL 185


>gi|119775815|ref|YP_928555.1| electron transport protein SCO1/SenC [Shewanella amazonensis SB2B]
 gi|119768315|gb|ABM00886.1| electron transport protein SCO1/SenC [Shewanella amazonensis SB2B]
          Length = 219

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/175 (22%), Positives = 76/175 (43%), Gaps = 14/175 (8%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLL 93
              D  + +  GT  +LS    K  ++FFG+TNC+ +CPTT++ + +L++++       +
Sbjct: 40  IGGDFSMQSSKGTQVNLSDFRGKVVMMFFGYTNCADICPTTMAHISQLMQKMPAEERARI 99

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              F+++D   DTP+ + K++  F    IG+  +   +  VA  +    + +  +K   E
Sbjct: 100 QVLFVSIDSDYDTPKHLNKYLSYFDPSFIGLVDERAKIDEVAAMYHADYSKLADDKVTTE 159

Query: 154 -------------EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                        + Y   HT  + + D  G + G        D     I+ L+ 
Sbjct: 160 YKKLSLERQGSAGKGYLYSHTAKIFVLDPEGRVRGFFYTGTPLDEMQADISSLLN 214


>gi|254295369|ref|YP_003061392.1| electron transporter SCO1/SenC [Hirschia baltica ATCC 49814]
 gi|254043900|gb|ACT60695.1| electron transport protein SCO1/SenC [Hirschia baltica ATCC 49814]
          Length = 234

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/205 (23%), Positives = 79/205 (38%), Gaps = 14/205 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNR----------RFNSDVHLVAQDGTDFS 50
           MK   +     +  ++ +    + SS                      + LV   G   +
Sbjct: 29  MKKSLLTSALAVTLLVSACGPNNNSSSAGSSGGGSTCASRAYENIGGPISLVDHTGAPVT 88

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVM 110
                 K ++V+FGFTNC  VCP TLS +   +  +           I+VDP++DTPE +
Sbjct: 89  QEDYKGKETLVYFGFTNCPDVCPFTLSVVGAAMDLLPADVEKPRTLLISVDPEQDTPEAL 148

Query: 111 KKFV--QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            ++V    F D +IG++G P  +   A  F+     + A  S +   Y +DH + L L D
Sbjct: 149 AQYVESNGFPDELIGLTGTPEAIKAAADEFKTSYKRIDAPDSTMG--YTMDHLSILYLMD 206

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRL 193
               +      +         I  L
Sbjct: 207 KDWKLKTFFTSEAAPKDVAGCITEL 231


>gi|149578234|ref|XP_001520199.1| PREDICTED: hypothetical protein, partial [Ornithorhynchus anatinus]
          Length = 163

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/159 (28%), Positives = 80/159 (50%), Gaps = 5/159 (3%)

Query: 39  VHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAY 96
            +L  Q G       L     +++F FT+C  VCP  L++L   ++  + DP+   +   
Sbjct: 1   FNLSVQSGRRRGKRDLRGWWVMLYFDFTHCPDVCPEELAKLAAAMRRLEADPSLPPVQPV 60

Query: 97  FITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           F+TVDP+RD P  + ++V+ F  R++G++G P  V RVA+++R+Y +    ++   +  Y
Sbjct: 61  FVTVDPERDDPAALGRYVRDFHPRLLGLTGTPEQVRRVARSYRVYYSAGPKDE---DRDY 117

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            VDHT  + L D  G  V         +   + + R + 
Sbjct: 118 IVDHTVVIYLLDPDGLFVDYYGRGKTDEQIADSVRRHMA 156


>gi|89056550|ref|YP_512001.1| electron transport protein SCO1/SenC [Jannaschia sp. CCS1]
 gi|88866099|gb|ABD56976.1| Electron transport protein SenC [Jannaschia sp. CCS1]
          Length = 210

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 66/152 (43%), Gaps = 3/152 (1%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              LV++ G   + + +  +P++++FG+T C  VCP    R    +  ++  G  +   F
Sbjct: 53  PFELVSETGEAVTDADVITEPTLMYFGYTFCPDVCPLDTVRNAEAVDILEENGHSVLPTF 112

Query: 98  ITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYF 157
           +TVDP RDTPEV+  F      R++G++G        A  +R+Y         G +  Y 
Sbjct: 113 VTVDPNRDTPEVVAAFTDNVHPRMLGLTGTEEQTHAAASAYRVYYQ---NHDDGTDPYYL 169

Query: 158 VDHTTALLLFDTAGSIVGVIPYKDDSDSAIEK 189
           VDHT    L       V          +  E+
Sbjct: 170 VDHTAFTYLMMPEVGFVEFFNRDVTPTAMAER 201


>gi|149911125|ref|ZP_01899751.1| SCO1/SenC family protein [Moritella sp. PE36]
 gi|149805802|gb|EDM65792.1| SCO1/SenC family protein [Moritella sp. PE36]
          Length = 216

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 50/218 (22%), Positives = 93/218 (42%), Gaps = 27/218 (12%)

Query: 1   MKALG--IILGTILLAVLGSIA--------YVSFSSKFVDGNRRFNSDVHLVAQDGTDFS 50
           MK     I  G I L+ LG++           +F++ +    +    DV L   +    +
Sbjct: 1   MKKSKAIIAAGIIGLSALGAMVANNMQQPSLPTFTTAYAQPQQVTLPDVVL--GNNQAHT 58

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEV 109
            +    K S+VFFG+ +C  VCPT L  L+ +   +     T+    FI+VDP+RD+ E+
Sbjct: 59  SALFKDKWSLVFFGYASCPDVCPTELYNLNNVASIMTTAGKTMPQVVFISVDPQRDSNEM 118

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGV--------------EEK 155
           +  + Q ++D  IGI+G+  ++ ++  +F +         +G                E 
Sbjct: 119 LTSYAQFYNDEFIGITGETSEIDKLVASFGVIYQKTFLANNGQYVSVPYSSPIPEDQRES 178

Query: 156 YFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
           Y ++H++ L L +  G  V        +      + +L
Sbjct: 179 YLINHSSRLYLVNPEGQYVAAFAPPHSAKKIAADLLKL 216


>gi|91794872|ref|YP_564523.1| electron transport protein SCO1/SenC [Shewanella denitrificans
           OS217]
 gi|91716874|gb|ABE56800.1| electron transport protein SCO1/SenC [Shewanella denitrificans
           OS217]
          Length = 217

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 50/220 (22%), Positives = 88/220 (40%), Gaps = 29/220 (13%)

Query: 1   MKALGIILGTILLAVLGSIAY-------------VSFSSKFVDGNRRFNSDVHLVAQDGT 47
           MK L  I+  ILL  +G  A              ++ SS ++    R  +   L  Q G 
Sbjct: 1   MKKL--IISFILLFGIGGAALVALSPSKAVNTSPLTLSSGYLFEQPRGLAPFSLEDQSGA 58

Query: 48  DFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGT-LLNAYFITVDPKRDT 106
           +F+ +    K S+VF G+T+C  VCPTTLS+L  L  ++       +   F++ DP RDT
Sbjct: 59  EFTQADFAGKWSLVFVGYTSCPDVCPTTLSKLAALFPKLQAVSKVPVQVVFVSADPARDT 118

Query: 107 PEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLL 166
            +    ++  F+     ++     +   +++       V     G  + Y VDH+ + +L
Sbjct: 119 QQKRLDYINFFNSEFKAVTAPHAKLFPFSRDLGFAYAMV-----GDGDDYQVDHSASYVL 173

Query: 167 FDTAGSIVGVIPYK--------DDSDSAIEKINRLITYGN 198
               G    V   K         D    +  + ++    +
Sbjct: 174 VSPKGEKFAVFKPKPVLGQMGQIDHKELLADLEQIFNRYS 213


>gi|157373330|ref|YP_001471930.1| electron transport protein SCO1/SenC [Shewanella sediminis HAW-EB3]
 gi|157315704|gb|ABV34802.1| electron transport protein SCO1/SenC [Shewanella sediminis HAW-EB3]
          Length = 218

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 97/221 (43%), Gaps = 30/221 (13%)

Query: 2   KALGIILGTILLAVLGSIAYVS---------------FSSKFVDGNRRFNSDVHLVAQDG 46
           K L  ++  +L  V+  +   +                S+ FV    +      L+ Q G
Sbjct: 3   KRLTRVVAALLAVVIVGLGSFTALQFQSMSEEVSQIELSNSFVYPTPKRLPQFKLMEQHG 62

Query: 47  TDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDT 106
           T F+ + L  K S+ F G+T+C  VCPTT+++L     ++  +   +   F++VDP+RDT
Sbjct: 63  TSFTNADLKGKWSLFFIGYTSCPDVCPTTMAKLTAAYPELLESA-DIQVIFLSVDPQRDT 121

Query: 107 PEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLL 166
            + +  ++  F+ + I ++GD   +  + ++       V     G  E Y +DH+ ++ L
Sbjct: 122 QDKLLNYMDFFNPKFIALTGDHTQLFPLTRSLGFVYAMV-----GDGENYQIDHSASMAL 176

Query: 167 FDTAGSIVGVIPYKDD---------SDSAIEKINRLITYGN 198
               G  + +I  K           S + I  I+++I   N
Sbjct: 177 ISPEGENIAIIKPKSSTPGTLPQITSQALISDIHQIIQRKN 217


>gi|152975437|ref|YP_001374954.1| electron transport protein SCO1/SenC [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152024189|gb|ABS21959.1| electron transport protein SCO1/SenC [Bacillus cytotoxicus NVH
           391-98]
          Length = 194

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 49/201 (24%), Positives = 79/201 (39%), Gaps = 15/201 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    ++G I++     +A     SK              + QDG  F    L  K  +
Sbjct: 1   MKRYQKLIGLIVVFCFFILAGCGSGSKLRKPLNWDLETFQYINQDGKQFGTKDLKGKVWV 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD- 119
             F FTNC  VCP   + + +L K        +     +VDP+ D PE +K F+Q+F+D 
Sbjct: 61  ADFMFTNCQTVCPPMTANMAKLQKMAKEQKLDVQFVSFSVDPEVDKPENLKTFIQKFTDD 120

Query: 120 --RIIGISG-DPIDVMRVAK-NFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                 ++G    D+ + +K NF+  V           E   V H T+  L D  G ++ 
Sbjct: 121 TSNWNLLTGYSLEDIKKFSKENFQALVEK--------PENGQVVHVTSFYLIDQNGKVMK 172

Query: 176 VIPY--KDDSDSAIEKINRLI 194
                     +  +  + RL+
Sbjct: 173 KYSGISNTPYEDILRDMKRLL 193


>gi|254784351|ref|YP_003071779.1| ggdef [Teredinibacter turnerae T7901]
 gi|237684482|gb|ACR11746.1| ggdef [Teredinibacter turnerae T7901]
          Length = 221

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/172 (24%), Positives = 73/172 (42%), Gaps = 6/172 (3%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT-LSRLDRLL 83
           +   +  + R   D  L  + G  F+ + L    +++F GFT+C  +CPTT     +   
Sbjct: 52  NGAILFDHPRIIEDFRLQDEKGQAFTQAELTGHWTLLFLGFTHCPDICPTTLAKLAEVHK 111

Query: 84  KQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVN 143
                         ++VDP RDTP  + ++V  F+   IG++GD   +M + +N      
Sbjct: 112 NLQPEIAAQTRVVLLSVDPARDTPVKLAEYVHYFNPEFIGLTGDFRQIMTLTQNLNGVFQ 171

Query: 144 NVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            V+       + Y VDHT  L+L +  G   G I    +       I  +++
Sbjct: 172 KVV-----QGDDYTVDHTANLILINPEGHYQGFIQPPFELARLTTVIESIVS 218


>gi|326388326|ref|ZP_08209922.1| electron transport protein SCO1/SenC [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207058|gb|EGD57879.1| electron transport protein SCO1/SenC [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 208

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 70/172 (40%), Gaps = 7/172 (4%)

Query: 28  FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSR----LDRLL 83
                     D  LV + G     +    K  +++FG+T C  +CP  +           
Sbjct: 40  PPLAGTALGGDFTLVDKTGKTVRYADFAGKWRVLYFGYTFCPDICPLDVQHLMQGYHLFA 99

Query: 84  KQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVN 143
           +        +   FI++DP RDTP+V+ +F   F   ++G++G P  V   AK F +Y  
Sbjct: 100 RAHPAQAARVVPMFISIDPARDTPQVVGQFASAFGPELVGLTGTPQQVAVAAKAFAVYYQ 159

Query: 144 NVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
                     + Y +DH+ A  L D  G  V ++P   D  +   ++ + + 
Sbjct: 160 KHAG---STPDAYLMDHSRASYLMDPDGKPVALLPVDQDGKAVAAELEKWVR 208


>gi|67527062|gb|AAY68331.1| putative inner mitochondrial membrane protein Sco1p [uncultured
           marine bacterium 66A03]
          Length = 195

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 95/192 (49%), Gaps = 8/192 (4%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K L      +L   + + +       F + +    +   L+  +G   +  +    PS++
Sbjct: 9   KRLLFFTVLMLSVFIFATSEWLARRHFTETDFSLGTPFSLIDHNGRVITEKAFLGSPSLL 68

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFGFT C  +CPTTL  L RL +++      +  YF+T+DP+RDTP+ +  ++  F +RI
Sbjct: 69  FFGFTYCPEICPTTLVDLGRLTEELG---FEIPIYFVTLDPERDTPQQLADYLPYFGNRI 125

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           IGI+G+   ++ +AK++ IY   +          Y +DHT  + +   +G   G I + +
Sbjct: 126 IGITGNTDAILALAKSWGIYRKKI-----STSSGYTIDHTATVFMLSDSGKFQGTIAWGE 180

Query: 182 DSDSAIEKINRL 193
           +     +K+ RL
Sbjct: 181 NDQIVKQKLERL 192


>gi|310814833|ref|YP_003962797.1| electron transport protein SCO1/SenC [Ketogulonicigenium vulgare
           Y25]
 gi|308753568|gb|ADO41497.1| electron transport protein SCO1/SenC [Ketogulonicigenium vulgare
           Y25]
          Length = 220

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 55/204 (26%), Positives = 95/204 (46%), Gaps = 14/204 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNR--------RFN-SDVHLVAQDGTDFSL 51
           ++ + I +  +         +++ + +                   D  L   DG  F+ 
Sbjct: 22  LRNIRIAIWGLAAIAGAGAVWLTTTQRTAIPAPMTMQAAYSDIGQGDYSLQTTDGQPFTA 81

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
           +SL  +PS+VFFGFT+C  VCPTTL  +      +   G  L   FITVDP+RDTPE++ 
Sbjct: 82  ASLVGQPSLVFFGFTHCPDVCPTTLGDITLWKDDLGAVGDDLQVVFITVDPERDTPELLH 141

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            +V  +    + ++G P ++ +    FRIY + V  E     + Y ++H   ++LFD  G
Sbjct: 142 DYV-SWVPDSVAVTGTPEEIEKTVTAFRIYASKVPLE----GDDYTMNHAAYVMLFDENG 196

Query: 172 SIVGVIPYKDDSDSAIEKINRLIT 195
               +  Y++D D    K+   ++
Sbjct: 197 QFNQIFSYQEDIDRVTAKMREFLS 220


>gi|117924373|ref|YP_864990.1| electron transporter SCO1/SenC [Magnetococcus sp. MC-1]
 gi|117608129|gb|ABK43584.1| electron transport protein SCO1/SenC [Magnetococcus sp. MC-1]
          Length = 224

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/205 (23%), Positives = 89/205 (43%), Gaps = 18/205 (8%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVD-------------GNRRFNSDVHLVAQDGTDFS 50
           +  ILG  +  +L + +  +                       R  +   LV + G  F 
Sbjct: 13  IWPILGLFMGLLLVACSQPAEKKGAPQWVAVPAALKGIALQGPRPVTQFQLVDEQGQPFD 72

Query: 51  LSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG--TLLNAYFITVDPKRDTPE 108
            S L  K S++FFG+T C  VCPT+L+ L  + + +            FI+VDP+RD+ E
Sbjct: 73  QSRLLGKWSLIFFGYTYCPDVCPTSLTLLAEMFELMGAQQLAEAYQGLFISVDPQRDSVE 132

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
           ++K++   F   I+G++G P  +  VA                 +  Y + H+  L + +
Sbjct: 133 LLKEYTGYFHSAIMGVTGTPAAIAGVAGQMGALYYREPG---RSDTDYLISHSAKLHVVN 189

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRL 193
            AG +V ++P +   ++ +E +  L
Sbjct: 190 PAGQLVALLPSERSPEALVELLKTL 214


>gi|212637522|ref|YP_002314047.1| electron transport protein SCO1/SenC [Shewanella piezotolerans WP3]
 gi|212559006|gb|ACJ31460.1| Electron transport protein SCO1/SenC [Shewanella piezotolerans WP3]
          Length = 210

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/184 (23%), Positives = 76/184 (41%), Gaps = 15/184 (8%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +   + F     +  +   L  Q G  F+   L  K S+ F G+T+C  VCPTT+ +L  
Sbjct: 29  LQLQTSFEFPTPQAIAPFSLTDQHGKAFTNDDLSGKWSLFFIGYTSCPDVCPTTMGKLTA 88

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
               +      L   F++VDP+RD+ + +  +   F+   + ++ +   +  + ++    
Sbjct: 89  AYPSLSEHA-DLQVIFLSVDPQRDSTDTLLNYANFFNPEFVAVTAEHKQLYPITRSLGFV 147

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS---------DSAIEKINR 192
              V     G  E Y VDH+ +  L    G  V VI  K D+          + I  ++ 
Sbjct: 148 YAMV-----GDGEDYQVDHSASFALVSPNGEKVAVIKPKSDTPGKLPQIKNSALIHDVHA 202

Query: 193 LITY 196
           LI  
Sbjct: 203 LIAK 206


>gi|126665618|ref|ZP_01736600.1| Sco1/SenC family protein [Marinobacter sp. ELB17]
 gi|126630246|gb|EBA00862.1| Sco1/SenC family protein [Marinobacter sp. ELB17]
          Length = 222

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/207 (20%), Positives = 77/207 (37%), Gaps = 20/207 (9%)

Query: 2   KALGIILGTILLAVLGSIAYVSF---------------SSKFVDGNRRFNSDVHLVAQDG 46
           +   I+L   ++AV G      +               ++ +V    R   +  L  ++G
Sbjct: 6   RTTVILLVLAVVAVFGFSIARYWLAEPAPVEPPPDLASANIYVYEPPRPVIEFELTDENG 65

Query: 47  TDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDT 106
              +  +L    +  F G+TNC  +CP  ++ L +  K +  T        I+ DP+ DT
Sbjct: 66  QTVTRENLRGHWTFAFVGYTNCPDICPVAMAALRQTNKLLPATLPQPRYLLISADPEHDT 125

Query: 107 PEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLL 166
           PEV+K +   F +   G SGD      +A +           +   E    VDH+    L
Sbjct: 126 PEVLKNYTGFFGENFHGYSGDIDITRALATSLGAVF-----VQRETEGGLLVDHSGHFAL 180

Query: 167 FDTAGSIVGVIPYKDDSDSAIEKINRL 193
              +  +V +I          +   ++
Sbjct: 181 IGPSAEVVALIQPPHKPQQLADGFEQI 207


>gi|163732939|ref|ZP_02140383.1| SenC protein [Roseobacter litoralis Och 149]
 gi|161393474|gb|EDQ17799.1| SenC protein [Roseobacter litoralis Och 149]
          Length = 207

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/159 (28%), Positives = 74/159 (46%), Gaps = 4/159 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              LV   G   + + +  +PSI++FG+T C  VCP  ++R    ++ ++  G  +   F
Sbjct: 52  PFELVNAQGDVVTDADVITEPSILYFGYTFCPDVCPLDVARNAVAVEVLEENGMSVTPVF 111

Query: 98  ITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYF 157
           I++DPKRDTPEV+  F     +R+IG++G P  V   +  +R Y         G E+ Y 
Sbjct: 112 ISIDPKRDTPEVVGDFAANMHERMIGLTGSPEQVKAASTAYRTYYKAHE----GDEDFYL 167

Query: 158 VDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           VDH+T   L       V     +   +   E +   +  
Sbjct: 168 VDHSTFSYLVLPEHGFVEFFRREVAPEQMAETVACFVEN 206


>gi|330958701|gb|EGH58961.1| Sco1/SenC family protein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 201

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 52/181 (28%), Positives = 85/181 (46%), Gaps = 5/181 (2%)

Query: 14  AVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCP 73
           A  G+   + F       N     +  L    G   +LSS      ++FFGFT C A+CP
Sbjct: 23  AGCGNSNALPFKHGKDMSNEIVGRNFRLKDTQGNVKTLSSFRGLMPMIFFGFTQCPAICP 82

Query: 74  TTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMR 133
           TTL+R  ++ K +   G  L   FIT+DP+RDTPEV+  +V+ F    + +SG   +   
Sbjct: 83  TTLARAAQIRKLMGEEGKTLQVVFITLDPERDTPEVIDAYVKAFDPTFVALSGTLEETAA 142

Query: 134 VAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
            AK F ++   V        + Y + HT+   ++DT G +   + ++  +    E +  L
Sbjct: 143 TAKEFGVFFEKVPL-----GDTYTISHTSTSYVYDTRGVLRLGLSHRLSAQQCTEDLLTL 197

Query: 194 I 194
           +
Sbjct: 198 M 198


>gi|254483344|ref|ZP_05096575.1| SCO1/SenC superfamily protein [marine gamma proteobacterium
           HTCC2148]
 gi|214036439|gb|EEB77115.1| SCO1/SenC superfamily protein [marine gamma proteobacterium
           HTCC2148]
          Length = 221

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 84/201 (41%), Gaps = 20/201 (9%)

Query: 2   KALGIILGTILLAVLGS---------------IAYVSFSSKFVDGNRRFNSDVHLVAQDG 46
           + + I +  IL+ +                   A +  +  ++    R   +V L+   G
Sbjct: 12  RNIKITVVAILVLITIIVAGFVNRVQQPRVMTFAEMKINGLYLLQTPRNFGEVKLIDHHG 71

Query: 47  TDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRD 105
             F+   L    ++VFFGFT+C  +CPTT++ +D+ + +             +TVDP RD
Sbjct: 72  EPFTRERLEGHWTMVFFGFTHCPDICPTTMAFMDKFMAELEGTEAQDTEVVLVTVDPARD 131

Query: 106 TPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALL 165
           T E +  +V  F+    G++G+ +DV R A         V  +     E Y VDH++ ++
Sbjct: 132 TVEQLAAYVPYFNPDFTGVTGEFLDVHRFATALNTPFRRVPGQD----ENYQVDHSSNVV 187

Query: 166 LFDTAGSIVGVIPYKDDSDSA 186
           L +  G   G      D    
Sbjct: 188 LINPRGDYHGFFKAPLDQAKM 208


>gi|113972127|ref|YP_735920.1| electron transport protein SCO1/SenC [Shewanella sp. MR-4]
 gi|114049357|ref|YP_739907.1| electron transport protein SCO1/SenC [Shewanella sp. MR-7]
 gi|113886811|gb|ABI40863.1| electron transport protein SCO1/SenC [Shewanella sp. MR-4]
 gi|113890799|gb|ABI44850.1| electron transport protein SCO1/SenC [Shewanella sp. MR-7]
          Length = 219

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 53/198 (26%), Positives = 90/198 (45%), Gaps = 14/198 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFS--------SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
            I++  ILL  LG +  V F+        S F+       +   LV Q    F+ ++L  
Sbjct: 14  KILVIAILLIGLGGLFAVKFNPPKPVELESGFLFPEAFELAPFELVDQQQKPFTNANLKD 73

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           + S+ F GFT C  VCPTTL++L     ++      +   F++VDPKRDTPE +  +V  
Sbjct: 74  QWSLFFIGFTYCPDVCPTTLNKLAAAYPELKKIA-PIQIVFLSVDPKRDTPEKLLTYVNF 132

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F+     ++G+   +  + ++  +    V     G  + Y VDH+   +L    G+ V V
Sbjct: 133 FNPEFKAVTGEQTQIFPLTRSLGLTYAMV-----GEGDNYQVDHSAGYVLVSPQGTRVAV 187

Query: 177 IPYKDDSDSAIEKINRLI 194
                    A + +N+ +
Sbjct: 188 FKPTAALGKAPQVLNQAL 205


>gi|289625105|ref|ZP_06458059.1| Sco1/SenC family protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646470|ref|ZP_06477813.1| Sco1/SenC family protein [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330866595|gb|EGH01304.1| Sco1/SenC family protein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 210

