HHsearch results for GI: 254780282 and protein with PDBid: 1ixc_A

>1ixc_A CBNR, LYSR-type regulatory protein; long alpha helix connecting DNA binding and regulatory domains, DNA binding protein; 2.20A {Cupriavidus necator} SCOP: a.4.5.37 c.94.1.1 PDB: 1iz1_A
Probab=100.00  E-value=0  Score=349.84  Aligned_cols=290  Identities=16%  Similarity=0.159  Sum_probs=246.7

Q ss_pred             CCHHHHHHHHHHHHHCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCEEEEECCCCEEEEECCCCCCCCCCCCCCCCCHHHH
Q ss_conf             88899999999998276899998828997899999999999958821797699468500134332222222222101221
Q gi|254780282|r    3 FDWDKLRVFYVVARSGSFTHAAEQLHLSQSSISRQISGLETEVGIKLFYRHARGLTLTEQGSKLHRVTSEVYHKLETTQI   82 (299)
Q Consensus         3 md~~~L~~f~~v~~~gs~s~AA~~L~itq~avS~~i~~LE~~lg~~Lf~R~~~~~~lT~~G~~l~~~a~~~l~~~~~~~~   82 (299)
                      |||++|++|++|+++|||++||++|++||||||++|++||+++|++||+|+++|+.||++|+.|+++++++++.++++..
T Consensus         1 Md~~~l~~f~~v~~~~s~~~AA~~L~~sq~avS~~i~~LE~~lg~~Lf~R~~~~~~lT~~G~~l~~~a~~~l~~~~~~~~   80 (294)
T 1ixc_A            1 MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGIELTAAGHAFLEDARRILELAGRSGD   80 (294)
T ss_dssp             CCHHHHHHHHHHHHHSSHHHHHHHHTCCHHHHHHHHHHHHHHHTSCCBC-----CCBCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCEEEEECCCCEEECHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             96799999999998199999999988888999999999999869989998899627868899998620156776556776


Q ss_pred             HCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC--C-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             001223222222333211100000000013566754200012222222--2-2222222222223456543211112234
Q gi|254780282|r   83 ELQESSVKPSGKLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDN--K-DIDISMDYADCAIRLRKPIQSSSLIQRK  159 (299)
Q Consensus        83 ~~~~~~~~~~g~i~I~~~~~~~~~~l~~~l~~f~~~~P~i~i~i~~~~--~-~~~l~~~~~Di~i~~~~~~~~~~l~~~~  159 (299)
                      .++.......|++++++.+++...++++.+.+|.++||++.+++...+  . ...+..|++|++|.... ...+++...+
T Consensus        81 ~~~~~~~~~~~~i~~~~~~~~~~~~l~~~~~~~~~~~p~v~~~i~~~~~~~~~~~l~~g~~Di~i~~~~-~~~~~l~~~~  159 (294)
T 1ixc_A           81 RSRAAARGDVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFF-PRHPGIEIVN  159 (294)
T ss_dssp             HHHHHHHTCCEEEEEEECSGGGGTHHHHHHHHHHHHCTTEEEEEEECCHHHHHHHHHHTSCSEEEESCC-CCCTTEEEEE
T ss_pred             HHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCEEECCHHCCCCCCCCCEEEEEECCC-CCCCCCCCCC
T ss_conf             665302366523787325307999999999997531876444304520310032114796468885167-7787542220


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCEEEECCCCHHHHHHHHHC
Q ss_conf             55543321123443211122222211000112356643321100023566520223432121145324200135678738
Q gi|254780282|r  160 LVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWLATVDRPIGEPRISCLQVNSYLSIMQYCVLGS  239 (299)
Q Consensus       160 l~~~~~~~v~~~~~~~~~~~~~~~~dL~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~v~~g~  239 (299)
                      |+.++++++++++|+...+..++++|+.+++|+.+........  ...+.......+..+...+++++..+++++|..|.
T Consensus       160 l~~~~~~~~~~~~h~~~~~~~i~~~dl~~~~~i~~~~~~~~~~--~~~~~~~~~~~g~~~~~~~~~~~~~~~~~lv~~g~  237 (294)
T 1ixc_A          160 IAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSF--ADEVIGLFKHAGIEPRIARVVEDATAALALTMAGA  237 (294)
T ss_dssp             EEEEEEEEEEEGGGGGGTCSEECGGGGTTCEEEECCCSSSSCH--HHHHHHHHHHTTCCCEEEEECSSHHHHHHHHHTTS
T ss_pred             CCCCEEEEEEECCCHHHCCCCCCHHHHHCCCEEEECCCCCCCH--HHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHCC
T ss_conf             1352079998273076539999999981899799638767514--67777765324547744688657999999999499


Q ss_pred             CEEEEEHHHHCC-CCCEEEECCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             423311777601-998466177666766008999348778888999999999999850
Q gi|254780282|r  240 GIALLPDYIVKD-NPNLVRIMEDVITPSFTVYFCYPEALKNTGKLKAFRNFIFLKARD  296 (299)
Q Consensus       240 Gia~lp~~~~~~-~~~lv~i~~~~~~~~~~~~lv~~~~~~~~~~~~~f~d~l~~~~r~  296 (299)
                      |++++|.+++.. .+++..+....+...+++|++|++++ .+|.+++|++++.+.+||
T Consensus       238 gia~lp~~~~~~~~~~~~~~~l~~~~~~~~~~li~~~~~-~~p~~~~fi~~l~~~~~~  294 (294)
T 1ixc_A          238 ASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFRKEK-QPPILARFVEHVRRSAKD  294 (294)
T ss_dssp             CBEEEEHHHHTSCCTTEEEEEECCTTCEEEEEEEEESSS-CCHHHHHHHHHHHHHHCC
T ss_pred             EEEECCHHHHHHHCCCEEEEECCCCCCEEEEEEEEECCC-CCHHHHHHHHHHHHHCCC
T ss_conf             799810889855229859997789886038999997999-998999999999997179