HHsearch results for GI: 254780287 and protein with PDBid: 1r94_A

>1r94_A Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} SCOP: b.124.1.1 PDB: 1r95_A 1s98_A
Probab=100.00  E-value=1.4e-37  Score=239.54  Aligned_cols=105  Identities=35%  Similarity=0.775  Sum_probs=102.0

Q ss_pred             EEECHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCEEEEEHHHHCCCCCCCEECCCCEEEEECHHHHHHCCCCEEEEEEC
Q ss_conf             33188999999999972898847999983688765146533321035211300468789998467765406879998727
Q gi|254780287|r    5 IKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEIDFVDN   84 (109)
Q Consensus         5 i~iT~~A~~~i~~l~~~~~~~~~lRi~v~~gGCsG~~y~l~~~~~~~~~D~v~~~~gi~v~vd~~s~~~L~g~~IDy~~~   84 (109)
                      |+||++|+++|+++++++++..+|||+|++|||+||+|.|++++++.++|.+++.+|++|+||+.|++||+|++|||+++
T Consensus         3 ItIT~~A~~~i~~ll~~~~~~~~lRi~v~~gGC~G~~y~~~~~~~~~~~D~v~~~~g~~v~id~~s~~~L~G~~IDy~~~   82 (118)
T 1r94_A            3 ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKVVVDGKSLQFLDGTQLDFVKE   82 (118)
T ss_dssp             CEECHHHHHHHHHHHHHHCCCSEEEEEEEECSSSCEEEEEEEESSCCTTEEEEEETTEEEEEEGGGHHHHTTCEEEEEEE
T ss_pred             EEECHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCEEEEEEECCCCCCCCEEEECCCEEEEECHHHHHHHCCCEEEEEEC
T ss_conf             99899999999999974899728999994899786289887644589987999809979999779987637879987307


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             8545238988888887788622469
Q gi|254780287|r   85 LLSKSFQIRNPNATSNCGCGTSFSI  109 (109)
Q Consensus        85 ~~g~gF~i~nPna~~~CgCG~SF~~  109 (109)
                      ++++||+|+||||+++||||+||++
T Consensus        83 ~~~~gF~f~NPna~~~CgCG~SF~~  107 (118)
T 1r94_A           83 GLNEGFKFTNPNVKDECGCGESFKL  107 (118)
T ss_dssp             TTEEEEEEECTTCCC----------
T ss_pred             CCCCCEEEECCCCCCCCCCCCCCCC
T ss_conf             8867479989998840589876233