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 90/208 (43%), Gaps = 18/208 (8%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFN-------------SDVHLVAQDGTDF 49
               I   I+  VLG I          +     N               + +  Q+G   
Sbjct: 6   KTVFIAAAIVALVLGLILSQLLPGSGSEDQAALNDAGIVLLPKSRQLPALSMSDQNGAAV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           +L  L  K +++FFG+T C  +CPTTL+++ ++  +  +     +    ++VDP+RDTP+
Sbjct: 66  ALDDLKGKWTLMFFGYTFCPDICPTTLAQIKQIRTELPEKVVERMRMVLVSVDPERDTPQ 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F  + IG++    D+  +A    I        K      YFVDH+  L L  
Sbjct: 126 QLKQYLGYFDPQYIGLTAPVADIQTLANAVSIPFIPADTSK----ANYFVDHSGNLALIG 181

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G+  G I    ++   ++++ RL+  
Sbjct: 182 PDGTQRGFIRAPLNNQKLVKQLPRLLER 209


>gi|330428216|gb|AEC19550.1| hypothetical protein PT7_1010 [Pusillimonas sp. T7-7]
          Length = 196

 Score =  103 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/193 (22%), Positives = 88/193 (45%), Gaps = 3/193 (1%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSD--VHLVAQDGTDFSLSSLYIKPSIVFFG 64
                L + + + + V+ +   +   R F  D    L A  G   +         ++FFG
Sbjct: 4   FFLGFLASAVLAWSGVAQAETALHNVRGFLPDLRFTLQAAGGKTVTEDDFKGSTVMLFFG 63

Query: 65  FTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGI 124
           + +C  VCPTT+++L +++ ++D     +   FI+VDP RDTP++++ +V+ F    IG+
Sbjct: 64  YASCPDVCPTTMAQLSQVMLELDDDADKVQIVFISVDPHRDTPDILQAYVKAFDSNAIGL 123

Query: 125 SGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSD 184
           +G    V  VA+ +R+    +        + Y V H+  + +FD +G    +    +  +
Sbjct: 124 TGTEKQVADVARRYRVAFQ-IEKPTGDNPDNYEVAHSRGVYIFDASGRARYLAADTESVE 182

Query: 185 SAIEKINRLITYG 197
                +  L+   
Sbjct: 183 VLTAGVKTLLDQQ 195


>gi|66045525|ref|YP_235366.1| twin-arginine translocation pathway signal [Pseudomonas syringae
           pv. syringae B728a]
 gi|289673473|ref|ZP_06494363.1| twin-arginine translocation pathway signal [Pseudomonas syringae
           pv. syringae FF5]
 gi|302187586|ref|ZP_07264259.1| twin-arginine translocation pathway signal [Pseudomonas syringae
           pv. syringae 642]
 gi|63256232|gb|AAY37328.1| Twin-arginine translocation pathway signal [Pseudomonas syringae
           pv. syringae B728a]
 gi|330979869|gb|EGH78185.1| twin-arginine translocation pathway signal [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 201

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 82/180 (45%), Gaps = 5/180 (2%)

Query: 15  VLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPT 74
             GS   + F       N     +  L    G   +LSS      ++FFGFT C A+CPT
Sbjct: 24  GCGSSNALPFKHGKDMSNEIVGRNFRLKDSQGNVKTLSSFRGLMPMIFFGFTQCPAICPT 83

Query: 75  TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRV 134
            L+R  ++ K +   G  L   FIT+DP+RDTPEV+  +V+ F    + +SG   +    
Sbjct: 84  ALARAAQIRKLMGEEGKTLQVVFITLDPERDTPEVIDAYVKAFDPTFVALSGTLEETAAT 143

Query: 135 AKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           AK F ++   V        + Y + HT    ++DT G +   + ++  +    E +  L+
Sbjct: 144 AKEFGVFFEKVPL-----GDTYTISHTATSYVYDTRGVLRLGLSHRLSAQQCTEDLLTLM 198


>gi|89055687|ref|YP_511138.1| electron transport protein SCO1/SenC [Jannaschia sp. CCS1]
 gi|88865236|gb|ABD56113.1| electron transport protein SCO1/SenC [Jannaschia sp. CCS1]
          Length = 188

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/191 (19%), Positives = 77/191 (40%), Gaps = 5/191 (2%)

Query: 6   IILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGF 65
           +IL  +LLA  G ++  + S++ +  +        L    G   +      +P ++FFG+
Sbjct: 1   MILRALLLACAGVLSAQAASAQTLTED--LGGAFALTDHTGAIRTEVDPNGQPQLLFFGY 58

Query: 66  TNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGIS 125
            NC  +C      +  ++  +D  G  +    ITVDP+RDT + M   +       IG++
Sbjct: 59  ANCQEICSAVFPTMASIVDIMDADGIAIRPVLITVDPERDTVDTMADALHIHHPDFIGLT 118

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDS 185
           G   D+      + +    +  +           H + + L D  G+++ ++P    S  
Sbjct: 119 GSEADLQVAYDAYSVEFEELFVDPFYGT---VFSHGSFIYLLDGDGTVLTLLPPVLGSQM 175

Query: 186 AIEKINRLITY 196
             + +   +  
Sbjct: 176 MADIVAGYLDE 186


>gi|190576211|ref|YP_001974056.1| putative SCO1/SenC family protein [Stenotrophomonas maltophilia
           K279a]
 gi|190014133|emb|CAQ47772.1| putative SCO1/SenC family protein [Stenotrophomonas maltophilia
           K279a]
          Length = 226

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 3/163 (1%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
                  +    GT      L  + + +FFGFT+C  VCPTT+  L ++   +      L
Sbjct: 42  ELGQQWSMPDSHGTVRGPKDLQGQVTYLFFGFTSCPDVCPTTMVELSQVKHLMGKDADQL 101

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              F++VDP RDTPEV + +V+ F  R I + G+   +  +A +F+ +      +   V 
Sbjct: 102 QVVFVSVDPARDTPEVARTYVEAFDPRAIALVGNEAQLAAMASDFKAFYEKEPGQ---VP 158

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           + Y + H     +FD  G +    PY    +     + RL+  
Sbjct: 159 DTYTMSHIAGGYVFDRQGRLRLFAPYGMPVEKLFSDVQRLLLE 201


>gi|311695857|gb|ADP98730.1| electron transport protein SCO1/SenC [marine bacterium HP15]
          Length = 197

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 90/200 (45%), Gaps = 7/200 (3%)

Query: 1   MKALGIILGTILLAVLGSIAY--VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKP 58
           M  + ++    L  +         S+  K + G      +  L   DG   + +      
Sbjct: 1   MIRIRLLWLIFLALMFTGCTGNDESWHGKDISGLMPEL-EFRLEGTDGNTVTPADSRGTI 59

Query: 59  SIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
            +++FGFT+C  VCPTTL+ L R + Q  +     +   F++VDP+RDTPE +  +V  F
Sbjct: 60  RLLYFGFTSCPDVCPTTLTDLRRSVGQLPEEYRDDVTTLFVSVDPRRDTPERLASYVDFF 119

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
            DR++G++ +   +  + K +R        +K      Y V H++A+ +FD +G+   ++
Sbjct: 120 GDRVVGMTAEEPALRELTKRYRTTFG---YDKPDSSGNYNVSHSSAVYVFDRSGNARLLL 176

Query: 178 PYKDDSDSAIEKINRLITYG 197
                 +   E + +L    
Sbjct: 177 RPGLSPEQISEDLAQLARES 196


>gi|51473766|ref|YP_067523.1| Sco2-like protein [Rickettsia typhi str. Wilmington]
 gi|51460078|gb|AAU04041.1| Sco2-like protein [Rickettsia typhi str. Wilmington]
          Length = 198

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/162 (26%), Positives = 82/162 (50%), Gaps = 2/162 (1%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
            N +      L+ Q+G  F+ + L    S+++FGFT+C  +CPT L+++  +++ +    
Sbjct: 38  DNIKIGEAFELIDQNGEIFNSNKLRGHLSLIYFGFTSCPDICPTFLNKMTNIVEILHQNQ 97

Query: 91  TLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKS 150
             +   FIT+DPKRDTPEV+K++++ F  + I ++G+   +  V   F+I    V     
Sbjct: 98  IDIIPIFITIDPKRDTPEVLKEYIKNFHPKFICLTGNEHQIKDVTDKFKILYARVNG--Y 155

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
             ++ Y +DH++   L D  G  +        +   +E +  
Sbjct: 156 DDDQNYMIDHSSFTYLIDKNGKYIKHFYLDISAKEIMEFLRN 197


>gi|229085200|ref|ZP_04217444.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           Rock3-44]
 gi|228698110|gb|EEL50851.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           Rock3-44]
          Length = 226

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 78/201 (38%), Gaps = 13/201 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    ++G I++  L  +A     SK              + QDG  F    L  K  +
Sbjct: 33  MKRYQKLIGLIVVFCLFILAGCGSGSKLRKPLNWDLETFEYINQDGKKFGTKDLKGKVWV 92

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD- 119
             F FTNC  VCP   + + +L K        +     +VDP+ D PE +K F+Q+F++ 
Sbjct: 93  ADFMFTNCQTVCPPMTANMAKLQKMAKERKLDVQFVSFSVDPELDKPENLKAFIQKFTED 152

Query: 120 --RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
                 ++G    D+ + +K+                E   V H T+  L D  G ++  
Sbjct: 153 TSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFYLVDQEGKVMKK 205

Query: 177 IPY--KDDSDSAIEKINRLIT 195
                K   +  +  + RL+ 
Sbjct: 206 YNGISKTPYEDILRDMERLLK 226


>gi|330892530|gb|EGH25191.1| Sco1/SenC family protein [Pseudomonas syringae pv. mori str.
           301020]
 gi|330892913|gb|EGH25574.1| Sco1/SenC family protein [Pseudomonas syringae pv. mori str.
           301020]
          Length = 219

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/208 (23%), Positives = 93/208 (44%), Gaps = 17/208 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDF 49
           K + I    + L +   ++ +   S   D               R    + +  Q+G   
Sbjct: 15  KTVFIAAALVALVLGLILSQLLPGSGSEDQAALNDAGIVLLPKSRPLPALSMSDQNGAAV 74

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           +L  L  K +++FFG+T C  +CPTTL+++ ++  +  +     +    ++VDP RDTP+
Sbjct: 75  ALDDLKGKWTLMFFGYTFCPDICPTTLAQIKQIRTELPEKVVERMRVVLVSVDPDRDTPQ 134

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F  + IG++    D+ ++A    I        K      YFVDH+  L L  
Sbjct: 135 QLKQYLGYFDKQYIGLTAPVADIQKLANAVSIPFIPADTSK----ANYFVDHSGNLALIG 190

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G+  G I    ++   ++++ RL+  
Sbjct: 191 PDGTQRGFIRAPLNNQKLVKQLPRLLER 218


>gi|134035033|sp|Q68WF1|SCO22_RICTY RecName: Full=SCO2-like protein RT0576
          Length = 203

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/162 (26%), Positives = 82/162 (50%), Gaps = 2/162 (1%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG 90
            N +      L+ Q+G  F+ + L    S+++FGFT+C  +CPT L+++  +++ +    
Sbjct: 43  DNIKIGEAFELIDQNGEIFNSNKLRGHLSLIYFGFTSCPDICPTFLNKMTNIVEILHQNQ 102

Query: 91  TLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKS 150
             +   FIT+DPKRDTPEV+K++++ F  + I ++G+   +  V   F+I    V     
Sbjct: 103 IDIIPIFITIDPKRDTPEVLKEYIKNFHPKFICLTGNEHQIKDVTDKFKILYARVNG--Y 160

Query: 151 GVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
             ++ Y +DH++   L D  G  +        +   +E +  
Sbjct: 161 DDDQNYMIDHSSFTYLIDKNGKYIKHFYLDISAKEIMEFLRN 202


>gi|326793897|ref|YP_004311717.1| electron transporter SCO1/SenC [Marinomonas mediterranea MMB-1]
 gi|326544661|gb|ADZ89881.1| electron transport protein SCO1/SenC [Marinomonas mediterranea
           MMB-1]
          Length = 198

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/176 (30%), Positives = 84/176 (47%), Gaps = 4/176 (2%)

Query: 21  YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLD 80
           Y+  ++     + R   D  L+  +G   SLS    K  +VFFG+T+C  +CP TL+ + 
Sbjct: 25  YMQTNNTEKAKSTRLGGDFTLMTSEG-PVSLSDFPNKMKLVFFGYTHCPDICPLTLANVK 83

Query: 81  RLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFR 139
             LKQ  D   + +   FI+VDPKRDTPE + ++V  F    IG +    ++ +V K + 
Sbjct: 84  VALKQLPDDVRSQVQTIFISVDPKRDTPEHLSQYVHFFDPSFIGATDTQKNIDKVVKQYG 143

Query: 140 IYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
            +   V    S +   Y VDH+  L L      I   + +   S+   E + + IT
Sbjct: 144 AFYRFVDMPDSSMG--YSVDHSAQLYLMGKDNKIKEYLFHDSSSEEIAETLKKAIT 197


>gi|289628179|ref|ZP_06461133.1| Sco1/SenC family protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649234|ref|ZP_06480577.1| Sco1/SenC family protein [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330868825|gb|EGH03534.1| Sco1/SenC family protein [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 201

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 51/181 (28%), Positives = 83/181 (45%), Gaps = 5/181 (2%)

Query: 14  AVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCP 73
           A  G+   + F       N     +  L    G   +LSS      ++FFGFT C A+CP
Sbjct: 23  AGCGNSNALPFKHGKDMSNEIVGRNFRLKDSQGNVKTLSSFRGLMPMIFFGFTQCPAICP 82

Query: 74  TTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMR 133
           T L+R  ++ K +   G  L   FIT+DP+RDTPEV+  +V+ F    + +SG   +   
Sbjct: 83  TALARAAQIRKLMGEEGKTLQVVFITLDPERDTPEVIDAYVKAFDPTFVALSGTLEETAA 142

Query: 134 VAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
            AK F ++   V        + Y + HT    ++DT G +   + ++  +    E +  L
Sbjct: 143 TAKEFGVFFEKVPL-----GDTYTISHTATSYVYDTRGVLRLGLSHRLSAQQCTEDLLTL 197

Query: 194 I 194
           +
Sbjct: 198 M 198


>gi|295400399|ref|ZP_06810378.1| electron transport protein SCO1/SenC [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111075|ref|YP_003989391.1| electron transporter SCO1/SenC [Geobacillus sp. Y4.1MC1]
 gi|294977674|gb|EFG53273.1| electron transport protein SCO1/SenC [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216176|gb|ADP74780.1| electron transport protein SCO1/SenC [Geobacillus sp. Y4.1MC1]
          Length = 185

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 49/195 (25%), Positives = 75/195 (38%), Gaps = 21/195 (10%)

Query: 6   IILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGF 65
           I+L  I+L            +  V+       D     Q+G  F LS L  K  +  F F
Sbjct: 2   IVLLAIVLLAACGKTIPDAKNWPVN-------DFTFTDQNGKPFGLSDLKGKVWVADFIF 54

Query: 66  TNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS---DRII 122
           TNC  VCP   + + +L K     G  +     +VDP+ DTPE +K+++++F        
Sbjct: 55  TNCETVCPPMTAHMAKLQKMAKEKGLDVEFVSFSVDPEVDTPEKLKEYIKKFDGDLANWH 114

Query: 123 GISGDPIDVMRVA--KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY- 179
            ++G     +     KNF+  V     +         V H T   L D  G+IV      
Sbjct: 115 LLTGYSQQEIEQFAEKNFKTIVQKPKDQD-------QVIHGTNFYLVDQNGTIVQTYSGV 167

Query: 180 -KDDSDSAIEKINRL 193
                +  +E I  L
Sbjct: 168 KDVPYEQILEHIEIL 182


>gi|330951995|gb|EGH52255.1| twin-arginine translocation pathway signal [Pseudomonas syringae
           Cit 7]
          Length = 201

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 51/179 (28%), Positives = 82/179 (45%), Gaps = 5/179 (2%)

Query: 16  LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT 75
            GS   + F       N     +  L    G   +LSS      ++FFGFT C A+CPT 
Sbjct: 25  CGSSNALPFKHGKDMSNEIVGRNFRLKDSQGNVKTLSSFRGLMPMIFFGFTQCPAICPTA 84

Query: 76  LSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVA 135
           L+R  ++ K +   G  L   FIT+DP+RDTPEV+  +V+ F    + +SG   +    A
Sbjct: 85  LARAAQIRKLMGEEGKTLQVVFITLDPERDTPEVIDAYVKAFDPTFVALSGTLEETAATA 144

Query: 136 KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           K F ++   V        + Y + HT    ++DT G +   + ++  +    E +  L+
Sbjct: 145 KEFGVFFEKVPL-----GDTYTISHTATSYVYDTRGVLRLGLSHRLSAQQCTEDLLTLM 198


>gi|127514261|ref|YP_001095458.1| electron transport protein SCO1/SenC [Shewanella loihica PV-4]
 gi|126639556|gb|ABO25199.1| electron transport protein SCO1/SenC [Shewanella loihica PV-4]
          Length = 212

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/207 (20%), Positives = 81/207 (39%), Gaps = 17/207 (8%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVF 62
              + L   +L +   ++  S ++  +   +    D  L +  G +  LS  + K  ++F
Sbjct: 8   KFHLALSLCVLLIGSLMSAASMANMPIL--KGIGGDFSLRSSKGGEVRLSDFHDKVVMMF 65

Query: 63  FGFTNCSAVCP-TTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FG+TNC+ +CP T       + +    T   +   FI++D   DTP+ + K++  F    
Sbjct: 66  FGYTNCADICPTTMAHISQLMHQLPSETRDRIQVLFISIDSDYDTPKHLNKYLSYFDPSF 125

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE--------------EKYFVDHTTALLLF 167
           IG+  +   +  VA  F+     +  EK   E              + Y   HT  + + 
Sbjct: 126 IGLVDEREKIDEVAALFKADYTKLAEEKVTTEYKKLSLEDSKAPKRQGYLYSHTAKIFVL 185

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLI 194
           D    + G        D   ++I  L+
Sbjct: 186 DGKQRVRGFFYTGTPIDEMRQQIESLL 212


>gi|330974470|gb|EGH74536.1| twin-arginine translocation pathway signal [Pseudomonas syringae
           pv. aceris str. M302273PT]
          Length = 201

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 50/180 (27%), Positives = 81/180 (45%), Gaps = 5/180 (2%)

Query: 15  VLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPT 74
             GS   + F       N     +  L    G   +LSS      ++FFGFT C A+CPT
Sbjct: 24  GCGSSNALPFKHGKDMSNEIVGRNFRLKDSQGNVKTLSSFRGLMPMIFFGFTQCPAICPT 83

Query: 75  TLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRV 134
            L+R  ++ K +   G  L   FIT+DP+RDT EV+  +V+ F    + +SG   +    
Sbjct: 84  ALARAAQIRKLMGEEGKTLQVVFITLDPERDTLEVIDAYVKAFDPTFVALSGTLEETAAT 143

Query: 135 AKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           AK F ++   V        + Y + HT    ++DT G +   + ++  +    E +  L+
Sbjct: 144 AKEFGVFFEKVPL-----GDTYTISHTATSYVYDTRGVLRLGLSHRLSAQQCTEDLLTLM 198


>gi|88861094|ref|ZP_01135729.1| putative SCO1/SenC family protein (copper-binding protein)
           [Pseudoalteromonas tunicata D2]
 gi|88817022|gb|EAR26842.1| putative SCO1/SenC family protein (copper-binding protein)
           [Pseudoalteromonas tunicata D2]
          Length = 201

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/202 (19%), Positives = 83/202 (41%), Gaps = 14/202 (6%)

Query: 1   MKALGI-ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           M+ + + I+  +L+++ G       +   V  N +      L  Q+G   S  +L    +
Sbjct: 1   MRFIFLVIMSAVLISLTGCQKEPPITQALVYENAKQLKPFELTNQNGQIISNEALIGSWN 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
            +F G+T+C  +CP       + +K+   +   +  +F++VDP RD  E +K + Q F  
Sbjct: 61  FLFLGYTSCPDICP-MTLAKLQQVKRSLSSEFPVKVWFVSVDPNRDNSEKLKLYTQYFDP 119

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY 179
             I  + D   +    ++  +      ++ +     Y VDH+ ++ L D  G +  +   
Sbjct: 120 EFIAATADHPKLFPFVRDIGLMYAMADSKLTQ----YSVDHSASIALIDAKGQLRAIFKP 175

Query: 180 KDDS--------DSAIEKINRL 193
           +           D  I+   ++
Sbjct: 176 EFAPNTIPTINTDQLIDDFKKI 197


>gi|297802084|ref|XP_002868926.1| electron transport SCO1/SenC family protein [Arabidopsis lyrata
           subsp. lyrata]
 gi|297314762|gb|EFH45185.1| electron transport SCO1/SenC family protein [Arabidopsis lyrata
           subsp. lyrata]
          Length = 276

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 76/169 (44%), Gaps = 5/169 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
            S              L++ +    + +    K  +++FG++    V P  L  + + + 
Sbjct: 105 GSNTTVKGPIIGGPFTLMSTENKIVTENDFCGKWVLLYFGYSFSPDVGPEQLKMMSKAVD 164

Query: 85  QVD-PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVN 143
           +++      +   F+T+DP+RDTP  +  +++ F  RI+G++G    + ++A+ +R+Y  
Sbjct: 165 KLESKHNQKILPVFVTLDPQRDTPSHLHAYLKEFDSRILGLTGAASAMRQMAQEYRVYFK 224

Query: 144 NVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINR 192
            V  +     + Y VD +  + L +    IV     + + D   +++ +
Sbjct: 225 KVQED----GDDYLVDTSHNMYLMNPKMEIVRCFGVEYNPDELSQELLK 269


>gi|167032994|ref|YP_001668225.1| electron transport protein SCO1/SenC [Pseudomonas putida GB-1]
 gi|166859482|gb|ABY97889.1| electron transport protein SCO1/SenC [Pseudomonas putida GB-1]
 gi|313499539|gb|ADR60905.1| Electron transport protein SCO1/SenC [Pseudomonas putida BIRD-1]
          Length = 202

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/174 (30%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           + F       N        L    G   +LSS Y    +VFFGFT C AVCPTTL+R  +
Sbjct: 31  LEFKYGKNMSNEILGRKFSLKDPQGNVRTLSSFYGSMPMVFFGFTQCPAVCPTTLARAAQ 90

Query: 82  LLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
           + K        L    FIT+DP+RDTPEV+  +V+ F      ++G P ++  VAK F++
Sbjct: 91  IRKLLRGRDRDLFQVVFITLDPERDTPEVLDAYVKAFDPTFTALTGTPEEIAAVAKEFKV 150

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +   V A      + Y + H++   ++DT G++   + +  ++    E +  L+
Sbjct: 151 FYEKVPA-----GDTYTISHSSTSYVYDTRGTLRLSLGHSLNAKECAEDLVTLM 199


>gi|26989103|ref|NP_744528.1| electron transport protein SCO1/SenC [Pseudomonas putida KT2440]
 gi|148548524|ref|YP_001268626.1| electron transport protein SCO1/SenC [Pseudomonas putida F1]
 gi|24983935|gb|AAN67992.1|AE016432_1 Sco1/SenC family protein [Pseudomonas putida KT2440]
 gi|148512582|gb|ABQ79442.1| electron transport protein SCO1/SenC [Pseudomonas putida F1]
          Length = 223

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/174 (30%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           + F       N        L    G   +LSS Y    +VFFGFT C AVCPTTL+R  +
Sbjct: 52  LEFKYGKNMSNEILGRKFSLKDPQGNVRTLSSFYGSMPMVFFGFTQCPAVCPTTLARAAQ 111

Query: 82  LLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
           + K        L    FIT+DP+RDTPEV+  +V+ F      ++G P ++  VAK F++
Sbjct: 112 IRKLLRGRDRDLFQVVFITLDPERDTPEVLDAYVKAFDPTFTALTGTPEEIAAVAKEFKV 171

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +   V A      + Y + H++   ++DT G++   + +  ++    E +  L+
Sbjct: 172 FYEKVPA-----GDTYTISHSSTSYVYDTRGTLRLSLGHSLNAKECAEDLVTLM 220


>gi|167917255|ref|ZP_02504346.1| SCO1/SenC family protein [Burkholderia pseudomallei BCC215]
          Length = 202

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 77/198 (38%), Gaps = 7/198 (3%)

Query: 1   MKALGIILGTILLAV---LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           M+   +     L      +GS A   F S  +           L    G   +       
Sbjct: 7   MRRKALGALCSLALAGAPVGSRAATPFYSLPLSSKDWHKG-FRLTDLHGHTKTPQDYRGN 65

