RPSBLAST alignment of GI: 254780282 and protein with PDBid: 2ql3

>2ql3_A Probable transcriptional regulator, LYSR family protein; APC7314, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Rhodococcus SP} Length = 209
 Score = 68.2 bits (165), Expect = 2e-12
 Identities = 34/207 (16%), Positives = 65/207 (31%), Gaps = 13/207 (6%)

Query: 92  SGKLRIATTIDLGQNLLQGNLKEFLLLYPDIQIQLILDNKD---IDISMDYADCAIRLRK 148
           +G + +     LG  +L   L  F   YP   ++   D ++     +     D AI    
Sbjct: 4   AGPIAVGCYPALGPTILPSMLYAFTAEYPRASVEFREDTQNRLRTQLEGGELDVAIVYDL 63

Query: 149 PIQSSSLIQRKLVTIHMHAYAAPHYLKNCREPLSIQELDKHNLITFGDLIPKCMEDFNWL 208
            +         +    M    A H L     P+ + +L +H ++             N  
Sbjct: 64  DLSPEWQTVPLMTREPMVVLGAEHPLAGVDGPVRLADLAEHPMVLL-----DAPPSTNHA 118

Query: 209 ATVDRPIGEPRISCLQVNSYLSIMQYCVLGSGIALLPDYIVKDNPN-----LVRIMEDVI 263
             V R  G       +  ++ +   +   G G  LL      D        +V+ + +  
Sbjct: 119 MDVCREAGFAPRVAYRTANFETARAFVGRGLGWTLLLQRPRVDVTYEGLPVVVKPIAEPK 178

Query: 264 TPSFTVYFCYPEALKNTGKLKAFRNFI 290
             S  V   + +    +   +AF  F+
Sbjct: 179 PASVAVVVAWHQEATLSRVARAFIRFV 205