>pfam01593 Amino_oxidase Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.

Probab=98.09  E-value=7.5e-06  Score=52.77  Aligned_cols=30  Identities=27%  Similarity=0.361  Sum_probs=25.9

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECC-CCCCEEE
Q ss_conf             77999999999869959999678-8775687
Q gi|254780283|r   15 PAGYTAAIYAARAMLKPVIIAGS-DLGGQLM   44 (321)
Q Consensus        15 pAGl~aA~~l~r~g~~v~iie~~-~~GG~l~   44 (321)
T Consensus         1 isGL~aA~~L~~~G~~V~vlEa~~riGGr~~   31 (444)
T pfam01593         1 LAGLAAARELLRAGFDVTVLEARDRVGGRIR   31 (444)
T ss_pred             CHHHHHHHHHHHCCCCEEEECCCCCCCCCEE
T ss_conf             9289999999858999999937998828766