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             ++FFGF +C ++C TT+  L +  ++V      +   F+T+DP RDT   + +++  F
Sbjct: 66  VLLLFFGFLSCPSICSTTMLELTQAKERVGAQKDKVKILFVTLDPNRDTSPTIARWLASF 125

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
            D  IG+      V + A    +    V  +   V   Y +DH     +FD  G +  + 
Sbjct: 126 GDDNIGLRDSEAHVRKAATALNLKYERVEGD---VPGAYTIDHGVQTYVFDPQGRLRLIA 182

Query: 178 PYKDDSDSAIEKINRLIT 195
               + +   + I +L++
Sbjct: 183 RAGIEPEYVAKDIVQLLS 200


>gi|53717985|ref|YP_106971.1| hypothetical protein BPSL0344 [Burkholderia pseudomallei K96243]
 gi|126453244|ref|YP_001064661.1| SCO1/SenC family protein [Burkholderia pseudomallei 1106a]
 gi|217425637|ref|ZP_03457128.1| SCO1/SenC family protein [Burkholderia pseudomallei 576]
 gi|237810561|ref|YP_002895012.1| SCO1/SenC family protein [Burkholderia pseudomallei MSHR346]
 gi|242314423|ref|ZP_04813439.1| SCO1/SenC family protein [Burkholderia pseudomallei 1106b]
 gi|254187988|ref|ZP_04894500.1| SCO1/SenC family protein [Burkholderia pseudomallei Pasteur 52237]
 gi|52208399|emb|CAH34333.1| putative exported protein [Burkholderia pseudomallei K96243]
 gi|126226886|gb|ABN90426.1| SCO1/SenC family protein [Burkholderia pseudomallei 1106a]
 gi|157935668|gb|EDO91338.1| SCO1/SenC family protein [Burkholderia pseudomallei Pasteur 52237]
 gi|217391313|gb|EEC31344.1| SCO1/SenC family protein [Burkholderia pseudomallei 576]
 gi|237503843|gb|ACQ96161.1| SCO1/SenC family protein [Burkholderia pseudomallei MSHR346]
 gi|242137662|gb|EES24064.1| SCO1/SenC family protein [Burkholderia pseudomallei 1106b]
          Length = 197

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 77/198 (38%), Gaps = 7/198 (3%)

Query: 1   MKALGIILGTILLAV---LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           M+   +     L      +GS A   F S  +           L    G   +       
Sbjct: 2   MRRKALGALCSLALAGAPVGSRAATPFYSLPLSSKDWHKG-FRLTDLHGHTKTPQDYRGN 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             ++FFGF +C ++C TT+  L +  ++V      +   F+T+DP RDT   + +++  F
Sbjct: 61  VLLLFFGFLSCPSICSTTMLELTQAKERVGAQKDKVKILFVTLDPNRDTSPTIARWLASF 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
            D  IG+      V + A    +    V  +   V   Y +DH     +FD  G +  + 
Sbjct: 121 GDDNIGLRDSEAHVRKAATALNLKYERVEGD---VPGAYTIDHGVQTYVFDPQGRLRLIA 177

Query: 178 PYKDDSDSAIEKINRLIT 195
               + +   + I +L++
Sbjct: 178 RAGIEPEYVAKDIVQLLS 195


>gi|237800922|ref|ZP_04589383.1| Sco1/SenC family protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331023778|gb|EGI03835.1| Sco1/SenC family protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 201

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 51/181 (28%), Positives = 83/181 (45%), Gaps = 5/181 (2%)

Query: 14  AVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCP 73
           A  G+   + F       N     +  L    G   +LSS      ++FFGFT C A+CP
Sbjct: 23  AGCGNSNALPFKHGKDMSNEIVGRNFRLKDSKGNVKTLSSFRGLMPMIFFGFTQCPAICP 82

Query: 74  TTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMR 133
           T L+R  ++ K +   G  L   FIT+DP+RDTPEV+  +V+ F    + +SG   +   
Sbjct: 83  TALARAAQIRKLMGEEGKTLQVVFITLDPERDTPEVIDAYVKAFDPTFVALSGTLEETAA 142

Query: 134 VAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
            AK F ++   V        + Y + HT    ++DT G +   + ++  +    E +  L
Sbjct: 143 TAKEFGVFFEKVPL-----GDTYTISHTATSYVYDTRGVLRLGLSHRLSAQQCTEDLLTL 197

Query: 194 I 194
           +
Sbjct: 198 M 198


>gi|223994497|ref|XP_002286932.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220978247|gb|EED96573.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 187

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 73/170 (42%), Gaps = 7/170 (4%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTL----SRLD 80
           SS    G         LV  DG   +  S   K ++++FGF  C  +CP+ +      +D
Sbjct: 11  SSFLSAGKPAIGGPWSLVDLDGNLVTNKSFEGKWTLLYFGFARCPDICPSEMVKVGKVMD 70

Query: 81  RLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
            L K+       +   F+++DP RD+ + ++ + + F    + ++G P  V  +AK +R+
Sbjct: 71  TLKKEHPELAKNVQPIFVSIDPARDSLKALRDYAKDFHPSYVFLTGAPQQVQAMAKKYRV 130

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
           Y++         +  Y VDH+  +   D  G I             ++K+
Sbjct: 131 YMSK---ADETEDGDYLVDHSIVIYFHDETGDIADCFTQSMRPSDVVDKV 177


>gi|304320440|ref|YP_003854083.1| SCO1/SenC family protein [Parvularcula bermudensis HTCC2503]
 gi|303299342|gb|ADM08941.1| SCO1/SenC family protein [Parvularcula bermudensis HTCC2503]
          Length = 193

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 47/195 (24%), Positives = 80/195 (41%), Gaps = 4/195 (2%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           + + ++L T+ L   G           +  N  F++D  L+   G   +      KP  +
Sbjct: 3   RPIALVL-TLTLMACGQAPNDRPMPGAITLNEAFDADFDLIDDQGEPATDERFEGKPMFI 61

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           +FGFT C  +CP  L  + + L ++      +   FI+VDP RD PE ++  +     RI
Sbjct: 62  YFGFTACPDICPAALGIMTQTLDRLGAQSKAIQPLFISVDPARDDPERLRNHLAYDG-RI 120

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           +G++G    +         Y        S +   Y +DH     L D AG+ V   P   
Sbjct: 121 LGLTGSQAAIDDARLALNYYAARRELPDSALG--YTIDHQRIFFLTDAAGTPVLAFPDST 178

Query: 182 DSDSAIEKINRLITY 196
           D     + I R+++ 
Sbjct: 179 DPALLAKAIRRILSE 193


>gi|325276842|ref|ZP_08142539.1| electron transport protein SCO1/SenC [Pseudomonas sp. TJI-51]
 gi|324098008|gb|EGB96157.1| electron transport protein SCO1/SenC [Pseudomonas sp. TJI-51]
          Length = 202

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 52/174 (29%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           + F       N        L    G   +LSS Y    ++FFGFT C A+CPTTL+R  +
Sbjct: 31  LEFKYGKNMSNEILGRKFSLKDPQGNVRTLSSFYGSMPMIFFGFTQCPAICPTTLARAAQ 90

Query: 82  LLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
           + K        L    FIT+DP+RDTPEV+  +V+ F    I ++G P ++  VAK F++
Sbjct: 91  IRKTLRGRDRDLFQVVFITLDPERDTPEVLDAYVKAFDPTFIALTGTPEEIAAVAKEFKV 150

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +   V A      + Y + H++   ++DT G++   + +   +    E +  L+
Sbjct: 151 FYEKVPA-----GDTYTISHSSTSYVYDTRGTLRLSLGHSLTAKECAEDLVTLM 199


>gi|3298363|dbj|BAA31473.1| SenC [Rhodovulum sulfidophilum]
          Length = 211

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 68/166 (40%), Gaps = 4/166 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           S     G         L  Q GT  + + +   P++++FG+T C  VCP   +R    + 
Sbjct: 39  SGGPRPGLSELGGPFTLTDQTGTTMTEADVIAGPTLIYFGYTFCPDVCPFDNARNADAVD 98

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            ++  G  +   FI+VDP RDTPE +  F      R++ ++G P  V   ++ +R     
Sbjct: 99  LLEGRGYEVRPVFISVDPARDTPEALAAFASMMHPRMLALTGTPEQVQAASRAYRTLYRI 158

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
              +     + Y +DH+T   +      +V         +    ++
Sbjct: 159 RDPDD----DYYLIDHSTFTYIAFPGAGVVEAFERDTTPEDMAARV 200


>gi|254182056|ref|ZP_04888653.1| SCO1/SenC family protein [Burkholderia pseudomallei 1655]
 gi|184212594|gb|EDU09637.1| SCO1/SenC family protein [Burkholderia pseudomallei 1655]
          Length = 202

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/194 (20%), Positives = 77/194 (39%), Gaps = 3/194 (1%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           KALG +    L          +        ++ ++    L    G   +         ++
Sbjct: 10  KALGTLCSLALAGAPVGSRAATPFYSLPLSSKDWHKGFRLTDLHGHTKTPQDYRGNVLLL 69

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121
           FFGF +C ++C TT+  L +  ++V      +   F+T+DP RDT   + +++  F D  
Sbjct: 70  FFGFLSCPSICSTTMLELTQAKERVGAQKDKVKILFVTLDPNRDTSPTIARWLASFGDDN 129

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           IG+      V + A    +    V  +   V   Y +DH     +FD  G +  +     
Sbjct: 130 IGLRDSEAHVRKAATALNLKYERVEGD---VPGAYTIDHGVQTYVFDPQGRLRLIARAGI 186

Query: 182 DSDSAIEKINRLIT 195
           + +   + I +L++
Sbjct: 187 EPEYVAKDIVQLLS 200


>gi|313679714|ref|YP_004057453.1| electron transport protein sco1/senc [Oceanithermus profundus DSM
           14977]
 gi|313152429|gb|ADR36280.1| electron transport protein SCO1/SenC [Oceanithermus profundus DSM
           14977]
          Length = 197

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 48/173 (27%), Positives = 83/173 (47%), Gaps = 12/173 (6%)

Query: 26  SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ 85
           S  V  N R   +  L +  G   SL+    K  +VFFG+ +C  VCP TL+ L  + ++
Sbjct: 31  SGTVLKNPRPAPEFRLESASG-PVSLADFRGKVVLVFFGYAHCPDVCPLTLNHLAHIYRE 89

Query: 86  VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNV 145
           +      L    I++DP+RDTPE M ++ + F    +G+SG P  + +VA  F +YV   
Sbjct: 90  LGEPE-QLQVLAISIDPERDTPEAMDRYAKMFHPSFVGLSGPPKAIAKVAAGFFVYVR-- 146

Query: 146 LAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK--DDSDSAIEKINRLITY 196
                  +   ++DHT+ + L D  G I  +   +  +D  + +  +  ++  
Sbjct: 147 ------SDASGYIDHTSTVTLIDPEGRIRVLYGQQLVEDETAMLRDLRAILER 193


>gi|297622535|ref|YP_003703969.1| electron transport protein SCO1/SenC [Truepera radiovictrix DSM
           17093]
 gi|297163715|gb|ADI13426.1| electron transport protein SCO1/SenC [Truepera radiovictrix DSM
           17093]
          Length = 202

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/202 (21%), Positives = 80/202 (39%), Gaps = 17/202 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD-------GNRRFNSDVHLVAQDGTDFSLSSL 54
           +   +    ++ A++ + ++    +            N    +   L    G   +L + 
Sbjct: 8   RFWWLAALGVVAALVAAFSWGQLRADAAPTLHGTALDNPPLVAPFELTNARGERVTLEAW 67

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFV 114
             +  +VFFGFT+C  VCP TL RL ++ + +      +    ITVDP+ DTPEV +++ 
Sbjct: 68  RGELLLVFFGFTSCPDVCPLTLGRLAKIYEDLGEPE-DVQVVMITVDPEHDTPEVTQRYA 126

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
           + F    +G+SG   D+   AK F +    +         +    HT  + L D  G + 
Sbjct: 127 EAFHPDFVGLSGSTADIAEAAKRFYVGYREL--------GERSFLHTDTVALLDREGRLR 178

Query: 175 GVIPYKDDSDSAIEKINRLITY 196
            V             +  ++  
Sbjct: 179 LVYGQD-KVARIGSDLKTILAQ 199


>gi|52840658|ref|YP_094457.1| SCO1/SenC family protein [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52627769|gb|AAU26510.1| hypothetical, SCO1/SenC family protein [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 213

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 47/203 (23%), Positives = 87/203 (42%), Gaps = 10/203 (4%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSK--------FVDGNRRFNSDVHLVAQDGTDFSLSSL 54
            + ++    LLA +       F  K            N R  ++  L   D   F  SSL
Sbjct: 11  TITVLALVSLLAGIYISQNFHFKKKINVADFHGTYLENPRTVNNFSLTGTDQKVFDNSSL 70

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKK 112
             + ++VFFGFTNC  +CPTT++ L ++ +  +      L     I++DP+RD+ + +  
Sbjct: 71  QGRWTLVFFGFTNCGYLCPTTMAELGKMYRILEKKGVKNLPQVVMISIDPQRDSLDKLGS 130

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V  F     G  G+   +  +     I    + +++S   E Y + H+ A++LF+  G 
Sbjct: 131 YVTSFHKSFYGARGEEDSIKSMTHEMGIAYAKINSKESSEPENYDIQHSGAVMLFNPQGE 190

Query: 173 IVGVIPYKDDSDSAIEKINRLIT 195
           +         +D   +    L++
Sbjct: 191 LNAFFTTPHHADLLAKDYVLLVS 213


>gi|332037338|gb|EGI73793.1| SCO1/SenC protein (copper-binding protein) [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 205

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 47/184 (25%), Positives = 87/184 (47%), Gaps = 8/184 (4%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSS---KFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK L + L  IL+  L + +  +        V  N +  SD  L  Q G   +      +
Sbjct: 1   MKQLWLGLIVILVLFLSACSNENSPPDVDALVYENAKPLSDFTLNDQRGELVTKQQFVGQ 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
            ++VF G+T+C  +CP TL++L+ + K +      L  +F++VDPKRDTP   K+++  F
Sbjct: 61  WNLVFLGYTSCPDICPLTLAKLNAVYKNLQA-DYPLQIWFLSVDPKRDTPAKRKQYIDYF 119

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           +   + +SG+   +  V +   +            E +Y VDH+ ++ + D  G++  + 
Sbjct: 120 NPDFLAVSGEHKHLFPVVRELGLIYAI----SDSSESEYAVDHSASVAMVDQNGAVRAIF 175

Query: 178 PYKD 181
             + 
Sbjct: 176 KPEF 179


>gi|163781925|ref|ZP_02176925.1| hypothetical protein HG1285_03543 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883145|gb|EDP76649.1| hypothetical protein HG1285_03543 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 222

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 50/196 (25%), Positives = 86/196 (43%), Gaps = 12/196 (6%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGT---DFSLSSLYIKPSI 60
           L  +L   L+  LGS +     +  V        +  L   +G    +  LS L  +  +
Sbjct: 27  LIPLLIITLMLYLGSCSQEGNYNGLVSDESPE--NFCLKGWNGRSEREVCLSDLKGRAVV 84

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +FFG+T C  VCP T+  L R  +   +     +   FI++DP+RD+P  ++++   F +
Sbjct: 85  LFFGYTRCPDVCPRTMDLLSRTFRGIPEDMRDGVAVLFISLDPERDSPRHVQRYAGFFGE 144

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP- 178
             +G++G   +V RVA+ F +          G    Y ++HT  + L    G  + V P 
Sbjct: 145 GFVGLTGGVEEVGRVARKFGVLYEK-----EGSGGSYTINHTALIYLISPDGERMLVYPI 199

Query: 179 YKDDSDSAIEKINRLI 194
            K   +     I +LI
Sbjct: 200 AKQKPELIRADIEKLI 215


>gi|319787544|ref|YP_004147019.1| electron transporter SCO1/SenC [Pseudoxanthomonas suwonensis 11-1]
 gi|317466056|gb|ADV27788.1| electron transport protein SCO1/SenC [Pseudoxanthomonas suwonensis
           11-1]
          Length = 217

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/180 (23%), Positives = 75/180 (41%), Gaps = 3/180 (1%)

Query: 17  GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTL 76
            + A  +  +  +    R     +L   DGT      L    ++VF GFT C  VCPTTL
Sbjct: 31  AAPAGPALQTVTLLPQPRELPPFNLRQSDGTPLLPGELAGHWTLVFLGFTFCPDVCPTTL 90

Query: 77  SRLDRLLKQVD--PTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRV 134
           + L    K+ +  P        F++VDP+RDTP    ++ + F    +  + D   + + 
Sbjct: 91  AELAGAQKEWESLPESVRPRVLFVSVDPERDTPAKAGEYARAFHPDSLAATADVPALEKF 150

Query: 135 AKNFRIYVNNVLAEKSGV-EEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
           A +       V  +      + Y VDH+  + + D+ G + G+I       +    ++ L
Sbjct: 151 ATSLGFVFMKVPGKTFDENPQDYSVDHSANIAVLDSQGRLAGLIRPPFQPQAIAADLSLL 210


>gi|320449162|ref|YP_004201258.1| electron transport protein SCO1/SenC [Thermus scotoductus SA-01]
 gi|320149331|gb|ADW20709.1| electron transport protein SCO1/SenC [Thermus scotoductus SA-01]
          Length = 196

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 86/184 (46%), Gaps = 11/184 (5%)

Query: 14  AVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCP 73
            +L   ++  + ++ ++       D  L    G    LS L  K  ++FFG+ +C  VCP
Sbjct: 21  LLLPKGSHAFYGTRLLNPKPV---DFTLEGPQG-PVQLSQLRGKLVLIFFGYVHCPDVCP 76

Query: 74  TTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVM 132
           TT+  L R  ++        +   FI+VDP+RDTP++  ++ + F    +G++G P  + 
Sbjct: 77  TTMLALKRAYEKLSPKEQERVQVIFISVDPERDTPQISDQYAKGFHPSFLGLTGSPETIQ 136

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK--DDSDSAIEKI 190
            VA+ F +Y       +     +Y VDHT    +    G++V +      ++++  +  +
Sbjct: 137 EVARTFGVYYQK---TQYRGPGEYLVDHTATTFVV-KEGNLVLLFSPDKVEETEKVVGDL 192

Query: 191 NRLI 194
             L+
Sbjct: 193 RALL 196


>gi|117620111|ref|YP_854719.1| SCO1/SenC family protein [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117561518|gb|ABK38466.1| SCO1/SenC family protein [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 228

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 38/181 (20%), Positives = 73/181 (40%), Gaps = 8/181 (4%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNS----DVHLVAQDGTDFSLSSLYIKPSIVF 62
           +L  +L+  + +  Y +  S     +               QDG  F  +SL    + +F
Sbjct: 28  LLFLLLVGGMMAGFYWNQPSLPEHADYYPAGRDINPFAFTDQDGQPFVPASLTGHWTFLF 87

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
            G+T C  +CPTTL+ L  +  ++          FI+ DP+RD    +K +   F+    
Sbjct: 88  VGYTFCPDICPTTLADLRSVYPELKKIAPNSQVVFISADPQRDDVARLKTYTAFFNPEFK 147

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
             +G    +    +N  +  +         E+ Y +DH+ +++L + AG +  V   +  
Sbjct: 148 AATGPHDKLFPFVRNLGLIYSIADQG----EKDYLIDHSASIVLINPAGKLEAVFRPRLS 203

Query: 183 S 183
            
Sbjct: 204 E 204


>gi|54296449|ref|YP_122818.1| hypothetical protein lpp0480 [Legionella pneumophila str. Paris]
 gi|148360970|ref|YP_001252177.1| SCO1/SenC family transporter protein [Legionella pneumophila str.
           Corby]
 gi|296105964|ref|YP_003617664.1| putative protein SCO1/SenC/PrrC, involved in biogenesis of
           respiratory and photosynthetic systems [Legionella
           pneumophila 2300/99 Alcoy]
 gi|53750234|emb|CAH11628.1| hypothetical protein lpp0480 [Legionella pneumophila str. Paris]
 gi|148282743|gb|ABQ56831.1| hypothetical, SCO1/SenC family protein [Legionella pneumophila str.
           Corby]
 gi|295647865|gb|ADG23712.1| putative protein SCO1/SenC/PrrC, involved in biogenesis of
           respiratory and photosynthetic systems [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 213

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 47/203 (23%), Positives = 87/203 (42%), Gaps = 10/203 (4%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSK--------FVDGNRRFNSDVHLVAQDGTDFSLSSL 54
            + ++    LLA +       F  K            N R  ++  L   D   F+ SSL
Sbjct: 11  TITVLALVSLLAGIYISQNFHFKKKINVADFHGTYLENPRTVNNFSLTGTDQKAFNNSSL 70

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKK 112
             + ++VFFGFTNC  +CPTT++ L ++ +  +      L     I++DP+RD+ + +  
Sbjct: 71  QGRWTLVFFGFTNCGYLCPTTMAELGKMYRILEKKGVKNLPQVVMISIDPQRDSLDKLGS 130

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V  F     G  G+   +  +     I    +  ++S   E Y + H+ A++LF+  G 
Sbjct: 131 YVTSFHKSFYGARGEEDSIKSMTHEMGIAYAKINNKESSEPENYDIQHSGAVMLFNPQGE 190

Query: 173 IVGVIPYKDDSDSAIEKINRLIT 195
           +         +D   +    L++
Sbjct: 191 LNAFFTTPHHADLLAKDYVLLVS 213


>gi|90019694|ref|YP_525521.1| hypothetical protein Sde_0045 [Saccharophagus degradans 2-40]
 gi|89949294|gb|ABD79309.1| electron transport protein SCO1/SenC [Saccharophagus degradans
           2-40]
          Length = 219

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 45/207 (21%), Positives = 89/207 (42%), Gaps = 18/207 (8%)

Query: 3   ALGIILGTILLAVLGSIA-------------YVSFSSKFVDGNRRFNSDVHLVAQDGTDF 49
              +I     + ++ S+               +  +        R   D +LV Q+   +
Sbjct: 13  KYTVIAAVAFMVIVLSLFMNKILQPRILSDQQLRANGAIEFDTARIIRDFNLVDQNNQPY 72

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           +L +L  K ++++FGFT+C  +CPTTL +L +++               +T DP RDTPE
Sbjct: 73  TLEALKGKWTLIYFGFTHCPDICPTTLMQLSKVVNSLEPEIKANTQVLMVTADPARDTPE 132

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K +++ F+     I+G+ + V R+A +  +  N V+ +       Y +DH+  L+L +
Sbjct: 133 KLKIYIEHFNKDFNAITGEFLAVKRLAGDLNVAFNKVMLDN----GDYTIDHSGNLILIN 188

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLIT 195
             G   G      +          +++
Sbjct: 189 PHGHYHGFFKPPFELAKLKLTYQSIVS 215


>gi|330831581|ref|YP_004394533.1| Electron transport protein SCO1/SenC [Aeromonas veronii B565]
 gi|328806717|gb|AEB51916.1| Electron transport protein SCO1/SenC [Aeromonas veronii B565]
          Length = 208

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 73/194 (37%), Gaps = 12/194 (6%)

Query: 10  TILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCS 69
             L+ V  +               R  +D      D   F+ ++L    + +F G+T C 
Sbjct: 15  ACLILVFYATQPEQPEQADYYPAGRDINDFAFTDADNQPFTPANLKGHWTFLFVGYTFCP 74

Query: 70  AVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPI 129
            +CPTTL+ +  +  Q+          FI+ DP+RD    +K +   F+      +    
Sbjct: 75  DICPTTLADMRSVYDQLKKMAPDSQVVFISADPQRDDIPRLKTYTAFFNSEFKAATAPHD 134

Query: 130 DVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS------ 183
            +    +N  +  +      +  E+ Y +DH+ +++L +  G +  V   +         
Sbjct: 135 KLFPFVRNLGLIYSI----ANQGEKDYLIDHSASIVLINPKGKLQAVFRPQVAPGQVPRV 190

Query: 184 --DSAIEKINRLIT 195
              + +   +R++ 
Sbjct: 191 QMATMLSDFSRILK 204


>gi|307945583|ref|ZP_07660919.1| putative SCO2-like protein [Roseibium sp. TrichSKD4]
 gi|307771456|gb|EFO30681.1| putative SCO2-like protein [Roseibium sp. TrichSKD4]
          Length = 261

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 80/180 (44%), Gaps = 4/180 (2%)

Query: 17  GSIAYVSFSSKFVDGNR-RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT 75
             ++  +  S           ++  L+  +G   +    + K   +FFG+ +C A+C   
Sbjct: 80  SFVSEDAAPSGPKTPFPIDLQAEFDLIDHNGNRRTAEDFHGKTYALFFGYASCEAICSAV 139

