HHsearch alignment for GI: 254780287 and conserved domain: COG3564

>COG3564 Uncharacterized protein conserved in bacteria [Function unknown].
Probab=94.99  E-value=0.16  Score=30.14  Aligned_cols=93  Identities=19%  Similarity=0.268  Sum_probs=64.5

Q ss_pred             CCCCEEECHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCEEEEEHHHH---CCCCCCCEE-CCCCEEEEECHHHHHHCCC
Q ss_conf             984033188999999999972898847999983688765146533321---035211300-4687899984677654068
Q gi|254780287|r    1 MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLES---KQSEDDIVF-EKNGAQIFIDKISLAYLTN   76 (109)
Q Consensus         1 M~~mi~iT~~A~~~i~~l~~~~~~~~~lRi~v~~gGCsG~~y~l~~~~---~~~~~D~v~-~~~gi~v~vd~~s~~~L~g   76 (109)
T Consensus         3 ~~~~V~aT~aAl~Li~~l~~~hgp---v-mFHQSGGCCDGSsPMCYP~~~fivGd~DvlLG~i~gvPvyIs~~QyeaWKH   78 (116)
T COG3564           3 MPARVLATPAALDLIAELQAEHGP---V-MFHQSGGCCDGSSPMCYPRADFIVGDNDVLLGEIDGVPVYISGPQYEAWKH   78 (116)
T ss_pred             CCCCEECCHHHHHHHHHHHHHCCC---E-EEECCCCCCCCCCCCCCCCCCEEECCCCEEEEEECCEEEEECCCHHHHHHC
T ss_conf             876224388899999999875498---7-883268845899874014544566477358865378778864707752100


Q ss_pred             C--EEEEEECCCCCEEEEECCCCC
Q ss_conf             7--999872785452389888888
Q gi|254780287|r   77 S--EIDFVDNLLSKSFQIRNPNAT   98 (109)
Q Consensus        77 ~--~IDy~~~~~g~gF~i~nPna~   98 (109)
T Consensus        79 TqLIIDVVp-GRGGmFSLdng~E~  101 (116)
T COG3564          79 TQLIIDVVP-GRGGMFSLDNGREK  101 (116)
T ss_pred             CEEEEEEEC-CCCCEEECCCCCCE
T ss_conf             178999865-98864572578513