HHsearch results for GI: 254780287 and protein with PDBid: 2apn_A

>2apn_A Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae}
Probab=100.00  E-value=1.5e-36  Score=233.61  Aligned_cols=109  Identities=44%  Similarity=0.853  Sum_probs=102.6

Q ss_pred             CCCCEEECHHHHHHHHHHHHHCC-CCCEEEEEEECCCCCCEEEEEHHHHCCCCCCCEECCCCEEEEECHHHHHHCCCCEE
Q ss_conf             98403318899999999997289-88479999836887651465333210352113004687899984677654068799
Q gi|254780287|r    1 MVPIIKITDAAATQIKTILESNS-DKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFIDKISLAYLTNSEI   79 (109)
Q Consensus         1 M~~mi~iT~~A~~~i~~l~~~~~-~~~~lRi~v~~gGCsG~~y~l~~~~~~~~~D~v~~~~gi~v~vd~~s~~~L~g~~I   79 (109)
                      |...|+||++|+++|++++++++ +..+|||.|+++||+||+|.|++.++..++|++++.+|++|+||+.|++||+|++|
T Consensus         5 ~~~~i~iT~~A~~~i~~ll~~~~~~~~~lri~v~~gGC~G~~y~~~~~~~~~~~D~~~~~~g~~v~id~~s~~~L~G~~I   84 (114)
T 2apn_A            5 MAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVIDPMSLQYLIGGTV   84 (114)
T ss_dssp             SCCSCEECSHHHHHHHHHHHHHTCSSCEEEECCCCSSSSCSCCCEEECCSCCSSCEEEECSSSEEEECHHHHHHHTTCEE
T ss_pred             CCCCCEECHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCEEEEECCCCCCCCCCEEEEECCEEEEECHHHHHHCCCCEE
T ss_conf             67882889999999999998689995489999857998852888512577999979999399699998478510268799


Q ss_pred             EEEECCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             987278545238988888887788622469
Q gi|254780287|r   80 DFVDNLLSKSFQIRNPNATSNCGCGTSFSI  109 (109)
Q Consensus        80 Dy~~~~~g~gF~i~nPna~~~CgCG~SF~~  109 (109)
                      ||++++++++|+|+||||+++||||+||+|
T Consensus        85 Dy~~~~~~~~F~~~NPna~~~CgCG~SF~v  114 (114)
T 2apn_A           85 DYTEGLEGSRFTVNNPNATSTCGCGSSFSI  114 (114)
T ss_dssp             EEECSSSCCEEEEECHHHHCCCCCCCCSCC
T ss_pred             EEEECCCCCCEEEECCCCCCCCCCCCCCCC
T ss_conf             886168766179979997953289757239