Query: 76  LSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVA 135
           L  +   ++ +D  G+ +    I++DP RDTP+ M++ + ++   +IG++G   ++ +  
Sbjct: 140 LPDIANAMEVLDEEGSPVETVMISIDPDRDTPDAMRQNLAKWHPDLIGLTGPKDELAKAR 199

Query: 136 KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           + F++    V  +++G        H + + L    G +  ++P     +   + I   +T
Sbjct: 200 ELFQVNRTEVARDENGEP---IYAHGSLVYLIGPDGRLQTILPPVFSPEHLAKVIRGYVT 256


>gi|54293407|ref|YP_125822.1| hypothetical protein lpl0456 [Legionella pneumophila str. Lens]
 gi|53753239|emb|CAH14686.1| hypothetical protein lpl0456 [Legionella pneumophila str. Lens]
 gi|307609222|emb|CBW98686.1| hypothetical protein LPW_04951 [Legionella pneumophila 130b]
          Length = 213

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 47/203 (23%), Positives = 86/203 (42%), Gaps = 10/203 (4%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSK--------FVDGNRRFNSDVHLVAQDGTDFSLSSL 54
            + ++    LLA +       F  K            N R  ++  L   D   F  SSL
Sbjct: 11  TITVLALVSLLAGIYISQNFHFKKKINVADFHGTYLENPRTVNNFSLTGTDQKVFDNSSL 70

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLK--QVDPTGTLLNAYFITVDPKRDTPEVMKK 112
             + ++VFFGFTNC  +CPTT++ L ++ +  +      L     I++DP+RD+ + +  
Sbjct: 71  QGRWTLVFFGFTNCGYLCPTTMAELGKMYRILEKKGVKNLPQVVMISIDPQRDSLDKLGS 130

Query: 113 FVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGS 172
           +V  F     G  G+   +  +     I    +  ++S   E Y + H+ A++LF+  G 
Sbjct: 131 YVTSFHKSFYGARGEEDSIKSMTHEMGIAYAKINNKESSEPENYDIQHSGAVMLFNPQGE 190

Query: 173 IVGVIPYKDDSDSAIEKINRLIT 195
           +         +D   +    L++
Sbjct: 191 LNAFFTTPHHADLLAKDYILLVS 213


>gi|117922431|ref|YP_871623.1| electron transport protein SCO1/SenC [Shewanella sp. ANA-3]
 gi|117614763|gb|ABK50217.1| electron transport protein SCO1/SenC [Shewanella sp. ANA-3]
          Length = 219

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 84/184 (45%), Gaps = 14/184 (7%)

Query: 5   GIILGTILLAVLGSIAYVSFS--------SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
            I++  ILL  LG +  V F+        S F+       +   LV Q    F+ ++L  
Sbjct: 14  KILVIAILLIGLGGLFAVKFNPPKPVELESGFLFPEAFELAPFELVDQQQKPFTNANLND 73

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           + S+ F GFT C  VCPTTL++L     ++      +   F++VDPKRDTPE +  +V  
Sbjct: 74  QWSLFFIGFTYCPDVCPTTLNKLAAAYPELKKIA-PIQIVFLSVDPKRDTPEKLLTYVNF 132

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F+     ++G+   +  + ++  +    V     G  + Y VDH+   +L    G+ V V
Sbjct: 133 FNPEFKAVTGEQTQIFPLTRSLGLTYAMV-----GEGDNYQVDHSAGYVLVSPQGTRVAV 187

Query: 177 IPYK 180
               
Sbjct: 188 FKPT 191


>gi|224081158|ref|XP_002306313.1| predicted protein [Populus trichocarpa]
 gi|222855762|gb|EEE93309.1| predicted protein [Populus trichocarpa]
          Length = 264

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 86/205 (41%), Gaps = 17/205 (8%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGN------------RRFNSDVHLVAQDGTDFSLS 52
            +++   +L  +G  A+V ++ +                         LV  +    +  
Sbjct: 61  FLVIPAAVLGFVGLAAFVHYNDERRAVPKGQGSDCVNVKGPIIGGPFTLVNTENKVVTEK 120

Query: 53  SLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVMK 111
                  +++FG+T+   + P  L  + + L  ++      +   F+T+DP+RD P  ++
Sbjct: 121 DFLGNWVLLYFGYTSSPDIGPEQLKLITKALNTLESKENLKVLPMFVTLDPQRDNPPHLR 180

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            +++ F  RI+G++G    + ++A+ +R+Y   V  E     + Y V+ +  + L +   
Sbjct: 181 AYLEEFESRIVGLTGPVGAIRQMAQEYRVYFRKVEEE----GDDYLVETSHNMYLINPNM 236

Query: 172 SIVGVIPYKDDSDSAIEKINRLITY 196
            +V     + +++   E I + +  
Sbjct: 237 EVVKCFGVEYNAEELSEAIGKELKR 261


>gi|194367563|ref|YP_002030173.1| electron transport protein SCO1/SenC [Stenotrophomonas maltophilia
           R551-3]
 gi|194350367|gb|ACF53490.1| electron transport protein SCO1/SenC [Stenotrophomonas maltophilia
           R551-3]
          Length = 264

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 44/163 (26%), Positives = 72/163 (44%), Gaps = 3/163 (1%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
                  +    GT      L  + + +FFGFT+C  VCPTT+  L ++   +      L
Sbjct: 80  ELGQQWSMPDSHGTVRGPKDLQGQVTYLFFGFTSCPDVCPTTMVELSQVKHLMGKDADQL 139

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              F++VDP RDTPEV + +V+ F  + I + G+   +  +A +F+ +      +   V 
Sbjct: 140 QVVFVSVDPARDTPEVARTYVEAFDPKAIALVGNEAQLAAMASDFKAFYEKEPGQ---VP 196

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           E Y + H     +FD  G +    PY    D     + RL+  
Sbjct: 197 ETYTMSHIAGGYVFDRQGRLRLFAPYGMPVDKLFSDVQRLLLE 239


>gi|119503602|ref|ZP_01625685.1| GGDEF domain protein [marine gamma proteobacterium HTCC2080]
 gi|119460664|gb|EAW41756.1| GGDEF domain protein [marine gamma proteobacterium HTCC2080]
          Length = 216

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 49/188 (26%), Positives = 90/188 (47%), Gaps = 13/188 (6%)

Query: 4   LGIILGTILLAVL--------GSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLY 55
           + + +  IL++ +         ++  +  +  ++    R      L+   G  F+  SL 
Sbjct: 16  ILLFIAVILVSFVNRIQQPRVMTLTEMQINGLYIFDTPRDPGAFTLLDHRGAPFTKESLK 75

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTG-TLLNAYFITVDPKRDTPEVMKKFV 114
              +++FFGFT+C  +CPTT+S L +L K+++ T         +TVDP RDTPEV+  +V
Sbjct: 76  GDWTLLFFGFTHCPDICPTTMSFLAKLKKELETTEAADTQVVMVTVDPARDTPEVLAAYV 135

Query: 115 QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             F +   G++GD I ++  A++F      V    +  +  Y +DH+  ++L +  G   
Sbjct: 136 PYFDETFTGVTGDFIKILSFARSFNAPFRKV----TAPDGTYELDHSANVVLINPRGDYH 191

Query: 175 GVIPYKDD 182
           G      D
Sbjct: 192 GFFKAPLD 199


>gi|254283915|ref|ZP_04958883.1| hypothetical protein NOR51B_2418 [gamma proteobacterium NOR51-B]
 gi|219680118|gb|EED36467.1| hypothetical protein NOR51B_2418 [gamma proteobacterium NOR51-B]
          Length = 216

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 51/198 (25%), Positives = 82/198 (41%), Gaps = 18/198 (9%)

Query: 3   ALGIILGTILLAVLGSIA-------------YVSFSSKFVDGNRRFNSDVHLVAQDGTDF 49
            L + L  + +AV+                  +  +  F+    R   D  L+  +   F
Sbjct: 10  WLTVALVLLFIAVVLVSFVNRIQQPRIMSATEMRANGLFLFETPRDPGDFSLIDHNEIAF 69

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
               L    +++FFGFT+C  +CPTTLS L  L +Q             ++VDP RDTPE
Sbjct: 70  IPERLEGVWTLLFFGFTHCPDICPTTLSFLADLHEQLASTEAKDTQVVMLSVDPARDTPE 129

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +  +V  F    IG++G+ IDV+  +++F      V  E       Y +DH+  ++L +
Sbjct: 130 RLASYVPYFDPDFIGVTGEFIDVLGFSRSFNAPFRKVTLED----GSYQIDHSANVVLVN 185

Query: 169 TAGSIVGVIPYKDDSDSA 186
             G   G      D    
Sbjct: 186 PRGDFHGFFRAPLDLAKM 203


>gi|331015541|gb|EGH95597.1| SCO1/SenC family protein [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 201

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 86/200 (43%), Gaps = 10/200 (5%)

Query: 1   MKALGIILGTILLAVLGSIAY-----VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLY 55
           M    ++ G  LL++           +++       N+       L   +G    LSS  
Sbjct: 5   MTRRKVVAGIGLLSLSILTGCDTREKLTYKHGKNLSNQILGRSFKLKDTNGDVRMLSSYR 64

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
               +VFFGFT C A+CPT L+R  ++ K +   G  L   FIT+DP+RDTP V+  +V+
Sbjct: 65  GMIPLVFFGFTQCPAICPTALARAVQIKKLMGKDGDRLQVIFITLDPERDTPAVLNAYVK 124

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F    + + G   +    AK F ++   +          Y + H+    ++D  G++  
Sbjct: 125 TFDPSFVALYGTLEETAATAKEFGVFYEKIP-----SGSTYTLSHSATSYVYDIRGTLRL 179

Query: 176 VIPYKDDSDSAIEKINRLIT 195
            +P+   +    E +  ++ 
Sbjct: 180 GLPHSLSAQECAEDLLTVMK 199


>gi|228991240|ref|ZP_04151198.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           pseudomycoides DSM 12442]
 gi|228997338|ref|ZP_04156960.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           mycoides Rock3-17]
 gi|229004963|ref|ZP_04162690.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           mycoides Rock1-4]
 gi|228756311|gb|EEM05629.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           mycoides Rock1-4]
 gi|228762430|gb|EEM11355.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           mycoides Rock3-17]
 gi|228768464|gb|EEM17069.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           pseudomycoides DSM 12442]
          Length = 226

 Score =  101 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 77/200 (38%), Gaps = 11/200 (5%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    ++G I++     +A     SK              + QDG  F    L  K  +
Sbjct: 33  MKRYQKLIGLIVVFCFFILAGCGSGSKLRKPLNWDLETFQYINQDGKKFGTKDLKGKVWV 92

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD- 119
             F FTNC  VCP   + + +L K        +     +VDP+ D PE +K F+Q+F+D 
Sbjct: 93  ADFMFTNCQTVCPPMTANMAKLQKMAKEKKLDVQFVSFSVDPEVDKPENLKAFIQKFTDD 152

Query: 120 --RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
                 ++G  ++ ++       +  +         E   V H T+  L D  G ++   
Sbjct: 153 TKNWNLLTGYSLEDVKK------FAKDNFQTLVDKPENGQVIHGTSFFLVDQEGKVMKQY 206

Query: 178 PY--KDDSDSAIEKINRLIT 195
               K   +  +  + RL+ 
Sbjct: 207 SGISKTPYEDILRDMERLLK 226


>gi|254524832|ref|ZP_05136887.1| electron transport protein SCO1/SenC [Stenotrophomonas sp. SKA14]
 gi|219722423|gb|EED40948.1| electron transport protein SCO1/SenC [Stenotrophomonas sp. SKA14]
          Length = 226

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 42/163 (25%), Positives = 71/163 (43%), Gaps = 3/163 (1%)

Query: 34  RFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLL 93
                  +    GT      L  + + +FFGFT C  VCPTT+  L ++   +      L
Sbjct: 42  ELGQHWSMPDSHGTVRGPEDLQGQVTYLFFGFTRCPDVCPTTMVELSQVKHLMGKDADQL 101

Query: 94  NAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE 153
              F++VDP RDTPEV + +V+ F  + I + G+   +  +A +F+ +      +   + 
Sbjct: 102 QVVFVSVDPARDTPEVARTYVEAFDPKAIALVGNEAQLAAMASDFKAFYEKEPGQ---IP 158

Query: 154 EKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
           + Y + H     +FD  G +    PY    D     + RL+  
Sbjct: 159 QTYTMSHIAGGYVFDRQGRLRLFAPYGMPVDKLFSDVQRLLLE 201


>gi|104782422|ref|YP_608920.1| hypothetical protein PSEEN3378 [Pseudomonas entomophila L48]
 gi|95111409|emb|CAK16129.1| conserved hypothetical protein; putative Sco1/SenC family protein
           [Pseudomonas entomophila L48]
          Length = 202

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 53/174 (30%), Positives = 87/174 (50%), Gaps = 6/174 (3%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           + F       N        L    G + +LSS Y    ++FFGFT C AVCPT L+R+ +
Sbjct: 31  LDFKYGKNMSNEILGRKFKLKDPQGNERTLSSFYGSMPMIFFGFTQCPAVCPTALARVAQ 90

Query: 82  LLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRI 140
           + K        L    FIT+DP+RDTPEV+  + + F   II ++G P ++  VAK FR+
Sbjct: 91  IRKILRGRDRDLFQPVFITLDPERDTPEVLDAYTKAFDPSIIALTGTPEEIAEVAKEFRV 150

Query: 141 YVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           +   V A      + Y + H++   ++DT G++   + +  ++    E +  L+
Sbjct: 151 FYEKVPA-----GDTYTISHSSTSYVYDTRGTLRLSLGHSLNAQECAEDLVTLM 199


>gi|262277982|ref|ZP_06055775.1| electron transport protein SCO1/SenC [alpha proteobacterium
           HIMB114]
 gi|262225085|gb|EEY75544.1| electron transport protein SCO1/SenC [alpha proteobacterium
           HIMB114]
          Length = 212

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 53/206 (25%), Positives = 102/206 (49%), Gaps = 19/206 (9%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFG 64
            I+   ++  V+      +F++K  +  ++   + +L   +G  F+   L  KPS++FFG
Sbjct: 10  RILPSILITTVVLVFIGYNFANKKPNAAQQIQVNFNLQDMNGNQFNQKHLKQKPSLLFFG 69

Query: 65  FTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGI 124
           FT+C  VCP +L  L  L++ + P    +N YF+T DP+RDT +++K+++  F  RI+GI
Sbjct: 70  FTHCPDVCPASLQLLTNLIEDLGPDADKINYYFVTADPERDTTKILKQYLSSFDQRILGI 129

Query: 125 SGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK---- 180
           +G   ++ ++     IY+  V   K      Y +DHT + ++ +     VG + ++    
Sbjct: 130 TGKQDELKKLYNALDIYIQKVDLGK----GNYTIDHTASFMIINKDTEKVGTMMHEGFSK 185

Query: 181 -----------DDSDSAIEKINRLIT 195
                         D  I+ + +L+ 
Sbjct: 186 FIVIDNYGKIQTPKDDVIKNLKKLLQ 211


>gi|84180498|gb|ABC54694.1| major antigenic protein 2 [Ehrlichia sp. P-Mtn]
          Length = 196

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 45/201 (22%), Positives = 81/201 (40%), Gaps = 19/201 (9%)

Query: 8   LGTILLAVLGSIAYVSFSS-----------KFVDGNRRFNSDVHLVAQDGTDFSLSSLYI 56
           L  +  A+    +Y++                +      N++  L  QDG   S      
Sbjct: 1   LCLLFAAIFLGYSYITKQGIFQPKLHNSPDVNISDKADINTNFTLTNQDGITISSKDFLG 60

Query: 57  KPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
           K  +VFFGF++C  +CP  L    ++L Q+      L   FIT+DP RDT   +K+F + 
Sbjct: 61  KHMLVFFGFSSCKTICPMELGLASQVLDQLGNKADKLQIIFITIDPARDTVNTLKEFHKN 120

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F  RI  ++G    +  V + ++ YV          +    +DH+  + +    G  +  
Sbjct: 121 FDSRIQMLTGSIETINEVVRGYKAYVGK-------PDNDNQIDHSGIMYIVGKKGEYLAH 173

Query: 177 IPYKD-DSDSAIEKINRLITY 196
              +    +  ++K+  LI  
Sbjct: 174 FAPELKSQEPQLDKLLSLIKQ 194


>gi|229102847|ref|ZP_04233541.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           Rock3-28]
 gi|228680520|gb|EEL34703.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           Rock3-28]
          Length = 195

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 49/201 (24%), Positives = 78/201 (38%), Gaps = 14/201 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK   I++G +++  L  +A  S S SK                QDG  F    L  K  
Sbjct: 1   MKRYQILIGLMVVFCLFVLAGCSGSGSKLRKPLNWDLETFQFTNQDGKQFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FTNC  VCP   + + +L K        +     +VDP  D PE +K F+Q+F++
Sbjct: 61  VADFMFTNCQTVCPPMTANMAKLQKMAKEEKLDVQFVSFSVDPDLDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                  ++G    D+ + +K+                E   V H T+  L D  G ++ 
Sbjct: 121 DTSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFYLIDQNGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRLI 194
                     +  I  + RL+
Sbjct: 174 KYSGISNTPYEDIIRDMKRLV 194


>gi|296135531|ref|YP_003642773.1| electron transport protein SCO1/SenC [Thiomonas intermedia K12]
 gi|295795653|gb|ADG30443.1| electron transport protein SCO1/SenC [Thiomonas intermedia K12]
          Length = 208

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 84/200 (42%), Gaps = 8/200 (4%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDG--NRRFNSDVHLVA---QDGTDFSLSSLY 55
           M A   +L + L+      A      K+       +    +         G   S     
Sbjct: 1   MVAFKWMLMSALVLAFSGCAQQPHEQKWAMDYIGPKIMQPLQFTDMASSSGKLESSKDFL 60

Query: 56  IKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
            K  +++FG+T+C  VCPTT++ L R  + + P G  +   F+TVDPKRDTP+V+  +V 
Sbjct: 61  GKVVVLYFGYTHCPDVCPTTMAHLARAEQLLGPQGKDVQVIFVTVDPKRDTPKVLDAYVH 120

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F    IG+SG       +A  + +  +     K      Y V+H+ A+ +F   G+   
Sbjct: 121 AFMFSAIGLSGTVAQTKTLAGRYHVSYS---YGKPDAHGNYVVNHSAAIYVFGPHGNGRL 177

Query: 176 VIPYKDDSDSAIEKINRLIT 195
           +       +     +++L+ 
Sbjct: 178 IGTELTPPEGIAHDVHQLLA 197


>gi|307545063|ref|YP_003897542.1| electron transporter [Halomonas elongata DSM 2581]
 gi|307217087|emb|CBV42357.1| K07152 [Halomonas elongata DSM 2581]
          Length = 192

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 52/195 (26%), Positives = 97/195 (49%), Gaps = 5/195 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
           L  +    L  +L      ++ +  + G      +  LV ++G D    +   KP+++FF
Sbjct: 2   LRWMFPLALSVMLAGCVDHNWQTNDITGVMP-ALEFDLVDENGEDVQAEAFIGKPTLLFF 60

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDP-TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           GFT+C  VCPTTL++L   +KQ+D      +   F++VDP RDTP+VMK++ + F  + I
Sbjct: 61  GFTHCPDVCPTTLAKLSAAIKQLDESWQDDVQVLFVSVDPARDTPDVMKQYTEAFGPQFI 120

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
           G+SGD   +  +   +R+        +      Y V H++++  FD  G    +    + 
Sbjct: 121 GLSGDLAKIDALTNRYRVTYE---YGEKDARGHYNVSHSSSVFAFDRQGEARFMFSDINS 177

Query: 183 SDSAIEKINRLITYG 197
            ++ +  ++ L+ +G
Sbjct: 178 LEALVGDLSYLMEHG 192


>gi|312795556|ref|YP_004028478.1| SCO2 PROTEIN PRECURSOR [Burkholderia rhizoxinica HKI 454]
 gi|312167331|emb|CBW74334.1| SCO2 PROTEIN PRECURSOR [Burkholderia rhizoxinica HKI 454]
          Length = 223

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/195 (27%), Positives = 91/195 (46%), Gaps = 6/195 (3%)

Query: 5   GIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSD--VHLVAQDGTDFSLSSLYIKPSIVF 62
            ++   + L V  S          +        D    L A +G   S +S   K ++VF
Sbjct: 30  TVLAACVGLLVTLSACTRDNGQWKLTNVSGHLPDLGFSLQADNGQTVSGASFAGKTTLVF 89

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD-RI 121
           FG+T+C  VCP T++RL ++++Q+      +   FI+VDP RDTP+ +  +VQ F    +
Sbjct: 90  FGYTHCPDVCPETMARLMQVVEQLGDDARDVRILFISVDPHRDTPQTLHTYVQAFDPQHV 149

Query: 122 IGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKD 181
           +G+SG    +  +A+ +R+      AEK      Y V H++A+ +FD  G    +    D
Sbjct: 150 VGLSGSEKQIANLARRYRVAYQ---AEKPDGNGSYEVTHSSAVYVFDRTGRARLLATASD 206

Query: 182 DSDSAIEKINRLITY 196
            ++     +  LI  
Sbjct: 207 SANMITNDLKHLIKQ 221


>gi|194017041|ref|ZP_03055654.1| antioxidant, AhpC/TSA family [Bacillus pumilus ATCC 7061]
 gi|194011647|gb|EDW21216.1| antioxidant, AhpC/TSA family [Bacillus pumilus ATCC 7061]
          Length = 196

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/202 (21%), Positives = 74/202 (36%), Gaps = 15/202 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           +K  G  LG +++  +  +   S        N +         QDG   SL  L  K  +
Sbjct: 2   LKKRGASLGALMIISVLLLVSCSNGQIKDALNYQIQ-PFEYENQDGQKVSLDDLKGKVWV 60

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF--- 117
             F FT+C  +CP   + +  L K++       +    +VDP+ D+P+ +K+F + +   
Sbjct: 61  ADFIFTSCETICPPMTAHMTELQKRLKEEKLDAHIISFSVDPEVDSPKKLKEFAKAYPLS 120

Query: 118 SDRIIGISGDPID--VMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                 ++G           K+F+  V     E         V H +   L D  G ++ 
Sbjct: 121 FKNWDFLTGYSQSAIEKFAMKSFKTIVKKPEDED-------QVIHQSLFFLVDQEGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRLIT 195
                     D  I+ I  LI 
Sbjct: 174 NYDGVQNTPYDDIIKDIKTLIR 195


>gi|315646205|ref|ZP_07899325.1| hypothetical protein PVOR_12330 [Paenibacillus vortex V453]
 gi|315278404|gb|EFU41720.1| hypothetical protein PVOR_12330 [Paenibacillus vortex V453]
          Length = 186

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/183 (22%), Positives = 71/183 (38%), Gaps = 6/183 (3%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK + +I   +L+ ++ +    S  S+     +        + QD  + SL+ L  K  I
Sbjct: 1   MKKIMLIGVLMLVLLVAAACGNSKPSQLSIPVQ----PFEYINQDEEEVSLADLKGKVWI 56

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120
             F FT C  VCPT  + +  L +++   G        +VDP+RD P  +K ++ +F   
Sbjct: 57  ADFVFTRCITVCPTMTANMAELQQRLSDAGLEATLVSFSVDPERDEPAALKSYLGKFDAN 116

Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180
                          K+F +             +   V H T+  L D +G++V      
Sbjct: 117 FTNWHALTGYTFEDIKSFVLQSFKAPIAMDTAAD--QVIHGTSFYLIDQSGTVVAKYDGN 174

Query: 181 DDS 183
            D 
Sbjct: 175 MDP 177


>gi|77456298|ref|YP_345803.1| electron transport protein SCO1/SenC [Pseudomonas fluorescens
           Pf0-1]
 gi|77380301|gb|ABA71814.1| putative copper-binding protein [Pseudomonas fluorescens Pf0-1]
          Length = 211

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/209 (22%), Positives = 89/209 (42%), Gaps = 18/209 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF------------NSDVHLVAQDGTDF 49
           K + I++  I L +  ++  V       D                   DV +  QDG   
Sbjct: 6   KTVFILVAVIALILGLTVNKVLSGKGQGDPTALIDAGIILLPQSRNLPDVTMTNQDGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           +++ L  K S++FFG+T C  +CPTTL++L ++  +        L    ++VDP RD P 
Sbjct: 66  TVNELKGKWSLLFFGYTFCPDICPTTLAQLRQIKSELPKDAVDKLQIVLVSVDPNRDNPA 125

Query: 109 VMKKFVQRFSDRIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
            +K+++  F  + IG++     ++ +VA    I        K      Y VDH+  L + 
Sbjct: 126 QLKQYLGYFDPQFIGLTPKSIDELQKVANAVSIPFIPADTSKP----NYTVDHSGNLAVI 181

