HHsearch alignment of GI: 254780287 and MMDB domain: 2qgo_A_

>2qgo_A (A:) Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC, 10399G, Fe-S cluster protein, structural genomics; 2.04A {Lactobacillus acidophilus ncfm}
Probab=99.75  E-value=1.2e-19  Score=135.79  Aligned_cols=102  Identities=19%  Similarity=0.253  Sum_probs=84.5

Q ss_pred             CCEEECHHHHHHHHHHHHHCCC------CCEEEEEEECCCCC-CEEEEEHHHHCCCCC-CCEECCC-CEEEEECHHHHHH
Q ss_conf             4033188999999999972898------84799998368876-514653332103521-1300468-7899984677654
Q gi|254780287|r    3 PIIKITDAAATQIKTILESNSD------KKALRITIEGGGCS-GFSYKFDLESKQSED-DIVFEKN-GAQIFIDKISLAY   73 (109)
Q Consensus         3 ~mi~iT~~A~~~i~~l~~~~~~------~~~lRi~v~~gGCs-G~~y~l~~~~~~~~~-D~v~~~~-gi~v~vd~~s~~~   73 (109)
                      .-|+|||+|+++|+++++.++.      ...+|+.++++||+ |..|.|.+.+++.++ |.+++.+ |++|+|++.++.|
T Consensus         4 M~ItiT~~A~~~L~~~l~~~~~~~l~~~dg~~~~s~~G~gCs~g~~y~l~~v~~~~~~~d~~iesn~G~~i~v~~~s~~f   83 (141)
T 2qgo_A            4 LNIKFTDNAVDYLKRREILDKILILITDDGGGKYSIQGGSCSMGAHFSIIWLDKVDPDYPVKIANEQNVKIYTSDFDKTM   83 (141)
T ss_dssp             CBEEECHHHHHHHHHTTCTTSEEEEEECSSCSTTCC---------CEEEEEESSCCTTCCEECBCSSCCEEEECHHHHTT
T ss_pred             EEEEECHHHHHHHHHHHCCCCEEEEEECCCCCHHHHCCCEEEECCEEEEEEEECCCCCCCEEECCCCCCEEEECCCCHHH
T ss_conf             89998999999999842889549999847987122018766508998899983678986636037898536766642422


Q ss_pred             C-CCCEEEEEECCCCCEEEEECCCCC--------CCCCCCCCCC
Q ss_conf             0-687999872785452389888888--------8778862246
Q gi|254780287|r   74 L-TNSEIDFVDNLLSKSFQIRNPNAT--------SNCGCGTSFS  108 (109)
Q Consensus        74 L-~g~~IDy~~~~~g~gF~i~nPna~--------~~CgCG~SF~  108 (109)
                      | +|++|||++    ++|+|+|||+.        ..||||+||+
T Consensus        84 ld~gl~iD~~~----~~f~l~npn~~l~~nv~i~~~~~~~~s~~  123 (141)
T 2qgo_A           84 LGPNMVMDYNA----GSLSLSSDEGLLDGSVDIGNGAALLKANK  123 (141)
T ss_dssp             SCSSEEEEEET----TEEEEEETTEEEEEEEEEEEHHHHHHHHH
T ss_pred             CCCCEEEECCC----CEEEECCCCCEECCCCEEEECHHHHHHHH
T ss_conf             17881882588----97887486534259827977354333664