RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780281|ref|YP_003064694.1| cytochrome-c oxidase assembly factor protein [Candidatus Liberibacter asiaticus str. psy62] (201 letters) >gnl|CDD|162773 TIGR02227, sigpep_I_bact, signal peptidase I, bacterial type. A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. Length = 163 Score = 27.6 bits (62), Expect = 2.5 Identities = 9/38 (23%), Positives = 20/38 (52%), Gaps = 9/38 (23%) Query: 120 RIIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYF 157 R+IG+ GD ++ ++ ++Y+N ++E Y Sbjct: 73 RVIGLPGDKVEF----RDGKLYINGKK-----IDEPYL 101 >gnl|CDD|150775 pfam10139, Virul_Fac, Putative bacterial virulence factor. Members of this family of prokaryotic proteins include various putative virulence factor effector proteins. Their exact function is, as yet, unknown. Length = 852 Score = 26.6 bits (59), Expect = 4.1 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 65 FTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEV 109 FT +A P RLL + D L N++F D ++ T + Sbjct: 100 FTRTAAPNPAGFPVELRLLSEADLAKILANSFFNDFDQEKVTYPL 144 >gnl|CDD|149044 pfam07760, DUF1616, Protein of unknown function (DUF1616). This is a family of sequences from hypothetical archaeal proteins. The region in question is approximately 330 amino acid residues long. Length = 278 Score = 26.9 bits (60), Expect = 4.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Query: 2 KALGIILGTILLAVLGSIAYVSFSSK 27 KAL +IL LLA +G++AYV + K Sbjct: 141 KALSVILIISLLASVGTLAYVILTPK 166 >gnl|CDD|150726 pfam10084, DUF2322, Uncharacterized protein conserved in bacteria (DUF2322). Members of this family of hypothetical bacterial proteins have no known function. Length = 100 Score = 26.1 bits (58), Expect = 5.7 Identities = 10/23 (43%), Positives = 12/23 (52%) Query: 158 VDHTTALLLFDTAGSIVGVIPYK 180 +DH AL L D G +V I K Sbjct: 11 IDHLAALDLLDAEGEVVHHIENK 33 >gnl|CDD|183179 PRK11528, PRK11528, hypothetical protein; Provisional. Length = 254 Score = 25.8 bits (57), Expect = 6.9 Identities = 10/40 (25%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Query: 26 SKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGF 65 + NRR D + + G +F+ + KP FF Sbjct: 117 GTYGSPNRRNFHDDNTLYGIGYNFTGDGWWFKP---FFAK 153 >gnl|CDD|179671 PRK03906, PRK03906, mannonate dehydratase; Provisional. Length = 385 Score = 25.9 bits (58), Expect = 7.2 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 18/56 (32%) Query: 74 TTLSRLDRLLKQVD-P-------TGTLLNAYFITVDPKRDTPEVMKKFVQRFSDRI 121 +T L RLL VD P TG+L P D P +++ F DRI Sbjct: 249 STEEDLQRLLDAVDSPANGLTLCTGSL------GARPDNDLPAMIR----EFGDRI 294 >gnl|CDD|151065 pfam10508, Proteasom_PSMB, Proteasome non-ATPase 26S subunit. The 26S proteasome, a eukaryotic ATP-dependent, dumb-bell shaped, protease complex with a molecular mass of approx 20kDa consists of a central 20S proteasome,functioning as a catalytic machine, and two large V-shaped terminal modules, having possible regulatory roles,composed of multiple subunits of 25- 110 kDa attached to the central portion in opposite orientations. It is responsible for degradation of abnormal intracellular proteins, including oxidatively damaged proteins, and may play a role as a component of a cellular anti-oxidative system. Expression of catalytic core subunits including PSMB5 and peptidase activities of the proteasome were elevated following incubation with 3-methylcholanthrene. The 20S proteasome comprises a cylindrical stack of four rings, two outer rings formed by seven alpha-subunits (alpha1-alpha7) and two inner rings of seven beta-subunits (beta1-beta7). Two outer rings of alpha subunits maintain structure, while the central beta rings contain the proteolytic active core subunits beta1 (PSMB6), beta2 (PSMB7), and beta5 (PSMB5). Expression of PSMB5 can be altered by chemical reactants, such as 3-methylcholanthrene. Length = 503 Score = 25.4 bits (56), Expect = 8.8 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 6/83 (7%) Query: 13 LAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSIVFFGFT---NCS 69 L +L +A + ++++ N + +L+ D L ++Y+ + FFG + Sbjct: 224 LELLTDLAEGNHGAEYLIQNGVVDKLSNLIQGVEEDPDLGAMYLPGIMKFFGNLATMSPP 283 Query: 70 AVC---PTTLSRLDRLLKQVDPT 89 V P L RL +L DPT Sbjct: 284 QVIQTYPDFLGRLFSMLDSEDPT 306 >gnl|CDD|178360 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transaminase. Length = 504 Score = 25.5 bits (56), Expect = 9.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Query: 103 KRDTPEVMKKFVQRFSDRIIGISGDPI 129 +R+ PE + K RF D I SG PI Sbjct: 386 ERNIPEHVNKIAPRFQDGIKAFSGSPI 412 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.140 0.398 Gapped Lambda K H 0.267 0.0624 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,335,397 Number of extensions: 213651 Number of successful extensions: 564 Number of sequences better than 10.0: 1 Number of HSP's gapped: 564 Number of HSP's successfully gapped: 21 Length of query: 201 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 112 Effective length of database: 4,071,361 Effective search space: 455992432 Effective search space used: 455992432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.2 bits)