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITY 196
              G+  G I    ++   + ++  ++  
Sbjct: 182 GPDGTQRGFIRAPLNNAKLVAQLPVMLNR 210


>gi|114320026|ref|YP_741709.1| electron transport protein SCO1/SenC [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226420|gb|ABI56219.1| electron transport protein SCO1/SenC [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 207

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/182 (24%), Positives = 84/182 (46%), Gaps = 7/182 (3%)

Query: 14  AVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCP 73
              G+       + +++G R   +   LV Q    F    L  + + +FFGFT+C  +CP
Sbjct: 25  MGAGTPEPPETEATWLEGGRAI-TPFELVDQHERPFDNRRLEGQWTFMFFGFTHCPDICP 83

Query: 74  TTLSRLDRLLKQVDP--TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDV 131
            +L+ ++R+   +        L   F++VDP RDTPE +K++V  F +  +G++G+   V
Sbjct: 84  MSLAAMNRIETLLAETGDDEDLQVVFVSVDPDRDTPERLKEYVGWFGEDYLGVTGEMDKV 143

Query: 132 MRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKIN 191
             + +N  I              +Y +DH+   LL +  G +  + PY    +S +    
Sbjct: 144 EVLTRNLGIVHARHDTG----GGEYQIDHSAQFLLINPGGHLQAIFPYPHAPESIVADFR 199

Query: 192 RL 193
           ++
Sbjct: 200 QM 201


>gi|299536879|ref|ZP_07050186.1| Putative copper metallochaperone [Lysinibacillus fusiformis ZC1]
 gi|298727703|gb|EFI68271.1| Putative copper metallochaperone [Lysinibacillus fusiformis ZC1]
          Length = 202

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/207 (21%), Positives = 78/207 (37%), Gaps = 18/207 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK    ++G +LL    S+     +SKF         D   V Q G   SL SL  KP I
Sbjct: 1   MKR--KLIGLVLLLACASVLGACGNSKFKADYSLEIPDFEHVNQRGETVSLESLKGKPWI 58

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS- 118
             + FTNC ++CP     + ++ ++         N    +VDP  D P+V+  ++ +++ 
Sbjct: 59  GMYIFTNCVSICPPMSLNMAQVQEKLQKKGVEDYNIVAFSVDPDVDQPDVLANYLSKYNV 118

Query: 119 ---DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
               +   ++G      +  + F +    +L +     +   V H     L D  G +V 
Sbjct: 119 PDKSKWNLLTG---YSQKYIEQFAVKNTKILVKNDPNSD--QVIHGNQFFLVDKDGVLVK 173

Query: 176 VIPY------KDDSDSAIEKINRLITY 196
           +             D+    I   I  
Sbjct: 174 MYNGYAENIEDVPIDTIASDIETYIDE 200


>gi|71734791|ref|YP_275073.1| Sco1/SenC family protein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|257485991|ref|ZP_05640032.1| Sco1/SenC family protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|71555344|gb|AAZ34555.1| Sco1/SenC family protein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|320323566|gb|EFW79650.1| Sco1/SenC family protein [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320328198|gb|EFW84202.1| Sco1/SenC family protein [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330880155|gb|EGH14304.1| Sco1/SenC family protein [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330890878|gb|EGH23539.1| Sco1/SenC family protein [Pseudomonas syringae pv. mori str.
           301020]
 gi|330986051|gb|EGH84154.1| Sco1/SenC family protein [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331010356|gb|EGH90412.1| Sco1/SenC family protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 201

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 50/179 (27%), Positives = 82/179 (45%), Gaps = 5/179 (2%)

Query: 16  LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT 75
            G+   + F       N     +  L    G   +LSS      ++FFGFT C A+CPT 
Sbjct: 25  CGNSNALPFKHGKDMSNEIVGRNFRLKDAQGNVKTLSSFRGLMPMIFFGFTQCPAICPTA 84

Query: 76  LSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVA 135
           L+R  ++ K +   G  L   FIT+DP+RDTPEV+  +V+ F    + +SG   +    A
Sbjct: 85  LARAAQIRKLMGEEGKTLQVVFITLDPERDTPEVIDAYVKAFDPTFVALSGTLEETAATA 144

Query: 136 KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           K F ++   V        + Y + HT    ++DT G +   + ++  +    E +  L+
Sbjct: 145 KEFGVFFEKVPL-----GDTYTISHTATSYVYDTRGVLRLGLSHRLSAQQCTEDLLTLM 198


>gi|213969926|ref|ZP_03398059.1| Sco1/SenC family protein [Pseudomonas syringae pv. tomato T1]
 gi|301382200|ref|ZP_07230618.1| Sco1/SenC family protein [Pseudomonas syringae pv. tomato Max13]
 gi|302061343|ref|ZP_07252884.1| Sco1/SenC family protein [Pseudomonas syringae pv. tomato K40]
 gi|302134281|ref|ZP_07260271.1| Sco1/SenC family protein [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213925251|gb|EEB58813.1| Sco1/SenC family protein [Pseudomonas syringae pv. tomato T1]
          Length = 201

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 49/179 (27%), Positives = 83/179 (46%), Gaps = 5/179 (2%)

Query: 16  LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT 75
            G+   + F       N     +  L    G   +LSS      ++FFGFT C A+CPT 
Sbjct: 25  CGNSNALPFKHGKDMSNEIVGRNFRLKDSQGNVKTLSSFRGLMPMIFFGFTQCPAICPTA 84

Query: 76  LSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVA 135
           L+R  ++ K +   G  L   FIT+DP+RDTP+V+  +V+ F    + +SG   + +  A
Sbjct: 85  LARAAQIRKLMGEEGKTLQVVFITLDPERDTPDVIDAYVKAFDPTFVALSGTLEETVATA 144

Query: 136 KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           K F ++   V        + Y + HT    ++DT G +   + ++  +    E +  L+
Sbjct: 145 KEFGVFFEKVPL-----GDTYTISHTATSYVYDTRGVLRLGLSHRLSAQQCTEDLLTLM 198


>gi|289207229|ref|YP_003459295.1| electron transporter SCO1/SenC [Thioalkalivibrio sp. K90mix]
 gi|288942860|gb|ADC70559.1| electron transport protein SCO1/SenC [Thioalkalivibrio sp. K90mix]
          Length = 215

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/208 (18%), Positives = 80/208 (38%), Gaps = 20/208 (9%)

Query: 1   MKAL---GIILGTILLAVLGSIAYVSFSSKFVDG------------NRRFNSDVHL-VAQ 44
           M  +    +     ++A    + YV+                    +      + L +A 
Sbjct: 1   MNRIPVSSLFWAFAVVAAGALLVYVTLEPGEPPPRDLAGHAQLPIADEVQGGPIELPIAT 60

Query: 45  DGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT-LSRLDRLLKQVDPTGTLLNAYFITVDPK 103
               F L     +   ++FG+T+C   CPT+       L +  +     +N  FI+VDP+
Sbjct: 61  HAERFDLGDYTDQYVWLYFGYTSCPDACPTSLGWIGGALNRLPEELQGQVNGVFISVDPE 120

Query: 104 RDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTA 163
           RDT + +  +V  F   I   +G   D+   AK + ++      + +  +    +DH+++
Sbjct: 121 RDTEDRLADYVAHFHADIHAATGSEEDLKPAAKRYGVFYERRATDSAMGD---IIDHSSS 177

Query: 164 LLLFDTAGSIVGVIPYKDDSDSAIEKIN 191
             L    G ++ + P+   +   +E + 
Sbjct: 178 TYLIGPEGDLLEIHPHGTSAADLVETLR 205


>gi|114798829|ref|YP_762070.1| SCO1/SenC family protein [Hyphomonas neptunium ATCC 15444]
 gi|114739003|gb|ABI77128.1| SCO1/SenC family protein [Hyphomonas neptunium ATCC 15444]
          Length = 246

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 44/207 (21%), Positives = 83/207 (40%), Gaps = 16/207 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNR------------RFNSDVHLVAQDGTD 48
           M +   +    LLA  G     +     +  +                  + L+   G  
Sbjct: 41  MSSAFAVPALFLLAACGPTEAPASGGSAIASSGGLTSGCASRAYTEIGGPISLIDDTGAR 100

Query: 49  FSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPE 108
            +  +   +P++++FGFT C  VCP  LS L    +++    T      I+VDP+RDTPE
Sbjct: 101 VTEETYKGQPTVIYFGFTYCPDVCPAALSTLGAAYRRLPEGETAPQTLLISVDPERDTPE 160

Query: 109 VMKKFV--QRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLL 166
            +  +V    F   + G++G P ++   A  F+     +  E+     +Y +DHT  + +
Sbjct: 161 ALATYVTTPAFPAGLTGLTGSPEEIRATADAFKADYARI--EQPESLAEYTMDHTNLIYV 218

Query: 167 FDTAGSIVGVIPYKDDSDSAIEKINRL 193
            D    +     ++D  ++    +  L
Sbjct: 219 MDEDWQLKTFFTHEDTPETISACLAEL 245


>gi|298487363|ref|ZP_07005411.1| Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative
           copper metallochaperone [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298158166|gb|EFH99238.1| Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative
           copper metallochaperone [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 201

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 50/179 (27%), Positives = 82/179 (45%), Gaps = 5/179 (2%)

Query: 16  LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT 75
            G+   + F       N     +  L    G   +LSS      ++FFGFT C A+CPT 
Sbjct: 25  CGNSNALPFKHGKDMSNEIVGRNFRLKDAQGNVKTLSSFRGLMPMIFFGFTQCPAICPTA 84

Query: 76  LSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVA 135
           L+R  ++ K +   G  L   FIT+DP+RDTPEV+  +V+ F    + +SG   +    A
Sbjct: 85  LARAAQIRKLMGEEGKTLQVVFITLDPERDTPEVIDAYVKAFDPTFVALSGTLEETAAAA 144

Query: 136 KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           K F ++   V        + Y + HT    ++DT G +   + ++  +    E +  L+
Sbjct: 145 KEFGVFFEKVPL-----GDTYTISHTATSYVYDTRGVLRLGLSHRLSAQQCTEDLLTLM 198


>gi|311692974|gb|ADP95847.1| electron transport protein SCO1/SenC [marine bacterium HP15]
          Length = 190

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/194 (24%), Positives = 88/194 (45%), Gaps = 6/194 (3%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
           ++  ILL          +    + G      +  L+   G   S      +  ++FFGFT
Sbjct: 1   MMLAILLVGCMGDDAPDWHGTDISGVMPKL-EFDLIDSQGAPVSGDDYSGQVRMLFFGFT 59

Query: 67  NCSAVCPTTLSRLDRLLK-QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGIS 125
           +C  VCPT L +L + +          +   F++VDP+RDTPE + ++V  F +RI+G++
Sbjct: 60  SCPDVCPTALQKLSQAVSGLSPENQEEVLTLFVSVDPQRDTPERLAEYVNFFGERIVGLT 119

Query: 126 GDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY-KDDSD 184
           G   D+  + + +R    +   E+   E  Y V H+ A+ +FD  G+   +I      + 
Sbjct: 120 GKTSDLRTLTQRYRTTFGH---EEPDAEGDYAVTHSGAVYVFDREGNPRLLIRPEDLSAQ 176

Query: 185 SAIEKINRLITYGN 198
           +  + +  L+   +
Sbjct: 177 AIRQDLVALLEESS 190


>gi|229587645|ref|YP_002869764.1| putative copper-binding protein [Pseudomonas fluorescens SBW25]
 gi|229359511|emb|CAY46352.1| putative copper-binding protein [Pseudomonas fluorescens SBW25]
          Length = 211

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 51/209 (24%), Positives = 88/209 (42%), Gaps = 19/209 (9%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKF-------------VDGNRRFNSDVHLVAQDGTDF 49
               IL  I+  ++G       S K              +    R    V +  Q+G   
Sbjct: 6   KTVFILVAIVALIMGLTVNKVLSGKGQGDPTALIDAGIILLPQSRQLPPVTMTNQEGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
            ++ L  K S++FFG+T C  +CPTTL++L ++  +        L    ++VDP RDTP 
Sbjct: 66  VVNELKGKWSLLFFGYTFCPDICPTTLAQLRQIKSELPKDVVDKLQVILVSVDPNRDTPT 125

Query: 109 VMKKFVQRFSDRIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
            +K+++  F  +  G++G +  DV +V+    I        K      Y VDH+  L L 
Sbjct: 126 QLKQYLGYFDPQFQGLTGANVEDVQKVSNAVSIPFIPADTSKP----NYTVDHSGNLALI 181

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITY 196
              G+  G I    ++   + ++  L+  
Sbjct: 182 GPDGTQRGFIRAPLNNQKLVAQLPGLLKR 210


>gi|302809805|ref|XP_002986595.1| hypothetical protein SELMODRAFT_124298 [Selaginella moellendorffii]
 gi|300145778|gb|EFJ12452.1| hypothetical protein SELMODRAFT_124298 [Selaginella moellendorffii]
          Length = 165

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/162 (24%), Positives = 74/162 (45%), Gaps = 7/162 (4%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
                 L+ Q G   S S  + K S+++ G+T+C   CP  L ++  ++ Q+      + 
Sbjct: 1   VGGPFSLLDQSGKVVSNSDFFGKWSLIYIGYTHCPEDCPRQLEKIASVVHQLGK---SIV 57

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FIT DP+RD    +K +++ F    +G++G P DV  V   FR +      +      
Sbjct: 58  PIFITADPERDNAVQLKHYLREFHPGFVGLTGKPSDVRPVLWKFRAFFRKTDED----RS 113

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            Y V+H++ + L +T    + V   +    + ++ I + +T 
Sbjct: 114 DYLVEHSSNVYLMNTKMECIKVFGPEYHDKALVDAITKEMTK 155


>gi|302763691|ref|XP_002965267.1| hypothetical protein SELMODRAFT_82855 [Selaginella moellendorffii]
 gi|300167500|gb|EFJ34105.1| hypothetical protein SELMODRAFT_82855 [Selaginella moellendorffii]
          Length = 165

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/162 (24%), Positives = 74/162 (45%), Gaps = 7/162 (4%)

Query: 35  FNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLN 94
                 L+ Q G   S S  + K S+++ G+T+C   CP  L ++  ++ Q+      + 
Sbjct: 1   VGGPFSLLDQSGKVVSNSDFFGKWSLIYIGYTHCPEDCPRQLEKIASVVHQLGK---SIV 57

Query: 95  AYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEE 154
             FIT DP+RD    +K +++ F    +G++G P DV  V   FR +      +      
Sbjct: 58  PIFITADPERDNTVQLKHYLREFHPGFVGLTGKPSDVRPVLWKFRAFFRKTDED----RS 113

Query: 155 KYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITY 196
            Y V+H++ + L +T    + V   +    + ++ I + +T 
Sbjct: 114 DYLVEHSSNVYLMNTKMECIKVFGPEYHDKALVDAITKEMTK 155


>gi|124511740|ref|XP_001349003.1| Cg3 protein [Plasmodium falciparum 3D7]
 gi|23498771|emb|CAD50841.1| Cg3 protein [Plasmodium falciparum 3D7]
          Length = 317

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 82/180 (45%), Gaps = 13/180 (7%)

Query: 28  FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-V 86
              G      D  L+   G   +  S   K  +++FGFT C  +CP  L +   ++++  
Sbjct: 119 ESIGKPLIGGDFTLINHHGNIVTNKSFKNKFCLIYFGFTYCPDICPQELEKQTIVIEKIH 178

Query: 87  DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVL 146
              G ++   FI+VDP+RDT   +  + + FS ++IG++G    +  VAK FR+Y N  +
Sbjct: 179 KKYGDIITPIFISVDPQRDTVAQINYYCKSFSPKLIGLTGTKELIKHVAKLFRVYYNENV 238

Query: 147 AEKSGVEEK------------YFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            + +  +E             Y +DH+    L DT G+ +        +   ++KI+  I
Sbjct: 239 TDVNYSKENESISKNNNYNYNYLIDHSIIHYLLDTNGNFLDFFGKNATTSEMVDKISEYI 298


>gi|325954005|ref|YP_004237665.1| electron transporter SCO1/SenC [Weeksella virosa DSM 16922]
 gi|323436623|gb|ADX67087.1| electron transport protein SCO1/SenC [Weeksella virosa DSM 16922]
          Length = 220

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 79/226 (34%), Gaps = 39/226 (17%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K +   +G   +  +  + Y S     +           L  Q     +   +  K  +V
Sbjct: 3   KRILSFIGVFAIFAIAVVWYKSSKKDELFTVMNV-PAFSLTNQQNQTITAEKMKGKVYVV 61

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR---FS 118
            F FT+C  +CP     L  +  Q++          IT+DPKRDTPE + K  ++    S
Sbjct: 62  EFFFTSCPTICPVMNKNLRMVEDQINDPNFG--IISITIDPKRDTPERLAKHAEKLGVKS 119

Query: 119 DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIP 178
                ++G+  D++ ++K F IYV    +   G      ++H+    L D  G I     
Sbjct: 120 PNWHFLTGNREDILALSKQFNIYVGEDESTAEG------LNHSGKFALVDQTGKIRSRYA 173

Query: 179 ---------------------------YKDDSDSAIEKINRLITYG 197
                                      Y  + +  IE I +L+   
Sbjct: 174 LNGIPMLYYSGLDYTDPEGKNPSLQGTYHPEVELLIEDIRKLLNEQ 219


>gi|296445052|ref|ZP_06887013.1| electron transport protein SCO1/SenC [Methylosinus trichosporium
           OB3b]
 gi|296257473|gb|EFH04539.1| electron transport protein SCO1/SenC [Methylosinus trichosporium
           OB3b]
          Length = 366

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 51/193 (26%), Positives = 82/193 (42%), Gaps = 4/193 (2%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFF 63
             I+           +   S  S             HL +  G     ++L  +P   FF
Sbjct: 172 FSIVALAAAGLQASVMWRWSQQSSDASPAPLREPSFHLTSSSGAAVDETTLRGRPYAAFF 231

Query: 64  GFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           GFT C  VCPTTL  L R ++ +  + + L   F+++DP+RDTPE +  F+  F  R+  
Sbjct: 232 GFTQCPQVCPTTLVELTRAVESLGASASNLAILFVSLDPERDTPETLSDFIASFGGRVTA 291

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           ++G   ++ R A+ FR+Y      +       Y +DHT  + L D  G     + + D  
Sbjct: 292 LTGTETEIARAARAFRVYHRKSALD----GGGYTIDHTALVYLVDRHGRARDALSFTDHR 347

Query: 184 DSAIEKINRLITY 196
           D A  K+   +  
Sbjct: 348 DIAKRKLEAFVRE 360


>gi|77361767|ref|YP_341342.1| SCO1/SenC protein (copper-binding protein) [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76876678|emb|CAI87900.1| putative SCO1/SenC family protein (copper-binding protein)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 209

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/204 (22%), Positives = 93/204 (45%), Gaps = 16/204 (7%)

Query: 1   MKALGIILGTILLAVLGSIA---YVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK L + L  +L   L + +        +  V  N +  +D  L  Q G   +   L  +
Sbjct: 5   MKQLWLGLVIVLTLFLSACSDDNAPPDVNALVYENAKPLADFSLDDQHGELVTKQQLLGQ 64

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
            ++VF G+T+C  +CP TL++L+ + K +  +   +  +F++VDPKRDTP   K ++  F
Sbjct: 65  WNLVFLGYTSCPDICPLTLAKLNAVYKNLR-SDYPVQIWFVSVDPKRDTPAKRKDYIDYF 123

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           +   + +SG+   +  + +   +            E +Y VDH+ ++ + D  G++  + 
Sbjct: 124 NPDFLAVSGEHKQLFPMVRGLGLIYAI----SDSSESEYAVDHSASVAMVDGNGAVRAIF 179

Query: 178 PYKD--------DSDSAIEKINRL 193
             +         +S    ++  ++
Sbjct: 180 KPEFKQGSVPLINSKELTQEFKKI 203


>gi|2642502|gb|AAC47844.1| CG3 [Plasmodium falciparum]
          Length = 328

 Score =   99 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 82/180 (45%), Gaps = 13/180 (7%)

Query: 28  FVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-V 86
              G      D  L+   G   +  S   K  +++FGFT C  +CP  L +   ++++  
Sbjct: 119 ESIGKPLIGGDFTLINHHGNIVTNKSFKNKFCLIYFGFTYCPDICPQELEKQTIVIEKIH 178

Query: 87  DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVL 146
              G ++   FI+VDP+RDT   +  + + FS ++IG++G    +  VAK FR+Y N  +
Sbjct: 179 KKYGDIITPIFISVDPQRDTVAQINYYCKSFSPKLIGLTGTKELIKHVAKLFRVYYNENV 238

Query: 147 AEKSGVEEK------------YFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            + +  +E             Y +DH+    L DT G+ +        +   ++KI+  I
Sbjct: 239 TDVNYSKENESISKNNNYNYNYLIDHSIIHYLLDTNGNFLDFFGKNATTSEMVDKISEYI 298


>gi|120553014|ref|YP_957365.1| electron transport protein SCO1/SenC [Marinobacter aquaeolei VT8]
 gi|120322863|gb|ABM17178.1| electron transport protein SCO1/SenC [Marinobacter aquaeolei VT8]
          Length = 218

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 73/172 (42%), Gaps = 5/172 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +S  + +V    R   +  L  ++G   +   L  + + VF G+TNC  +CP  ++ L R
Sbjct: 41  LSQYNAYVYDQPRPLVEFSLTNEEGETVTREDLRGRWTFVFVGYTNCPDICPAAMANLRR 100

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
             + + P     +   ++ DP+ DTP  +K +   F +   G++GD   + +VAK+    
Sbjct: 101 TDQLLSPELPQPDYLLVSADPEHDTPAKLKAYTDFFGEHFHGLTGDLDTLRQVAKSVSAV 160

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRL 193
                     V  +  VDH+    L +  G +  +I      +   E   R+
Sbjct: 161 F-----VHRQVNGELLVDHSGHFALLNPDGDVQALIQPPHKPEQLAEAFERI 207


>gi|260576056|ref|ZP_05844050.1| electron transport protein SCO1/SenC [Rhodobacter sp. SW2]
 gi|259021755|gb|EEW25057.1| electron transport protein SCO1/SenC [Rhodobacter sp. SW2]
          Length = 167

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/171 (29%), Positives = 86/171 (50%), Gaps = 5/171 (2%)

Query: 25  SSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK 84
           + + +      +    L   +G  F+ S    +P++VFFGFT C  VCPTTL+ +   L 
Sbjct: 2   TGRDLLPIPIRDMSFSLTDHNGQPFAPSQWLGRPTMVFFGFTFCPDVCPTTLNDISDWLA 61

Query: 85  QVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNN 144
            + P    LN   I+VDP RDTP ++ +++  F  RI+G++G   ++ + A +FR     
Sbjct: 62  DLGPEADRLNVALISVDPARDTPAILAEYLSNFDPRIVGLTGRLSELEKAAADFRAIFEK 121

Query: 145 VLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           +  +       Y ++HT  + LF   G    +I + +D   AI KI  ++T
Sbjct: 122 LPRD-----GGYTMNHTAGVFLFAAEGQFTSIIDFHEDRRFAIPKIRHILT 167


>gi|320322184|gb|EFW78280.1| Sco1/SenC family protein [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331835|gb|EFW87773.1| Sco1/SenC family protein [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330872861|gb|EGH07010.1| Sco1/SenC family protein [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 219

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 48/208 (23%), Positives = 89/208 (42%), Gaps = 18/208 (8%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFN-------------SDVHLVAQDGTDF 49
               I   I+  VLG I          +     N               + +  Q+G   
Sbjct: 15  KTVFIAAAIVALVLGLILSQLLPGSGSEDQAALNDAGIVLLPKSRQLPALSMSDQNGAAV 74

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           +L  L  K +++FFG+T C  +CPTTL+++ ++  +  +     +    ++VDP RDTP+
Sbjct: 75  ALDDLKGKWTLMFFGYTFCPDICPTTLAQIKQIRTELPEKVVERMRVVLVSVDPDRDTPQ 134

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F  + IG++    D+ ++A    I        K      YFVDH+  L L  
Sbjct: 135 QLKQYLGYFDKQYIGLTAPVADIQKLANAVSIPFIPADTSKP----NYFVDHSGNLALIG 190

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G+  G I    ++   ++++  L+  
Sbjct: 191 PDGTQRGFIRAPLNNQKLVKQLPGLLER 218


>gi|196249237|ref|ZP_03147936.1| electron transport protein SCO1/SenC [Geobacillus sp. G11MC16]
 gi|196211466|gb|EDY06226.1| electron transport protein SCO1/SenC [Geobacillus sp. G11MC16]
          Length = 201

