HHsearch results for GI: 254780287 and protein with PDBid: 1x0g_A

>1x0g_A ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus}
Probab=100.00  E-value=1.7e-37  Score=239.04  Aligned_cols=106  Identities=25%  Similarity=0.593  Sum_probs=100.5

Q ss_pred             CEEECHHHHHHHHHHHHH---CCCCCEEEEEEECCCCCCEEEEEHHHHCCCCCCCEECCCCEEEEECHHHHHHCCCCEEE
Q ss_conf             033188999999999972---89884799998368876514653332103521130046878999846776540687999
Q gi|254780287|r    4 IIKITDAAATQIKTILES---NSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEID   80 (109)
Q Consensus         4 mi~iT~~A~~~i~~l~~~---~~~~~~lRi~v~~gGCsG~~y~l~~~~~~~~~D~v~~~~gi~v~vd~~s~~~L~g~~ID   80 (109)
                      ||+||++|+++|+++++.   ++++.+|||.|++|||+||+|.|+++++++++|.+++.+|++|+||+.|++||+|++||
T Consensus         1 Mi~iT~~A~~~i~~l~~~~~~~~~~~~lRi~v~~gGCsG~~Y~~~~~~~~~~~D~v~~~~g~~v~id~~s~~~L~g~~ID   80 (112)
T 1x0g_A            1 MVELTPAAIQELERLQTHGVRRGQAAILRIQVQPSECGDWRYDLALVAEPKPTDLLTQSQGWTIAIAAEAAELLRGLRVD   80 (112)
T ss_dssp             CCEECHHHHHHTCCCC----------CEEEEEEEBSSSSEEEEEEECSSCCTTCEEECSSSCCEEECGGGHHHHTTCEEE
T ss_pred             CEEECHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCCEEEEEECCCCCCCCEEEECCCEEEEEECCHHHHCCCCEEE
T ss_conf             98979999999999997503258851899999689768868670262666767469962999999906065651998998


Q ss_pred             EEECCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             87278545238988888887788622469
Q gi|254780287|r   81 FVDNLLSKSFQIRNPNATSNCGCGTSFSI  109 (109)
Q Consensus        81 y~~~~~g~gF~i~nPna~~~CgCG~SF~~  109 (109)
                      |++++++++|+|+||||+++||||+||++
T Consensus        81 y~~~~~~~~F~~~NPna~~~CGCG~SF~~  109 (112)
T 1x0g_A           81 YIEDLMGGAFRFHNPNASQTCGCGMAFRV  109 (112)
T ss_dssp             EEEETTEEEEEEECTTCSEECSSSSEEEC
T ss_pred             EECCCCCCCEEEECCCCCCCCCCCCCEEE
T ss_conf             83488757369989998830489987206