RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780284|ref|YP_003064697.1| hypothetical protein CLIBASIA_00845 [Candidatus Liberibacter asiaticus str. psy62] (623 letters) >d1pq1a_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Mouse (Mus musculus) [TaxId: 10090]} Length = 196 Score = 27.2 bits (60), Expect = 3.6 Identities = 17/139 (12%), Positives = 38/139 (27%), Gaps = 13/139 (9%) Query: 66 EKFVSYARKKRSQRSPEDQLPSSKHLSPRFGSAHENFFDCDLENKPFPVETVVEKKENVD 125 F+SY K SQ+ S R + E + + + + Sbjct: 10 VDFLSY---KLSQKGYSWSQFSD-VEENRTEAPEETEAE-------RETPSAINGNPSWH 58 Query: 126 KSLQSKPSTDLLVQATSFLKESVIDYPDCDSEIMRGLDDDLDRCFEKKDRTSAIQLDKTE 185 + + ++ +E + + +R D+ + + + QL T Sbjct: 59 LADSPAVNGATGHSSSLDAREVIP--MAAVKQALREAGDEFELRYRRAFSDLTSQLHITP 116 Query: 186 EILKGELTDKTDSSFSDSM 204 + F D + Sbjct: 117 GTAYQSFEQVVNELFRDGV 135 >d1rf6a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Streptococcus pneumoniae [TaxId: 1313]} Length = 427 Score = 27.1 bits (59), Expect = 4.3 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Query: 602 LQINLSKLKGNIPVP--RSYSNRS 623 L+ N+ L G I VP +S S+RS Sbjct: 3 LKTNIRHLHGIIRVPGDKSISHRS 26 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.311 0.131 0.358 Gapped Lambda K H 0.267 0.0523 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 2,124,950 Number of extensions: 98542 Number of successful extensions: 116 Number of sequences better than 10.0: 1 Number of HSP's gapped: 116 Number of HSP's successfully gapped: 4 Length of query: 623 Length of database: 2,407,596 Length adjustment: 91 Effective length of query: 532 Effective length of database: 1,158,166 Effective search space: 616144312 Effective search space used: 616144312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 56 (25.8 bits)