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 50/199 (25%), Positives = 75/199 (37%), Gaps = 22/199 (11%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K + +I    LLA  G            D      +D   V Q G  F L  L  K  + 
Sbjct: 14  KRIMMIAAVCLLAACG--------KTIPDAKNWPVADFTFVDQSGEPFGLRDLKGKIWVA 65

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD-- 119
            F FTNC  VCP   + + +L K+ +  G  +     +VDP+ DTPE +  + ++F+D  
Sbjct: 66  DFVFTNCETVCPPMTANMAKLKKKAEEKGLDVEFVSFSVDPEVDTPEKLTAYAKQFTDDL 125

Query: 120 -RIIGISGDP--IDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
                ++G           K+F+  V     +         V H T   L    G+IV  
Sbjct: 126 ANWHFLTGYSQTEINELAQKSFKTIVQKPANDD-------QVIHGTNFYLVGPDGNIVQT 178

Query: 177 IPY--KDDSDSAIEKINRL 193
                    D+ +E I  L
Sbjct: 179 YNGVQDVPYDTILEHIEIL 197


>gi|225848515|ref|YP_002728678.1| electron transporter SCO1/SenC [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644511|gb|ACN99561.1| electron transport protein SCO1/SenC [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 202

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/204 (28%), Positives = 85/204 (41%), Gaps = 10/204 (4%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK L +    +L+    S+AY    S           + +LV ++G    LS    K  I
Sbjct: 1   MKKL-LSFLIVLVFSTVSMAYNLQGSAKGYPKPAIEVE-NLVNEEGKPTKLSDFKGKVVI 58

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQ--VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFS 118
           ++FGFTNC  VCPT  + L R+                FITVDPKRDTPEV+K++ +   
Sbjct: 59  LYFGFTNCQHVCPTVSASLKRISDALVEKGLKDKFQIVFITVDPKRDTPEVLKEYKKSHE 118

Query: 119 DR-IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVE---EKYFVDHTT-ALLLFDTAGSI 173
                 ++G   D+ +V K + I V     E    +   +   + HT     + D  G I
Sbjct: 119 FDTFTFLTGKEEDLKKVWKAYGIEVKEKEMEMKHGDHVMKHKMISHTPVITFIIDKNGKI 178

Query: 174 VGVIPYKDDSDS-AIEKINRLITY 196
           V         +   I+ I  LI  
Sbjct: 179 VEDYKGIYLPEDKIIQDIEYLIKK 202


>gi|330876250|gb|EGH10399.1| Sco1/SenC family protein [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 201

 Score =   99 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 50/179 (27%), Positives = 83/179 (46%), Gaps = 5/179 (2%)

Query: 16  LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT 75
            G+   + F       N     +  L    G   +LSS      ++FFGFT C A+CPT 
Sbjct: 25  CGNSNALPFKHGKDMSNEIVGRNFRLKDSQGNVKTLSSFRGLMPMIFFGFTQCPAICPTA 84

Query: 76  LSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVA 135
           L+R  ++ K +   G  L   FIT+DP+RDTPEV+  +V+ F    + +SG   + +  A
Sbjct: 85  LARAAQIRKLMGEEGKTLQVVFITLDPERDTPEVIDAYVKAFDPTFVALSGTLEETVATA 144

Query: 136 KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           K F ++   V        + Y + HT    ++DT G +   + ++  +    E +  L+
Sbjct: 145 KEFGVFFEKVPL-----GDTYTISHTATSYVYDTRGVLRLGLSHRLSAQQCSEDLLTLM 198


>gi|28872371|ref|NP_794990.1| Sco1/SenC family protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28855626|gb|AAO58685.1| Sco1/SenC family protein [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 210

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/208 (22%), Positives = 95/208 (45%), Gaps = 17/208 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVD------------GNRRFNSDVHLVAQDGTDF 49
           K + I+   + L +   ++ +   S   +               R    + ++ Q+G   
Sbjct: 6   KTVFIVAAIVALVLGLVLSRLLPGSGPSNQTALNEAGIVLLPKSRQLPALSMIDQNGAAV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           +L  L  + +++FFG+T C  +CPTTL+++ ++  +        +    ++VDP RDTP+
Sbjct: 66  ALDGLKDQWTLMFFGYTFCPDICPTTLAQIKQIRSELPTAAVERMRVVLVSVDPNRDTPQ 125

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F  + IG++    D+ ++A +  I        K      YFVDH+  L L  
Sbjct: 126 QLKEYLSYFDPQYIGLTAPVADIQKLANSVSIPFIPADTSKP----NYFVDHSGNLALIG 181

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G+  G I    ++   ++++ RL+  
Sbjct: 182 PDGTQRGFIRAPLNNQKLVKQLPRLLER 209


>gi|260575775|ref|ZP_05843771.1| electron transport protein SCO1/SenC [Rhodobacter sp. SW2]
 gi|259021928|gb|EEW25228.1| electron transport protein SCO1/SenC [Rhodobacter sp. SW2]
          Length = 209

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 76/210 (36%), Gaps = 15/210 (7%)

Query: 1   MKALGIILGT---ILLAVLGSIAYVSFSSKFVDGN--------RRFNSDVHLVAQDGTDF 49
           M  L   L      ++  +   A        +                 ++L+ + G   
Sbjct: 1   MTRLSAWLAAGMTAVIVAVSVWAAYFRGGNDIFAECRSGQVAGGEIGGPLNLIDETGAAV 60

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEV 109
           +   +  KPS+V+FG+T C  VCP   +R    +  ++  G  +   FI+VD  RDTPE 
Sbjct: 61  TEKEMLAKPSLVYFGYTFCPDVCPLDNARNAAAVDILEEQGIEVTPVFISVDSARDTPET 120

Query: 110 MKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDT 169
           +  F      R+IG +G    +   +  ++ Y      E    EE Y +DH+T   L   
Sbjct: 121 LTSFTDSLHPRMIGYTGTAEQIKAASLAYKTYFKIKNPE----EEYYLIDHSTFTYLMLP 176

Query: 170 AGSIVGVIPYKDDSDSAIEKINRLITYGNV 199
               V         D   E +   +    V
Sbjct: 177 GIGFVDFFKRDATPDQMAESVACYVNTAAV 206


>gi|296329481|ref|ZP_06871968.1| assembly factor BSco of the Cu(A) site of cytochrome c oxidase
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305674805|ref|YP_003866477.1| assembly factor BSco of the Cu(A) site of cytochrome c oxidase
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296153363|gb|EFG94225.1| assembly factor BSco of the Cu(A) site of cytochrome c oxidase
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305413049|gb|ADM38168.1| assembly factor BSco of the Cu(A) site of cytochrome c oxidase
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 193

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 69/199 (34%), Gaps = 18/199 (9%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           MK +  +   +   +L +           D             QDG + SL SL  +  +
Sbjct: 1   MKVIKGLTAGLFFLLLCACGGQQIK----DPLNYEVEPFTFQNQDGKNVSLESLKGEVWL 56

Query: 61  VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF--- 117
             F FTNC  VCP   + +  L K++      +     +VDP+ D P+ +KKF   +   
Sbjct: 57  ADFIFTNCETVCPPMTAHMTDLQKKLKAENIDVRIVSFSVDPENDKPKQLKKFAANYPLS 116

Query: 118 SDRIIGISGDPIDVMRVA--KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            D    ++G     +     K+F+  V     E         V H ++  L    G ++ 
Sbjct: 117 FDNWDFLTGYSQSDIEAFALKSFKAIVKKPEGED-------QVIHQSSFYLVGPNGKVLK 169

Query: 176 VIPY--KDDSDSAIEKINR 192
                     D  I  +  
Sbjct: 170 DYNGVENTPYDDIIADVKS 188


>gi|145301040|ref|YP_001143881.1| electron transport protein SCO1/SenC [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853812|gb|ABO92133.1| Electron transport protein SCO1/SenC [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 208

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 75/201 (37%), Gaps = 18/201 (8%)

Query: 9   GTILLAVLGSIAYVSFSSKFVDGNRRFNS------DVHLVAQDGTDFSLSSLYIKPSIVF 62
              LL V G +A   +S   +     +              ++G  F  +SL    + +F
Sbjct: 8   LLFLLLVGGMMAAFHWSRPSLPEQADYYPAGRDINPFAFTDEEGQPFVPASLVGHWTFLF 67

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
            G+T C  +CPTTL+ L  +   +          FI+ DP+RD    +K +   F     
Sbjct: 68  VGYTFCPDICPTTLADLRSVYPALKKIAPDSQVVFISADPQRDDITRLKTYTAFFHPEFK 127

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDD 182
             +G    +    +N  +  +         E+ Y +DH+ +++L +  G +  V   +  
Sbjct: 128 AATGPHEKLFPFVRNLGLIYSIAEQG----EKDYLIDHSASIVLINPEGKLEAVFRPQMS 183

Query: 183 S--------DSAIEKINRLIT 195
                    ++ +    +++ 
Sbjct: 184 EGRVPHVVMETLVSDFAKIVR 204


>gi|224093764|ref|XP_002309982.1| predicted protein [Populus trichocarpa]
 gi|222852885|gb|EEE90432.1| predicted protein [Populus trichocarpa]
          Length = 243

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/206 (16%), Positives = 83/206 (40%), Gaps = 15/206 (7%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGN----------RRFNSDVHLVAQDGTDFSL 51
           ++  I    +  A L +  + +   + V                     L+  +    + 
Sbjct: 40  RSYAIPAAILGFAGLAAFVHYNDERRAVPKGQGSDRGNVKGPTIGGPFTLINTEDKVVTG 99

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVD-PTGTLLNAYFITVDPKRDTPEVM 110
                   +++FG+T+   V P  L  + + +  ++      +   F+T+DP+RD P  +
Sbjct: 100 KDFLGSWVLLYFGYTSSPDVGPEQLKVMAKAINTLESKANLKVLPVFVTLDPQRDNPSHL 159

Query: 111 KKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTA 170
           + +++ F  RI+G++G    + ++A+ +R+Y   +  E     E Y V+ +  +   +  
Sbjct: 160 RAYLKEFEPRIVGLTGSVGAIRQMAQEYRVYFRKIEEE----GEDYLVESSHDMYFINPN 215

Query: 171 GSIVGVIPYKDDSDSAIEKINRLITY 196
             +V     + +++   E I + +  
Sbjct: 216 MEVVRCFGVEYNAEELSEAIQKELKR 241


>gi|229591066|ref|YP_002873185.1| putative SCO1/SenC family protein [Pseudomonas fluorescens SBW25]
 gi|229362932|emb|CAY49858.1| putative SCO1/SenC family protein [Pseudomonas fluorescens SBW25]
          Length = 202

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 50/173 (28%), Positives = 83/173 (47%), Gaps = 5/173 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           ++F       ++       L    G   +LSS      +VFFGFT C AVCPTTL+R  +
Sbjct: 32  LNFKYGKDLSDKIMGRTFKLKNTAGETVTLSSFRGLMPVVFFGFTQCPAVCPTTLARAAQ 91

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
             K +   G ++   FIT+DP+RDTPE++ ++V+ F      + G P ++   AK F I+
Sbjct: 92  AKKLMGRDGEIMQVVFITLDPERDTPEILDRYVKAFDPSFEALYGTPEEIAVAAKEFGIF 151

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              + A      + Y + HT    +FDT G++   +     +    E +  ++
Sbjct: 152 YEKIPA-----GDTYTLSHTATSFVFDTRGNLRLGLQASLTAKECAEDLLTVM 199


>gi|47565605|ref|ZP_00236645.1| cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           G9241]
 gi|47557241|gb|EAL15569.1| cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           G9241]
          Length = 195

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 76/200 (38%), Gaps = 14/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK    I+G +++  L  +A  S S SK                QDG  F    L  K  
Sbjct: 1   MKRYQKIIGLMVVFCLFVLAGCSGSGSKLRKPLNWDLETFQFTNQDGKPFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FTNC  VCP   + + +L K        +     +VDP  D PE +K F+Q+F++
Sbjct: 61  VADFMFTNCQTVCPPMTANMAKLQKMAKEEKIDVQFVSFSVDPDLDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                  ++G    D+ + +K+                E   V H T+  L D  G ++ 
Sbjct: 121 DTSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFYLIDQNGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRL 193
                     +  I  + RL
Sbjct: 174 KYSGISNTPYEDIIRDMKRL 193


>gi|171316962|ref|ZP_02906169.1| electron transport protein SCO1/SenC [Burkholderia ambifaria MEX-5]
 gi|171097886|gb|EDT42706.1| electron transport protein SCO1/SenC [Burkholderia ambifaria MEX-5]
          Length = 217

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 78/158 (49%), Gaps = 4/158 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              L   DG     ++   + ++V+FG+T+C  VCP T++RL  +L ++ P    +   F
Sbjct: 53  SFTLTGGDGRPVDANAFRGRIALVYFGYTHCPDVCPETMARLMEVLAKLGPRANDVRILF 112

Query: 98  ITVDPKRDTPEVMKKF-VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           ++VDP RDTP+ M+ +     +    G++G    +  +AK +R+       EK      Y
Sbjct: 113 VSVDPARDTPQAMQSYVAAFDAAHARGLTGTDGQIESLAKRYRVAYQM---EKRDPSGGY 169

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            V H++A+ +FD  G    +   +D  D+    + R+I
Sbjct: 170 EVTHSSAVYIFDANGRARLLATDRDSPDAIAADVRRII 207


>gi|226200287|ref|ZP_03795831.1| SCO1/SenC family protein [Burkholderia pseudomallei Pakistan 9]
 gi|254295897|ref|ZP_04963354.1| SCO1/SenC family protein [Burkholderia pseudomallei 406e]
 gi|157805747|gb|EDO82917.1| SCO1/SenC family protein [Burkholderia pseudomallei 406e]
 gi|225927609|gb|EEH23652.1| SCO1/SenC family protein [Burkholderia pseudomallei Pakistan 9]
          Length = 197

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 78/198 (39%), Gaps = 7/198 (3%)

Query: 1   MKALGIILGTILLAV---LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           M+   +     L      +GS A   F S  +           L    G   +       
Sbjct: 2   MRRKALGALCSLALAGAPVGSRAATPFYSLPLSSKDWHKG-FRLTDLHGHTKTPQDYRGN 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             ++FFGF +C ++C TT+  L +  ++V      +   F+T+DP RDT   + +++  F
Sbjct: 61  VLLLFFGFLSCPSICSTTMLELTQAKERVGAQKDKVKILFVTLDPNRDTSPTIARWLASF 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
            D  IG+      V + A    +    V  +   V   Y +DH     +FD+ G +  + 
Sbjct: 121 GDDNIGLRDSEAHVRKAATALNLKYERVEGD---VPGAYTIDHGVQTYVFDSQGRLRLIA 177

Query: 178 PYKDDSDSAIEKINRLIT 195
               + +   + I +L++
Sbjct: 178 RAGIEPEYVAKDIVQLLS 195


>gi|134295185|ref|YP_001118920.1| electron transport protein SCO1/SenC [Burkholderia vietnamiensis
           G4]
 gi|134138342|gb|ABO54085.1| electron transport protein SCO1/SenC [Burkholderia vietnamiensis
           G4]
          Length = 214

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/158 (26%), Positives = 77/158 (48%), Gaps = 4/158 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              L   DG     S+   + ++V+FG+T+C  VCP T++RL  +L ++ P    +   F
Sbjct: 54  SFTLTGGDGRPVDASAFRGRVALVYFGYTHCPDVCPETMARLMEVLAKLGPRANDVRILF 113

Query: 98  ITVDPKRDTPEVMKKF-VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           ++VDP RDTP+ ++ +     +    G++G    +  +AK +R+       E+      Y
Sbjct: 114 VSVDPARDTPQALQSYVAAFDAAHARGLTGSDGQIESLAKRYRVAYQM---EQRDPSGGY 170

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            V H++A+ +FD  G    +    D  D+    + R+I
Sbjct: 171 EVTHSSAVYIFDAHGRARLLATDGDSPDAIAADVRRII 208


>gi|76810302|ref|YP_331969.1| SCO1/SenC family protein [Burkholderia pseudomallei 1710b]
 gi|254196418|ref|ZP_04902842.1| SCO1/SenC family protein [Burkholderia pseudomallei S13]
 gi|254258320|ref|ZP_04949374.1| SCO1/SenC family protein [Burkholderia pseudomallei 1710a]
 gi|76579755|gb|ABA49230.1| SCO1/SenC family protein [Burkholderia pseudomallei 1710b]
 gi|169653161|gb|EDS85854.1| SCO1/SenC family protein [Burkholderia pseudomallei S13]
 gi|254217009|gb|EET06393.1| SCO1/SenC family protein [Burkholderia pseudomallei 1710a]
          Length = 202

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 78/198 (39%), Gaps = 7/198 (3%)

Query: 1   MKALGIILGTILLAV---LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           M+   +     L      +GS A   F S  +           L    G   +       
Sbjct: 7   MRRKALGALCSLALAGAPVGSRAATPFYSLPLSSKDWHKG-FRLTDLHGHTKTPQDYRGN 65

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             ++FFGF +C ++C TT+  L +  ++V      +   F+T+DP RDT   + +++  F
Sbjct: 66  VLLLFFGFLSCPSICSTTMLELTQAKERVGAQKDKVKILFVTLDPNRDTSPTIARWLASF 125

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
            D  IG+      V + A    +    V  +   V   Y +DH     +FD+ G +  + 
Sbjct: 126 GDDNIGLRDSEAHVRKAATALNLKYERVEGD---VPGAYTIDHGVQTYVFDSQGRLRLIA 182

Query: 178 PYKDDSDSAIEKINRLIT 195
               + +   + I +L++
Sbjct: 183 RAGIEPEYVAKDIVQLLS 200


>gi|229155834|ref|ZP_04283936.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           ATCC 4342]
 gi|228627632|gb|EEK84357.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           ATCC 4342]
          Length = 195

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 76/200 (38%), Gaps = 14/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK    I+G +++  L  +A  S S SK                QDG  F    L  K  
Sbjct: 1   MKRYQKIIGLMVVFCLFVLAGCSGSGSKLRKPLNWDLETFQFTNQDGKPFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FTNC  VCP   + + +L K        +     +VDP  D PE +K F+Q+F++
Sbjct: 61  VADFMFTNCQTVCPPMTANMAKLQKMAKEEKLDVQFVSFSVDPDLDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                  ++G    D+ + +K+                E   V H T+  L D  G ++ 
Sbjct: 121 DTSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFYLIDQNGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRL 193
                     +  I  + RL
Sbjct: 174 KYSGISNTPYEDIIRDMKRL 193


>gi|157692676|ref|YP_001487138.1| electron transport protein [Bacillus pumilus SAFR-032]
 gi|157681434|gb|ABV62578.1| possible SCO1 family electron transport protein [Bacillus pumilus
           SAFR-032]
          Length = 196

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/195 (21%), Positives = 70/195 (35%), Gaps = 15/195 (7%)

Query: 8   LGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTN 67
           LG +++  +  +   S        N +         QDG   SL  L  K  +  F FT+
Sbjct: 9   LGALMIISVLLLVSCSNGQIKDALNYQIQ-PFEYENQDGQKVSLDDLKGKVWVADFIFTS 67

Query: 68  CSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF---SDRIIGI 124
           C  +CP   + +  L K+V            +VDP+ D+P+ +K+F + +         +
Sbjct: 68  CETICPPMTAHMTELQKRVKEEKLDARIISFSVDPEVDSPKKLKEFAKAYPLSFKNWDFL 127

Query: 125 SGDPID--VMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPY--K 180
           +G           K+F+  V     E         V H +   L D  G ++        
Sbjct: 128 TGYSQSAIEKFAMKSFKTIVKKPEDED-------QVIHQSLFFLVDQEGKVMKNYDGVQN 180

Query: 181 DDSDSAIEKINRLIT 195
              D  I+ I  LI 
Sbjct: 181 TPYDDIIKDIKTLIR 195


>gi|221135021|ref|ZP_03561324.1| uncharacterized secreted protein of SCO1/SenC/PrrC family
           [Glaciecola sp. HTCC2999]
          Length = 228

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 88/222 (39%), Gaps = 33/222 (14%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKFVD--------------------GNRRFNSDVHLVA 43
           + II+G   +  +G    +  +S                           R  SD  L  
Sbjct: 5   IKIIIGLAFVIGIGFGVSIYETSDSQPVSTSYNPDAHPSGTQYMQWYPKPRKLSDFTLTN 64

Query: 44  QDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDP--TGTLLNAYFITVD 101
                 + + LY + ++ F G+T C  +CPTTL+ L++    +        +  +F++VD
Sbjct: 65  HKQMSMTNADLYNQWTLAFVGYTYCPDICPTTLAALNQAYPSIIEQAQDQPIKVWFLSVD 124

Query: 102 PKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHT 161
           PKRDT E + +++  F+   +  + +   +  + ++  +  +     +S  +  Y VDH+
Sbjct: 125 PKRDTIERLAEYIGFFNPNFLAATAEHKQLYPLVRSMGMMYS---MSQSTDDPNYLVDHS 181

Query: 162 TALLLFDTAGSIVGVIPYKDDS--------DSAIEKINRLIT 195
            ++++ +  G ++G                   I  + ++I 
Sbjct: 182 GSVVVINPLGQVIGRFKPNHTPGQIAISDTQQIIADMPKVIN 223


>gi|206978235|ref|ZP_03239114.1| SCO1/SenC family lipoprotein [Bacillus cereus H3081.97]
 gi|217959760|ref|YP_002338312.1| SCO1/SenC family lipoprotein [Bacillus cereus AH187]
 gi|222095846|ref|YP_002529903.1| cytochrome c oxidase cu(a) center assembly protein [Bacillus cereus
           Q1]
 gi|229138954|ref|ZP_04267532.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           BDRD-ST26]
 gi|206743536|gb|EDZ54964.1| SCO1/SenC family lipoprotein [Bacillus cereus H3081.97]
 gi|217065333|gb|ACJ79583.1| SCO1/SenC family lipoprotein [Bacillus cereus AH187]
 gi|221239904|gb|ACM12614.1| cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           Q1]
 gi|228644494|gb|EEL00748.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           BDRD-ST26]
          Length = 195

 Score = 99.6 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/200 (23%), Positives = 76/200 (38%), Gaps = 12/200 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK    I+G +++  L  +A  S S SK                QDG  F    L  K  
Sbjct: 1   MKRYQKIIGLMVVFCLFVLAGCSGSGSKLRKPLNWDLETFQFTNQDGKPFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FTNC  VCP   + + +L K        +     +VDP  D PE +K F+Q+F++
Sbjct: 61  VADFMFTNCQTVCPPMTANMAKLQKMAKEEKLDVQFVSFSVDPDLDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
                  ++G  ++ +        +  +         E   V H T+  L D  G ++  
Sbjct: 121 DTSNWNLLTGYSLEDITK------FAKDNFQSLVDKPENGQVMHGTSFYLIDQNGKVMKK 174

Query: 177 IPY--KDDSDSAIEKINRLI 194
                    +  I  + RL+
Sbjct: 175 YSGISNTPYEDIIRDMKRLV 194


>gi|312961559|ref|ZP_07776060.1| SCO1/SenC family protein [Pseudomonas fluorescens WH6]
 gi|311284238|gb|EFQ62818.1| SCO1/SenC family protein [Pseudomonas fluorescens WH6]
          Length = 201

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 51/173 (29%), Positives = 84/173 (48%), Gaps = 5/173 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           ++F       ++       L   +G   +LSS      +VFFGFT C AVCPTTL+R  +
Sbjct: 31  LNFKYGKDLSDKIMGRTFKLKNTEGDTVTLSSYRGLMPVVFFGFTQCPAVCPTTLARAAQ 90

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
             K +   G ++   FIT+DP+RDTPE++ K+V+ F      + G P ++   AK F I+
Sbjct: 91  AKKLMGRDGEIMQVIFITLDPERDTPEILDKYVKAFDPSFEALYGTPEEIAVAAKEFGIF 150

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              + A      + Y + HT    +FDT G++   +     +    E +  ++
Sbjct: 151 YEKIPA-----GDTYTLSHTATSFVFDTRGNLRLGLQASLTAKECAEDLLTVM 198


>gi|294138952|ref|YP_003554930.1| SCO1/SenC family protein [Shewanella violacea DSS12]
 gi|293325421|dbj|BAJ00152.1| SCO1/SenC family protein [Shewanella violacea DSS12]
          Length = 230

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 49/184 (26%), Positives = 80/184 (43%), Gaps = 15/184 (8%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +  ++ FV    +  +   L  QDG  F+ S L  K S+ F G+T+C  VCPTT+ +L  
Sbjct: 46  LDLATSFVFPIAKPLAPFSLTDQDGNAFTNSQLNNKWSLFFIGYTSCPDVCPTTMGKLTA 105

