HHsearch alignment for GI: 254780287 and conserved domain: pfam01521

>pfam01521 Fe-S_biosyn Iron-sulphur cluster biosynthesis. This family is involved in iron-sulphur cluster biosynthesis. Its members include proteins that are involved in nitrogen fixation such as the HesB and HesB-like proteins.
Probab=99.95  E-value=2.1e-27  Score=181.40  Aligned_cols=91  Identities=46%  Similarity=0.813  Sum_probs=88.1

Q ss_pred             EEECHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCEEEEEHHHHCCCCCCCEECCCCEEEEECHHHHHHCCCCEEEEEEC
Q ss_conf             33188999999999972898847999983688765146533321035211300468789998467765406879998727
Q gi|254780287|r    5 IKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDN   84 (109)
Q Consensus         5 i~iT~~A~~~i~~l~~~~~~~~~lRi~v~~gGCsG~~y~l~~~~~~~~~D~v~~~~gi~v~vd~~s~~~L~g~~IDy~~~   84 (109)
T Consensus         1 ItiT~~A~~~i~~~l~~~~~~~~lRl~v~~gGC~G~~Y~l~~~~~~~~~D~~~~~~g~~v~Id~~s~~~l~g~~iDy~~~   80 (91)
T pfam01521         1 ITLTDAAAKWIKKLLDLEGGENGLRIGVRYGGCSGFSYGLTFEDEAGEGDEVFEQDGVTVVVDEKSLPYLEGTEIDFVEE   80 (91)
T ss_pred             CEECHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCCEEEEECCCEEEEEHHHHHHCCCCEEEEEEC
T ss_conf             99999999999999974899946999996699798188789853577785999989929999169981559989998626


Q ss_pred             CCCCEEEEECC
Q ss_conf             85452389888
Q gi|254780287|r   85 LLSKSFQIRNP   95 (109)
Q Consensus        85 ~~g~gF~i~nP   95 (109)
T Consensus        81 ~~~~~F~f~NP   91 (91)
T pfam01521        81 LLGSGFTFSNP   91 (91)
T ss_pred             CCCCEEEEECC
T ss_conf             88773999595