HHsearch alignment for GI: 254780283 and conserved domain: PRK01438

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=96.18  E-value=0.0095  Score=34.64  Aligned_cols=33  Identities=18%  Similarity=0.286  Sum_probs=30.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             675199998977799999999986995999967
Q gi|254780283|r    4 HDSKILIIGSGPAGYTAAIYAARAMLKPVIIAG   36 (321)
Q Consensus         4 ~~~dVvIIG~GpAGl~aA~~l~r~g~~v~iie~   36 (321)
T Consensus        13 ~gk~v~V~GlG~sG~s~a~~L~~~G~~v~~~D~   45 (481)
T PRK01438         13 SGLRVVVAGLGVSGFPAADALHELGASVTVVAD   45 (481)
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             899899995758899999999967998999979