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
              ++      L   F++VDP+RDT   +  ++  F+   I I+G    +  + ++    
Sbjct: 106 AYPKLLENA-DLQVVFLSVDPQRDTRAKLFSYMNFFNPEFIAITGGHGQLFPLTRDLGFV 164

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS---------DSAIEKINR 192
              V     G  E Y VDH+ ++ L    GS V +I  K  +            I  I  
Sbjct: 165 YAMV-----GDGEDYQVDHSASMALISPDGSKVAIIKPKSSAPGKLPQILNKHLITDIQT 219

Query: 193 LITY 196
           +I  
Sbjct: 220 IIAN 223


>gi|330958596|gb|EGH58856.1| SCO1/SenC family protein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 201

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 5/189 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
           +L   +L    +   +++       N+       L   +G    LSS      +VFFGFT
Sbjct: 16  LLSLSILTGCDTREELTYKHGKNLSNQILGRSFKLKDTNGDLRMLSSYRGMIPLVFFGFT 75

Query: 67  NCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISG 126
            C A+CPT L+R  ++ K +   G  L   FIT+DP+RDTP V+  +V+ F    + + G
Sbjct: 76  QCPAICPTALARAVQIKKLMGKDGDRLQIIFITLDPERDTPAVLNAYVKTFDPSFVALYG 135

Query: 127 DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSA 186
              +    AK F ++   +          Y + H+    ++D  G++   + +   +   
Sbjct: 136 TLEETAATAKEFGVFYEKIP-----SGSTYTLSHSATSYVYDIRGTLRLGLSHSLSAQEC 190

Query: 187 IEKINRLIT 195
            E +  ++ 
Sbjct: 191 AEDLLTVMK 199


>gi|228985339|ref|ZP_04145499.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228774395|gb|EEM22801.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 195

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 76/200 (38%), Gaps = 14/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK    I+G +++  +  +A  S S SK                QDG  F    L  K  
Sbjct: 1   MKRYQKIIGLMVVFCIFVLAGCSGSGSKLRKPLNWDLETFQFTNQDGKPFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FTNC  VCP   + + +L K        +     +VDP  D PE +K F+Q+F++
Sbjct: 61  VADFMFTNCQTVCPPMTANMAKLQKMAKEEKLDVQFVSFSVDPDLDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                  ++G    D+ + +K+                E   V H T+  L D  G ++ 
Sbjct: 121 DTSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFYLIDQNGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRL 193
                     +  I  + RL
Sbjct: 174 KYSGISNTPYEDIIRDMKRL 193


>gi|28870034|ref|NP_792653.1| SCO1/SenC family protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28853280|gb|AAO56348.1| SCO1/SenC family protein [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 188

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 5/189 (2%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT 66
           +L   +L    +   +++       N+       L   +G    LSS      +VFFGFT
Sbjct: 3   LLSLSILTGCDTREELTYKHGKNLSNQILGRSFKLKDTNGDLRMLSSYRGMIPLVFFGFT 62

Query: 67  NCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISG 126
            C A+CPT L+R  ++ K +   G  L   FIT+DP+RDTP V+  +V+ F    + + G
Sbjct: 63  QCPAICPTALARAVQIKKLMGKDGDRLQIIFITLDPERDTPAVLNAYVKTFDPSFVALYG 122

Query: 127 DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSA 186
              +    AK F ++   +          Y + H+    ++D  G++   + +   +   
Sbjct: 123 TLEETAATAKEFGVFYEKIP-----SGSTYTLSHSATSYVYDIRGTLRLGLSHSLSAQEC 177

Query: 187 IEKINRLIT 195
            E +  ++ 
Sbjct: 178 AEDLLTVMK 186


>gi|294340154|emb|CAZ88526.1| putative Electron transport protein SCO1/SenC [Thiomonas sp. 3As]
          Length = 193

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/197 (24%), Positives = 86/197 (43%), Gaps = 10/197 (5%)

Query: 7   ILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVH----LVAQDGTDFSLSSLYIKPSIVF 62
           ++  +LLA + + ++    S  + G+                 G  FS +    +  +VF
Sbjct: 1   MVSALLLAAVWAWSHFQQHSAALHGSPLKPVPAPSLSGFTDTQGRAFSWTRERGRAVLVF 60

Query: 63  FGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRII 122
           FG+T+C  VCP TL+ L + L+++ P    +   F+T+DP RDT  V++ ++  F    I
Sbjct: 61  FGYTHCPDVCPLTLAALAQSLERLGPLRKQVRVVFVTLDPARDTAPVLRAYLDAFLPDTI 120

Query: 123 GISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK-- 180
           G+      V   A+ + I    V       +  Y++DHT A+ L    G +V    Y   
Sbjct: 121 GLRAAMPAVRVSARQWGITWRRVDT----ADGAYWIDHTAAVTLVGPDGRLVARYGYGQL 176

Query: 181 DDSDSAIEKINRLITYG 197
            D     + +  ++  G
Sbjct: 177 TDPSWLADDLRTVLERG 193


>gi|71733999|ref|YP_272576.1| Sco1/SenC family protein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71554552|gb|AAZ33763.1| Sco1/SenC family protein [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 219

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/208 (23%), Positives = 89/208 (42%), Gaps = 18/208 (8%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFN-------------SDVHLVAQDGTDF 49
               I   I+  VLG I          +     N               + +  Q+G   
Sbjct: 15  KTVFIAAAIVALVLGLILSQLLPGSGSEDQAALNDAGIVLLPKSRQLPALSMSDQNGAAV 74

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           +L  L  K +++FFG+T C  +CPTTL+++ ++  +  +     +    ++VDP RDTP+
Sbjct: 75  ALDDLKGKWTLMFFGYTFCPDICPTTLAQIKQIRTELPEKVVERMRVVLVSVDPDRDTPQ 134

Query: 109 VMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFD 168
            +K+++  F  + IG++    D+ ++A    I        K      YFVDH+  L L  
Sbjct: 135 QLKQYLGYFDKQYIGLTSPVADIQKLANAVSIPFIPADTSKP----NYFVDHSGNLALIG 190

Query: 169 TAGSIVGVIPYKDDSDSAIEKINRLITY 196
             G+  G I    ++   ++++  L+  
Sbjct: 191 PDGTQRGFIRAPLNNQKLVKQLPGLLER 218


>gi|42781342|ref|NP_978589.1| lipoprotein [Bacillus cereus ATCC 10987]
 gi|42737264|gb|AAS41197.1| SCO1/SenC family lipoprotein [Bacillus cereus ATCC 10987]
          Length = 195

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 76/200 (38%), Gaps = 14/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK    I+G +++  L  +A  S S SK                QDG  F    L  K  
Sbjct: 1   MKRYQKIIGLMVVFCLFVLAGCSGSGSKLRKPLNWDLETFQFTNQDGKPFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FTNC  VCP   + + +L K        +     +VDP  D PE +K F+Q+F++
Sbjct: 61  VADFMFTNCQTVCPPMTANMAKLQKMAKEEKLDVQFVSFSVDPDLDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                  ++G    D+ + +K+                E   V H T+  L D  G ++ 
Sbjct: 121 DTSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFYLIDQNGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRL 193
                     +  I  + RL
Sbjct: 174 KYNGISNTPYEDIIRDMKRL 193


>gi|70730389|ref|YP_260130.1| SCO1/SenC family protein [Pseudomonas fluorescens Pf-5]
 gi|68344688|gb|AAY92294.1| SCO1/SenC family protein [Pseudomonas fluorescens Pf-5]
          Length = 201

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 50/173 (28%), Positives = 76/173 (43%), Gaps = 5/173 (2%)

Query: 22  VSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDR 81
           +SF       N+       L    G   SLSS      ++FFGFT C AVCPTTL+R  +
Sbjct: 31  LSFKYGKDLSNQILGRTFKLTDSQGETKSLSSYRGLMPMIFFGFTQCPAVCPTTLARAAQ 90

Query: 82  LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIY 141
             K +   G  L   FIT+DP+RDTPEV+  +V+ F      + G        AK F ++
Sbjct: 91  AKKLMGRDGDRLQVVFITLDPERDTPEVLDAYVKSFDPSFEALYGTLEQTAATAKEFGVF 150

Query: 142 VNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
              +          Y + HT    +FD+ G++   +     +    E +  ++
Sbjct: 151 YEKIP-----SGSTYTLSHTATSFVFDSRGTLRLGLSQSLTAQECAEDLLTVM 198


>gi|221201372|ref|ZP_03574411.1| electron transport protein SCO1/SenC [Burkholderia multivorans
           CGD2M]
 gi|221208852|ref|ZP_03581850.1| electron transport protein SCO1/SenC [Burkholderia multivorans
           CGD2]
 gi|221171308|gb|EEE03757.1| electron transport protein SCO1/SenC [Burkholderia multivorans
           CGD2]
 gi|221178640|gb|EEE11048.1| electron transport protein SCO1/SenC [Burkholderia multivorans
           CGD2M]
          Length = 241

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/158 (28%), Positives = 80/158 (50%), Gaps = 4/158 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              L   DG     ++   + ++V+FG+T+C  VCP T++RL  +L ++ P    +   F
Sbjct: 81  SFDLTGGDGRPVDAAAFRGRVALVYFGYTHCPDVCPETMARLMEVLAKLGPQANAVRILF 140

Query: 98  ITVDPKRDTPEVMKKFVQRFS-DRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           ++VDP RDTP+ M+ +V  F  +   G++G    +  +AK +R+       EK      Y
Sbjct: 141 VSVDPARDTPQAMQSYVNAFDAEHARGLTGTDRQIESLAKRYRVAYQM---EKRDPSGGY 197

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            V H++A+ +FD  G    +   +D  D+    + R+I
Sbjct: 198 EVTHSSAVYVFDANGRARLLATDRDSPDAIAADVRRII 235


>gi|134279834|ref|ZP_01766546.1| SCO1/SenC family protein [Burkholderia pseudomallei 305]
 gi|134249034|gb|EBA49116.1| SCO1/SenC family protein [Burkholderia pseudomallei 305]
          Length = 197

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 77/198 (38%), Gaps = 7/198 (3%)

Query: 1   MKALGIILGTILLAV---LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           M+   +     L      +GS A   F S  +           L    G   +       
Sbjct: 2   MRRKALGALCSLALAGAPVGSRAATPFYSLPLSSKDWHKG-FRLTDLHGHTKTPQDDRGN 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             ++FFGF +C ++C TT+  L +  ++V      +   F+T+DP RDT   + +++  F
Sbjct: 61  VLLLFFGFLSCPSICSTTMLELTQAKERVGAQKDKVKILFVTLDPNRDTSPTIARWLASF 120

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
            D  IG+      V + A    +    V  +   V   Y +DH     +FD  G +  + 
Sbjct: 121 GDDNIGLRDSEAHVRKAATALNLKYERVEGD---VPGAYTIDHGVQTYVFDPQGRLRLIA 177

Query: 178 PYKDDSDSAIEKINRLIT 195
               + +   + I +L++
Sbjct: 178 RAGIEPEYVAKDIVQLLS 195


>gi|115351088|ref|YP_772927.1| electron transport protein SCO1/SenC [Burkholderia ambifaria AMMD]
 gi|115281076|gb|ABI86593.1| electron transport protein SCO1/SenC [Burkholderia ambifaria AMMD]
          Length = 217

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 78/158 (49%), Gaps = 4/158 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              L   DG     ++   + ++V+FG+T+C  VCP T++RL  +L ++ P    +   F
Sbjct: 53  SFTLTGGDGHPVDANAFRGRIALVYFGYTHCPDVCPETMARLMEVLAKLGPQANHVRILF 112

Query: 98  ITVDPKRDTPEVMKKF-VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           ++VDP RDTP+ M+ +     +    G++G    +  +AK +R+       EK      Y
Sbjct: 113 VSVDPARDTPQAMQSYVAAFDAAHARGLTGTDGQIESLAKRYRVAYQM---EKRDPSGGY 169

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            V H++A+ +FD  G    +   +D  D+    + R+I
Sbjct: 170 EVTHSSAVYIFDANGRARLLATDRDSPDAIAADVRRII 207


>gi|315128021|ref|YP_004070024.1| SCO1/SenC protein (copper-binding protein) [Pseudoalteromonas sp.
           SM9913]
 gi|315016535|gb|ADT69873.1| SCO1/SenC protein (copper-binding protein) [Pseudoalteromonas sp.
           SM9913]
          Length = 205

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/189 (22%), Positives = 81/189 (42%), Gaps = 8/189 (4%)

Query: 1   MKALG---IILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           MK L    ++   + L+       +      V    +  SD  L  Q G   +      +
Sbjct: 1   MKQLWCGLVVFSVLFLSACSDKKNLQDLDALVYETAKPLSDFSLRDQQGKLVTKQQFLGQ 60

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
            ++VF G+T+C  +CP TL++L+   K +      L  +FI+VDPKRD  +  K+++  F
Sbjct: 61  WNLVFLGYTSCPDICPMTLAKLNNAYKNLQA-EYPLQVWFISVDPKRDIAQKRKEYIDYF 119

Query: 118 SDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVI 177
           +   + +SG+  D+    +   +            E  Y VDH+ ++ L D +G++  + 
Sbjct: 120 NPDFLAVSGEHKDLFPFVRELGLIYAI----SDSNESDYAVDHSASVALVDGSGALRAIF 175

Query: 178 PYKDDSDSA 186
             +      
Sbjct: 176 KPEFKQGDV 184


>gi|160872909|ref|ZP_02063041.1| ggdef [Rickettsiella grylli]
 gi|159121708|gb|EDP47046.1| ggdef [Rickettsiella grylli]
          Length = 211

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/202 (22%), Positives = 86/202 (42%), Gaps = 14/202 (6%)

Query: 4   LGIILGTILLAVLGSIAYVSFSSKF---------VDGNRRFNSDVHLVAQDGTDFSLSSL 54
           L +I+  I+   LG    +  + K          +    +   + HLV      F+  +L
Sbjct: 11  LSLIIFGIVALALGIGFNLWHAKKTHVVAPSVGTMIDTPQPIPEFHLVNGSHQPFTNLNL 70

Query: 55  YIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKF 113
               S +FFGFT+C  +CP T++ L +L  +       L    FIT+DP+ DTP+V+  +
Sbjct: 71  KGHYSFLFFGFTHCQNICPLTMTLLTQLYSELNAEKLPLPQIVFITLDPRHDTPQVVGAY 130

Query: 114 VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
              F+ R IG++G    + +++K   +       +    E    +DH+  L L +    +
Sbjct: 131 AHAFNPRFIGVTGPSAGIQQLSKQLGVVY----LQHDSSENNSQIDHSGTLYLINPDAQL 186

Query: 174 VGVIPYKDDSDSAIEKINRLIT 195
           V +     +  +  +    ++ 
Sbjct: 187 VAIFTPPHNKANIKKDYKTVVR 208


>gi|221214066|ref|ZP_03587039.1| electron transport protein SCO1/SenC [Burkholderia multivorans
           CGD1]
 gi|221166243|gb|EED98716.1| electron transport protein SCO1/SenC [Burkholderia multivorans
           CGD1]
          Length = 211

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 79/158 (50%), Gaps = 4/158 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              L   DG     ++   + ++V+FG+T+C  VCP T++RL  +L ++ P    +   F
Sbjct: 51  SFDLTGGDGRPVDAAAFRGRVALVYFGYTHCPDVCPETMARLMEVLAKLGPQANAVRILF 110

Query: 98  ITVDPKRDTPEVMKKF-VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           ++VDP RDTP+ M+ +     ++   G++G    +  +AK +R+       EK      Y
Sbjct: 111 VSVDPARDTPQAMQSYVAAFDAEHARGLTGTDRQIESLAKRYRVAYQM---EKRDPSGGY 167

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            V H++A+ +FD  G    +   +D  D+    + R+I
Sbjct: 168 EVTHSSAVYVFDANGRARLLATDRDSPDAIAADVRRII 205


>gi|138895322|ref|YP_001125775.1| lipoprotein [Geobacillus thermodenitrificans NG80-2]
 gi|134266835|gb|ABO67030.1| SCO1/SenC family lipoprotein [Geobacillus thermodenitrificans
           NG80-2]
          Length = 201

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 49/199 (24%), Positives = 75/199 (37%), Gaps = 22/199 (11%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIV 61
           K + +I    LLA  G            D      +D   V Q G  F L  L  K  + 
Sbjct: 14  KRIMMIAAVCLLAACG--------KTIPDAKNWPVADFTFVDQSGEPFGLRDLKGKIWVA 65

Query: 62  FFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD-- 119
            F FTNC  VCP   + + +L K+ +  G  +     +VDP+ DTPE +  + ++F+D  
Sbjct: 66  DFVFTNCETVCPPMTANMAKLKKKAEEKGLDVEFVSFSVDPEVDTPEKLTAYAKQFTDDL 125

Query: 120 -RIIGISGDP--IDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
                ++G           K+F+  V     +         V H T   L    G+I+  
Sbjct: 126 ANWHFLTGYSQTEINELAQKSFKTIVQKPANDD-------QVIHGTNFYLVGPDGNIIQT 178

Query: 177 IPY--KDDSDSAIEKINRL 193
                    D+ +E I  L
Sbjct: 179 YNGVQDVPYDTILEHIEIL 197


>gi|91794827|ref|YP_564478.1| electron transport protein SCO1/SenC [Shewanella denitrificans
           OS217]
 gi|91716829|gb|ABE56755.1| electron transport protein SCO1/SenC [Shewanella denitrificans
           OS217]
          Length = 212

 Score = 99.2 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 86/208 (41%), Gaps = 14/208 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60
           +K L  +L  + L ++ ++   S +   +   +    +  L +  G + SLS    K  +
Sbjct: 5   LKKLMTMLAAVQLYLVLALFGSSVALAQMPVLKGIGGEFSLKSSKGGEVSLSDFKDKVVL 64

Query: 61  VFFGFTNCSAVCP-TTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +FFG+TNC+ +CP T       + K      + +   F+++D   DTP+ + K++  F  
Sbjct: 65  MFFGYTNCADICPTTMAHISQMMNKLTPEQRSRVQVLFVSIDSDYDTPKHLNKYLAYFDP 124

Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNV-------------LAEKSGVEEKYFVDHTTALLL 166
             IG+  +   +  VAK F      +             L ++   ++ Y   H+  + +
Sbjct: 125 SFIGLVDEREKIDYVAKLFHADYIKLANDKVTTEFKKLSLDDEKQEQKGYLYSHSAKIFV 184

Query: 167 FDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            DT   + G        +   +++  L+
Sbjct: 185 MDTHSRVRGFFYAGTAIEDMRQQVISLL 212


>gi|30262262|ref|NP_844639.1| lipoprotein [Bacillus anthracis str. Ames]
 gi|47527546|ref|YP_018895.1| lipoprotein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49185104|ref|YP_028356.1| lipoprotein [Bacillus anthracis str. Sterne]
 gi|49477574|ref|YP_036362.1| cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|118477679|ref|YP_894830.1| cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis str. Al Hakam]
 gi|165870599|ref|ZP_02215253.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0488]
 gi|167633122|ref|ZP_02391448.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0442]
 gi|167642067|ref|ZP_02400292.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0193]
 gi|170686941|ref|ZP_02878160.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0465]
 gi|170706689|ref|ZP_02897148.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0389]
 gi|177649709|ref|ZP_02932711.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0174]
 gi|190565134|ref|ZP_03018054.1| SCO1/SenC family lipoprotein [Bacillus anthracis Tsiankovskii-I]
 gi|196034020|ref|ZP_03101431.1| SCO1/SenC family lipoprotein [Bacillus cereus W]
 gi|196039994|ref|ZP_03107297.1| SCO1/SenC family lipoprotein [Bacillus cereus NVH0597-99]
 gi|196046938|ref|ZP_03114159.1| SCO1/SenC family lipoprotein [Bacillus cereus 03BB108]
 gi|218903390|ref|YP_002451224.1| SCO1/SenC family lipoprotein [Bacillus cereus AH820]
 gi|225864228|ref|YP_002749606.1| SCO1/SenC family lipoprotein [Bacillus cereus 03BB102]
 gi|227814936|ref|YP_002814945.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. CDC 684]
 gi|228914850|ref|ZP_04078457.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228927316|ref|ZP_04090376.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228945869|ref|ZP_04108212.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|229121803|ref|ZP_04251023.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           95/8201]
 gi|229184477|ref|ZP_04311681.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           BGSC 6E1]
 gi|229196474|ref|ZP_04323218.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           m1293]
 gi|229603388|ref|YP_002866602.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0248]
 gi|254684830|ref|ZP_05148690.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. CNEVA-9066]
 gi|254722238|ref|ZP_05184026.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A1055]
 gi|254737276|ref|ZP_05194980.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. Western North
           America USA6153]
 gi|254743537|ref|ZP_05201222.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. Kruger B]
 gi|254751592|ref|ZP_05203629.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. Vollum]
 gi|254759107|ref|ZP_05211134.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. Australia 94]
 gi|301053779|ref|YP_003791990.1| SCO1/SenC family lipoprotein [Bacillus anthracis CI]
 gi|30256893|gb|AAP26125.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. Ames]
 gi|47502694|gb|AAT31370.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49179031|gb|AAT54407.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. Sterne]
 gi|49329130|gb|AAT59776.1| cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|118416904|gb|ABK85323.1| cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis str. Al Hakam]
 gi|164713754|gb|EDR19277.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0488]
 gi|167509970|gb|EDR85391.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0193]
 gi|167531934|gb|EDR94599.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0442]
 gi|170128420|gb|EDS97288.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0389]
 gi|170668992|gb|EDT19736.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0465]
 gi|172084783|gb|EDT69841.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0174]
 gi|190563161|gb|EDV17126.1| SCO1/SenC family lipoprotein [Bacillus anthracis Tsiankovskii-I]
 gi|195993700|gb|EDX57657.1| SCO1/SenC family lipoprotein [Bacillus cereus W]
 gi|196022313|gb|EDX60999.1| SCO1/SenC family lipoprotein [Bacillus cereus 03BB108]
 gi|196029253|gb|EDX67857.1| SCO1/SenC family lipoprotein [Bacillus cereus NVH0597-99]
 gi|218539964|gb|ACK92362.1| SCO1/SenC family lipoprotein [Bacillus cereus AH820]
 gi|225786272|gb|ACO26489.1| SCO1/SenC family lipoprotein [Bacillus cereus 03BB102]
 gi|227007631|gb|ACP17374.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. CDC 684]
 gi|228586830|gb|EEK44904.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           m1293]
 gi|228598977|gb|EEK56593.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           BGSC 6E1]
 gi|228661592|gb|EEL17212.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           95/8201]
 gi|228813743|gb|EEM60021.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228832328|gb|EEM77905.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228844797|gb|EEM89841.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|229267796|gb|ACQ49433.1| SCO1/SenC family lipoprotein [Bacillus anthracis str. A0248]
 gi|300375948|gb|ADK04852.1| SCO1/SenC family lipoprotein [Bacillus cereus biovar anthracis str.
           CI]
 gi|324326284|gb|ADY21544.1| SCO1/SenC family lipoprotein [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 195

 Score = 98.8 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/200 (24%), Positives = 76/200 (38%), Gaps = 14/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK    ++G +++  L  +A  S S SK                QDG  F    L  K  
Sbjct: 1   MKRYQKVIGLMVVFCLFVLAGCSGSGSKLRKPLNWDLETFQFTNQDGKPFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FTNC  VCP   + + +L K        +     +VDP  D PE +K F+Q+F++
Sbjct: 61  VADFMFTNCQTVCPPMTANMAKLQKMAKEEKLDVQFVSFSVDPDLDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                  ++G    D+ + +K+                E   V H T+  L D  G ++ 
Sbjct: 121 DTSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFYLIDQNGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRL 193
                     +  I  + RL
Sbjct: 174 KYSGISNTPYEDIIRDMKRL 193


>gi|330806757|ref|YP_004351219.1| Putative copper-binding protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374865|gb|AEA66215.1| Putative copper-binding protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 211

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 50/209 (23%), Positives = 90/209 (43%), Gaps = 18/209 (8%)

Query: 2   KALGIILGTILLAVLGSIAYVSFSSKFVDGNRRF------------NSDVHLVAQDGTDF 49
           K + I++  I L +  +I  V       D                   DV +  QDG   
Sbjct: 6   KTVFILVAVIALILGLTINKVLSGKGQGDPTALIDAGIILLPQSRNLPDVKMTDQDGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
           ++  L  K S++FFG+T C  +CPTTL++L ++  +        L    ++VDP RDTP+
Sbjct: 66  AMDGLKDKWSLLFFGYTFCPDICPTTLAQLRQIKSELPPEAVAKLQIVLVSVDPNRDTPK 125

Query: 109 VMKKFVQRFSDRIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
            +K+++  F  + IG++     D+ ++A    I        K      Y VDH+  L + 
Sbjct: 126 QLKQYLGYFDPQFIGLTAASVEDLQKLANAVSIPFIPADTSKP----NYTVDHSGNLAVI 181

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITY 196
              G+  G I    ++   + ++  ++  
Sbjct: 182 GPDGTQRGFIRAPLNNQKLVAQLPEMLKR 210


>gi|209544964|ref|YP_002277193.1| electron transport protein SCO1/SenC [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532641|gb|ACI52578.1| electron transport protein SCO1/SenC [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 203

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/199 (19%), Positives = 73/199 (36%), Gaps = 9/199 (4%)

Query: 2   KALGIILGTILLAVLGSIAYVS----FSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           + L I L    L + G+ A                        LV+      S +    +
Sbjct: 7   RRLKIGLVVAALGLAGTYAGYRVMDRIGPVLSTHGNEIGGSFRLVSAAEGTVSDTDFQGR 66

Query: 58  PSIVFFGFTNCSAV-CPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
             +V+FG T+C    C  TL  +   + ++     L+   FI+VDP RDT E M+ +  R
Sbjct: 67  WMLVYFGSTHCPESQCAATLKAMAGAMDRLGQRARLVAPLFISVDPMRDTAEEMRAYTLR 126

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F   I  ++G P  +  V   +         +       Y ++ +  +++    G   G 
Sbjct: 127 FGPHIFAMTGAPNMIKAVTAEYHAPYVRHEGKD----GDYTMEPSPRIVIMSPEGRYAGT 182

Query: 177 IPYKDDSDSAIEKINRLIT 195
           I     ++   +++  L+ 
Sbjct: 183 IQSDSSAEQIADRLTGLMK 201


>gi|28869798|ref|NP_792417.1| Sco1/SenC family protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28853043|gb|AAO56112.1| Sco1/SenC family protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|330963649|gb|EGH63909.1| Sco1/SenC family protein [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|331014489|gb|EGH94545.1| Sco1/SenC family protein [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 201

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 49/179 (27%), Positives = 83/179 (46%), Gaps = 5/179 (2%)

Query: 16  LGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTT 75
            G+   + F       N     +  L    G   +LSS      ++FFGFT C A+CPT 
Sbjct: 25  CGNSNALPFKHGKDMSNEIVGRNFRLKDSQGNVKTLSSFRGLMPMIFFGFTQCPAICPTA 84

Query: 76  LSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVA 135
           L+R  ++ K +   G  L   FIT+DP+RDTP+V+  +V+ F    + +SG   + +  A
Sbjct: 85  LARAAQIRKLMGEEGKTLQVVFITLDPERDTPDVIDAYVKAFDPTFVALSGTLEETVATA 144

Query: 136 KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
           K F ++   V        + Y + HT    ++DT G +   + ++  +    E +  L+
Sbjct: 145 KEFGVFFEKVPL-----GDTYTISHTATSYVYDTRGVLRLGLSHRLSAPQCTEDLLTLM 198


>gi|24376088|ref|NP_720131.1| SCO1/SenC family protein [Shewanella oneidensis MR-1]
 gi|24351114|gb|AAN57575.1|AE015893_4 SCO1/SenC family protein [Shewanella oneidensis MR-1]
          Length = 213

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 52/212 (24%), Positives = 89/212 (41%), Gaps = 24/212 (11%)

Query: 2   KAL--GIILGTILLAVLGSIAYVSF--------SSKFVDGNRRFNSDVHLVAQDGTDFSL 51
           K +   +++  ILL  LG +  V F         S F+       +   LV Q    F+ 
Sbjct: 3   KRIPNTLLVIAILLIGLGGLFSVKFTPPKPVELQSGFMFPEAFALAPFELVDQHKQAFTN 62

Query: 52  SSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMK 111
           ++L  + S+ F GFT C  +CPTTL++L     ++      +   F++VDPKRDTP+ + 
Sbjct: 63  ANLTDQWSLFFIGFTYCPDICPTTLNKLAAAYHELKKIA-PIQVVFLSVDPKRDTPDKLL 121

Query: 112 KFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAG 171
            +V  F+     I+G    +  + ++       V     G  E Y VDH+   +L    G
Sbjct: 122 SYVNFFNPEFKAITGKQTQIFPLTRSLGFTYAMV-----GEGENYQVDHSAGYVLVSPQG 176

Query: 172 SIVGVIPYKDDS--------DSAIEKINRLIT 195
           + V V               ++ I    +++ 
Sbjct: 177 TRVAVFKPTAALGQAPQVLNEALISDFAKIVN 208


>gi|229133080|ref|ZP_04261918.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           BDRD-ST196]
 gi|228650378|gb|EEL06375.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           BDRD-ST196]
          Length = 195

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 47/202 (23%), Positives = 79/202 (39%), Gaps = 18/202 (8%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSD---VHLVAQDGTDFSLSSLYIK 57
           MK    ++G +++  L  +A  S S   +   +  N D        Q+G  F    L  K
Sbjct: 1   MKRYQKLIGLMVVFCLFVLAGCSSSGAKL--RKPLNWDLETFQFTNQEGKPFGTKDLKGK 58

Query: 58  PSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF 117
             +  F FTNC  VCP   + + +L K        +     +VDP+ D PE +K F+Q+F
Sbjct: 59  VWVADFMFTNCQTVCPPMTANMAKLQKMAKEEKLDVQFVSFSVDPELDKPENLKAFIQKF 118

Query: 118 SD---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSI 173
           ++       ++G    D+ + +K+                E   V H T+  L D  G +
Sbjct: 119 TEDTSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFFLVDQNGKV 171

Query: 174 VGVIPY--KDDSDSAIEKINRL 193
           +           +  I  + RL
Sbjct: 172 MKKYSGISNTPYEDIIRDMKRL 193


>gi|229017566|ref|ZP_04174461.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           AH1273]
 gi|229023783|ref|ZP_04180268.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           AH1272]
 gi|228737468|gb|EEL87978.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           AH1272]
 gi|228743709|gb|EEL93814.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus cereus
           AH1273]
          Length = 195

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/200 (23%), Positives = 77/200 (38%), Gaps = 14/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK    ++G +++  L  +A  S S SK                Q+G  F    L  K  
Sbjct: 1   MKRYQKLIGLMVVFCLFVLAGCSSSGSKLRKPLNWDLETFQFTNQEGKPFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FTNC  VCP   + + +L K        +     +VDP+ D PE +K F+Q+F++
Sbjct: 61  VADFMFTNCQTVCPPMTANMAKLQKMAKEEKLDVEFVSFSVDPELDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                  ++G    ++ + +K+                E   V H T+  L D  G ++ 
Sbjct: 121 DTSNWNLLTGYSLEEITKFSKD-------NFQSLVDKPEDGQVIHGTSFYLIDQNGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRL 193
                     +  I  + RL
Sbjct: 174 KYSGISNTPYEDIIRDMKRL 193


>gi|145395070|gb|ABP65330.1| major surface protein 5 [Anaplasma phagocytophilum]
          Length = 182

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 79/171 (46%), Gaps = 8/171 (4%)

Query: 14  AVLGSIAYVSFSSKFVDGNRRFNSDVH-LVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVC 72
           A+   +     S+  V       +    L+ Q+G   S +    K  ++ FGF++C  +C
Sbjct: 1   AIFSDMGAKLSSTDTVVEQAPILASFTDLINQEGQVVSSTDFAGKHMLLMFGFSSCKHIC 60

Query: 73  PTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVM 132
           P  L  + +LL ++  T   L A FIT+DPK DT E + ++ + F  RI  ++GD   + 
Sbjct: 61  PAELGMVSQLLNKLGETADKLQAVFITIDPKNDTVERLNEYHKAFDSRIQMLTGDEEVIR 120

Query: 133 RVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
            V  N+++YV          + +  ++H++ L L D  G  VG      D 
Sbjct: 121 NVVNNYKVYV-------GESDSEGDINHSSFLYLVDADGRYVGHFAPDFDE 164


>gi|65319553|ref|ZP_00392512.1| COG1999: Uncharacterized protein SCO1/SenC/PrrC, involved in
           biogenesis of respiratory and photosynthetic systems
           [Bacillus anthracis str. A2012]
          Length = 195

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 47/200 (23%), Positives = 75/200 (37%), Gaps = 14/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK    ++G +++  L  +A  S S SK                QDG  F    L  K  
Sbjct: 1   MKRYQKVIGLMVVFCLFVLAGCSGSGSKLRKPLNWDLETFQFTNQDGKPFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FT C  VCP   + + +L K        +     +VDP  D PE +K F+Q+F++
Sbjct: 61  VADFMFTXCQTVCPPMTANMAKLQKMAKEEKLDVQFVSFSVDPDLDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                  ++G    D+ + +K+                E   V H T+  L D  G ++ 
Sbjct: 121 DTSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFYLIDQNGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRL 193
                     +  I  + RL
Sbjct: 174 KYSGISNTPYEDIIRDMKRL 193


>gi|167586654|ref|ZP_02379042.1| electron transport protein SCO1/SenC [Burkholderia ubonensis Bu]
          Length = 214

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 80/158 (50%), Gaps = 4/158 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              L   DG     S+   + S+V+FG+T+C  VCP T++RL  +L Q+ P    +   F
Sbjct: 54  SFTLTGGDGRPVDASAFRGRVSLVYFGYTHCPDVCPETMARLMEVLAQLGPQARNVRILF 113

Query: 98  ITVDPKRDTPEVMKKF-VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           ++VDP RDTP+ M+ +     ++   G++G    +  +AK +R+       E+      Y
Sbjct: 114 VSVDPARDTPQTMQSYVAAFDAEHARGLTGTDRQIESLAKRYRVAYQM---EQRDPSGGY 170

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            V H++A+ +FD +G    +   +D  D+    + R++
Sbjct: 171 EVTHSSAVYIFDASGRARLLATDRDKPDAIAADVRRIL 208


>gi|312958167|ref|ZP_07772690.1| electron transport protein [Pseudomonas fluorescens WH6]
 gi|311287598|gb|EFQ66156.1| electron transport protein [Pseudomonas fluorescens WH6]
          Length = 211

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 52/209 (24%), Positives = 89/209 (42%), Gaps = 19/209 (9%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKF-------------VDGNRRFNSDVHLVAQDGTDF 49
               IL  I+  ++G       S K              +    R    V +  QDG   
Sbjct: 6   KTVFILVAIVALIMGLTVNKVLSGKGQGDPTALIDAGIILLPQSRQLPAVTMTNQDGQPV 65

Query: 50  SLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPE 108
            +++L  K S++FFG+T C  +CPTTL++L ++  +        L    ++VDP RDTP 
Sbjct: 66  QVNALKGKWSLLFFGYTFCPDICPTTLAQLRQIKSELPKEAVDKLQVILVSVDPNRDTPT 125

Query: 109 VMKKFVQRFSDRIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLF 167
            +K+++  F  +  G++G +  DV +V+    I        K      Y VDH+  L L 
Sbjct: 126 QLKQYLGYFDPQFAGLTGANVDDVQKVSNAVSIPFIPADTSKP----NYTVDHSGNLALI 181

Query: 168 DTAGSIVGVIPYKDDSDSAIEKINRLITY 196
              G+  G I    ++   + ++  L+  
Sbjct: 182 GPDGTQRGFIRAPLNNQKLVAQLPGLLQR 210


>gi|170699562|ref|ZP_02890602.1| electron transport protein SCO1/SenC [Burkholderia ambifaria
           IOP40-10]
 gi|170135513|gb|EDT03801.1| electron transport protein SCO1/SenC [Burkholderia ambifaria
           IOP40-10]
          Length = 218

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 43/162 (26%), Positives = 79/162 (48%), Gaps = 4/162 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              L   DG     ++   + ++V+FG+T+C  VCP T++RL  +L ++ P    +   F
Sbjct: 54  SFTLTGGDGHPVDANAFRGRIALVYFGYTHCPDVCPETMARLMEVLAKLGPQANDVRILF 113

Query: 98  ITVDPKRDTPEVMKKF-VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           ++VDP RDTP+ M+ +     +    G++G    +  +AK +R+       EK      Y
Sbjct: 114 VSVDPARDTPQAMQSYVAAFDAAHARGLTGTDGQIESLAKRYRVAYQM---EKRDPSGGY 170

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLITYGN 198
            V H++A+ +FD  G    +   +D  D+    + R+I   +
Sbjct: 171 EVTHSSAVYIFDANGRARLLATDRDSPDAIAADVRRIIDTSS 212


>gi|149374914|ref|ZP_01892687.1| hypothetical protein MDG893_07650 [Marinobacter algicola DG893]
 gi|149360803|gb|EDM49254.1| hypothetical protein MDG893_07650 [Marinobacter algicola DG893]
          Length = 190

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 50/194 (25%), Positives = 87/194 (44%), Gaps = 6/194 (3%)

Query: 6   IILGTILLAVLGSIAYV-SFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFG 64
           + L   L+ + G      +++ K + G     +   L    G   + S       ++FFG
Sbjct: 1   MALLASLVMLGGCFGDDENWNGKDISGLMPELA-FELTGTSGETVTASQTDGNIRLLFFG 59

Query: 65  FTNCSAVCPTTLSRLDR-LLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIG 123
           FT+C  +CP TL +L R +    +   T     F++VDP+RDTPE +  +V  FSDR IG
Sbjct: 60  FTSCPDICPATLQKLSRAVTNLPEALRTDTQIVFVSVDPQRDTPERIDSYVSFFSDRAIG 119

Query: 124 ISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDS 183
           ++G+   +  ++K +R        ++   E  Y V H+ A+ +FD  G    +I  +   
Sbjct: 120 LTGEEPALRELSKRYRTTFG---YDEPDAEGNYNVSHSGAVYVFDREGKARLLIRPELSV 176

Query: 184 DSAIEKINRLITYG 197
           +     +  L    
Sbjct: 177 EEIRTDLVALAEES 190


>gi|162149304|ref|YP_001603765.1| electron transport protein SCO1/SenC [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787881|emb|CAP57479.1| Electron transport protein SCO1/SenC [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 203

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 74/199 (37%), Gaps = 9/199 (4%)

Query: 2   KALGIILGTILLAVLGSIAYVS----FSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIK 57
           + L I L    L + G+ A                        LV+      S +    +
Sbjct: 7   RRLKIGLVVAALGLAGTYAGYRVMDRIGPVLSTHGNEIGGSFRLVSAAEGTVSDTDFQGR 66

Query: 58  PSIVFFGFTNCSAV-CPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQR 116
             +V+FG T+C    C  TL  +   + ++     L+   FI+VDP RDT E M+ +  R
Sbjct: 67  WMLVYFGSTHCPESQCAATLKAMAGAMDRLGQRARLVAPLFISVDPMRDTAEEMRAYTLR 126

Query: 117 FSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGV 176
           F   I  ++G P  +  V   +            G +  Y ++ +  +++    G   G 
Sbjct: 127 FGPHIFAMTGAPNMIKAVTAEYHAPYVRHE----GHDGDYTMEPSPRIVIMSPEGRYAGT 182

Query: 177 IPYKDDSDSAIEKINRLIT 195
           I     ++   +++  L+ 
Sbjct: 183 IQSDSSAEQIADRLTGLMK 201


>gi|219124595|ref|XP_002182585.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405931|gb|EEC45872.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 171

 Score = 98.8 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 70/164 (42%), Gaps = 7/164 (4%)

Query: 31  GNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLK----QV 86
           G         LV  +G   +  S   K  +++FGF  C  +CP+ + ++ +++       
Sbjct: 1   GKPAIGGPWSLVDLEGNLVTNRSFEGKWLLLYFGFARCPDICPSEMMKVGQVMDTLKKDF 60

Query: 87  DPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVL 146
                 +   F++VDP RD+ + +K +   F    + ++G P  V ++AK +R+YV+   
Sbjct: 61  PKLYEKVVPVFVSVDPARDSLKALKAYGTDFHPDYVFLTGAPDQVQQMAKKYRVYVSK-- 118

Query: 147 AEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKI 190
                 +  Y VDH+  +   D  G +             +EK+
Sbjct: 119 -ADESPDGDYLVDHSIVIYFHDDTGDLSDCFTQSMRPSDVVEKV 161


>gi|256823545|ref|YP_003147508.1| electron transport protein SCO1/SenC [Kangiella koreensis DSM
           16069]
 gi|256797084|gb|ACV27740.1| electron transport protein SCO1/SenC [Kangiella koreensis DSM
           16069]
          Length = 216

 Score = 98.4 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 41/186 (22%), Positives = 73/186 (39%), Gaps = 9/186 (4%)

Query: 3   ALGIILGTILLAVLGSIAYVSFSSKFV------DGNRRFNSDVHLVAQDGTDFSLSSLYI 56
            +  I+  +L  V G ++Y    +          G  R  +        G  F+  S   
Sbjct: 9   RMIFIISAVLALVAGVMSYQLLFAPKEMQLMRTFGEPRAIAPFEGKTHTGETFNQESFIG 68

Query: 57  KPSIVFFGFTNCSAVCP-TTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQ 115
             SIVFFGFT C  VCP    +    + K      +      ++VDP+RD+ E + K+V 
Sbjct: 69  NWSIVFFGFTTCPDVCPTAMSNINQVMQKLPPEIASSTQVVMVSVDPERDSIERLAKYVP 128

Query: 116 RFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
            F+   IGI+    +  ++ ++  +    +        + Y V+HT    + D  G    
Sbjct: 129 AFNKDFIGINAGLEETRKLTESIGVTFYKIPG--HDDPDNYLVEHTARWFIIDPLGRRYA 186

Query: 176 VIPYKD 181
           ++   +
Sbjct: 187 LLSPDE 192


>gi|221310088|ref|ZP_03591935.1| hypothetical protein Bsubs1_11976 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221314409|ref|ZP_03596214.1| hypothetical protein BsubsN3_11892 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319332|ref|ZP_03600626.1| hypothetical protein BsubsJ_11823 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323608|ref|ZP_03604902.1| hypothetical protein BsubsS_11952 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|255767476|ref|NP_390058.2| assembly factor BSco of the Cu(A) site of cytochrome c oxidase
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|321311641|ref|YP_004203928.1| assembly factor BSco of the Cu(A) site of cytochrome c oxidase
           [Bacillus subtilis BSn5]
 gi|251757333|sp|P54178|SCO1_BACSU RecName: Full=SCO1 protein homolog; AltName: Full=BsSco; Flags:
           Precursor
 gi|225185103|emb|CAB14093.2| assembly factor BSco of the Cu(A) site of cytochrome c oxidase
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|320017915|gb|ADV92901.1| assembly factor BSco of the Cu(A) site of cytochrome c oxidase
           [Bacillus subtilis BSn5]
          Length = 193

 Score = 98.4 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/200 (21%), Positives = 70/200 (35%), Gaps = 20/200 (10%)

Query: 1   MKALG-IILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK +  +  G I L +           +  D             QDG + SL SL  +  
Sbjct: 1   MKVIKGLTAGLIFLFLCACGG-----QQIKDPLNYEVEPFTFQNQDGKNVSLESLKGEVW 55

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRF-- 117
           +  F FTNC  +CP   + +  L K++      +     +VDP+ D P+ +KKF   +  
Sbjct: 56  LADFIFTNCETICPPMTAHMTDLQKKLKAENIDVRIISFSVDPENDKPKQLKKFAANYPL 115

Query: 118 -SDRIIGISGDPIDVMRVA--KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIV 174
             D    ++G     +     K+F+  V     E         V H ++  L    G ++
Sbjct: 116 SFDNWDFLTGYSQSEIEEFALKSFKAIVKKPEGED-------QVIHQSSFYLVGPDGKVL 168

Query: 175 GVIPY--KDDSDSAIEKINR 192
                      D  I  +  
Sbjct: 169 KDYNGVENTPYDDIISDVKS 188


>gi|228920961|ref|ZP_04084298.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228838655|gb|EEM83959.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 195

 Score = 98.4 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 49/201 (24%), Positives = 77/201 (38%), Gaps = 14/201 (6%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK    I+G +++  L  +A  S S SK                QDG  F    L  K  
Sbjct: 1   MKRYQKIIGLMVVFCLFVLAGCSESGSKLRKPLNWDLETFQFTNQDGKQFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FTNC  VCP   + + +L K        +     +VDP  D PE +K F+Q+F++
Sbjct: 61  VADFMFTNCQTVCPPMTANMAKLQKMAKEEKLDVQFVSFSVDPDLDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                  ++G    D+ + +K+                E   V H T+  L D  G ++ 
Sbjct: 121 DTSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFYLIDQNGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRLI 194
                     +  I  + RL+
Sbjct: 174 KYSGISNTPYEDIIRDMKRLV 194


>gi|228933555|ref|ZP_04096405.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228826015|gb|EEM71798.1| Cytochrome c oxidase Cu(A) center assembly protein [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
          Length = 195

 Score = 98.4 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 47/200 (23%), Positives = 75/200 (37%), Gaps = 14/200 (7%)

Query: 1   MKALGIILGTILLAVLGSIAYVSFS-SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPS 59
           MK    ++G +++  L  +   S S SK                QDG  F    L  K  
Sbjct: 1   MKRYQKVIGLMVVFCLFVLVGCSGSGSKLRKPLNWDLETFQFTNQDGKPFGTKDLKGKVW 60

Query: 60  IVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSD 119
           +  F FTNC  VCP   + + +L K        +     +VDP  D PE +K F+Q+F++
Sbjct: 61  VADFMFTNCQTVCPPMTANMAKLQKMAKEEKLDVQFVSFSVDPDLDKPENLKAFIQKFTE 120

Query: 120 ---RIIGISG-DPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVG 175
                  ++G    D+ + +K+                E   V H T+  L D  G ++ 
Sbjct: 121 DTSNWNLLTGYSLEDITKFSKD-------NFQSLVDKPENGQVIHGTSFYLIDQNGKVMK 173

Query: 176 VIPY--KDDSDSAIEKINRL 193
                     +  I  + RL
Sbjct: 174 KYSGISNTPYEDIIRDMKRL 193


>gi|172060093|ref|YP_001807745.1| electron transport protein SCO1/SenC [Burkholderia ambifaria
           MC40-6]
 gi|171992610|gb|ACB63529.1| electron transport protein SCO1/SenC [Burkholderia ambifaria
           MC40-6]
          Length = 217

 Score = 98.4 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 78/158 (49%), Gaps = 4/158 (2%)

Query: 38  DVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYF 97
              L   DG     ++   + ++V+FG+T+C  VCP T++RL  +L ++ P    +   F
Sbjct: 53  SFTLTGGDGHPVDANAFRGRIALVYFGYTHCPDVCPETMARLMEVLAKLGPQANDVRILF 112

Query: 98  ITVDPKRDTPEVMKKF-VQRFSDRIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKY 156
           ++VDP RDTP+ M+ +     +    G++G    +  +AK +R+       EK      Y
Sbjct: 113 VSVDPARDTPQAMQSYVAAFDAAHARGLTGTDGQIESLAKRYRVAYQM---EKRDPSGGY 169

Query: 157 FVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLI 194
            V H++A+ +FD  G    +   +D  D+    + R+I
Sbjct: 170 EVTHSSAVYIFDANGRARLLATDRDSPDAIAADVRRII 207


>gi|126730995|ref|ZP_01746804.1| SCO1/SenC family protein [Sagittula stellata E-37]
 gi|126708711|gb|EBA07768.1| SCO1/SenC family protein [Sagittula stellata E-37]
          Length = 199

 Score = 98.4 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 57/180 (31%), Positives = 90/180 (50%), Gaps = 7/180 (3%)

Query: 18  SIAYVSFSSKFVDGNRRFN-SDVHLVAQDGTDFSLSSLYIKPSIVFFGFTNCSAVCPTTL 76
           S  Y+           R    D  LV  DG  F+  +L   PS VFFGF++C  VCPTTL
Sbjct: 24  SWFYILEPRLNQSVTDRLGHGDYALVTSDGGTFTEDTLDGAPSAVFFGFSHCPEVCPTTL 83

Query: 77  SRLDRLLKQ-VDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRIIGISGDPIDVMRVA 135
             +        +     +  +F+TVDP+RDTPE++  +V  +++ + G+SG   ++ +  
Sbjct: 84  GDISVWQDMLAEDGLGPIRTFFVTVDPERDTPEMLGDYV-SWAEGVTGVSGSREEIDKAI 142

Query: 136 KNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYKDDSDSAIEKINRLIT 195
           + FR+Y   V  +       Y +DH+  +LLFD  G     I Y++D + A+ KI  L+ 
Sbjct: 143 RAFRVYAQKVPLKD----GGYTMDHSAMVLLFD