BLAST/PSIBLAST alignment of GI: 254780287 and GI: 17987374 at iteration 1
>gi|17987374|ref|NP_540008.1| HESB protein [Brucella melitensis bv. 1 str. 16M] Length = 108
>gi|23501761|ref|NP_697888.1| HesB/YadR/YfhF family protein [Brucella suis 1330] Length = 108
>gi|62289820|ref|YP_221613.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 1 str. 9-941] Length = 108
>gi|82699745|ref|YP_414319.1| hypothetical protein BAB1_0894 [Brucella melitensis biovar Abortus 2308] Length = 108
>gi|148559334|ref|YP_001258849.1| HesB/YadR/YfhF family protein [Brucella ovis ATCC 25840] Length = 108
>gi|161618835|ref|YP_001592722.1| iron-sulfur cluster assembly accessory protein [Brucella canis ATCC 23365] Length = 108
>gi|189024061|ref|YP_001934829.1| Protein of unknown function, HesB/YadR/YfhF [Brucella abortus S19] Length = 108
>gi|225627363|ref|ZP_03785400.1| iron-sulfur cluster assembly accessory protein [Brucella ceti str. Cudo] Length = 108
>gi|225852387|ref|YP_002732620.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis ATCC 23457] Length = 108
>gi|237815305|ref|ZP_04594303.1| iron-sulfur cluster assembly accessory protein [Brucella abortus str. 2308 A] Length = 108
>gi|254689125|ref|ZP_05152379.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 6 str. 870] Length = 108
>gi|254693608|ref|ZP_05155436.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 3 str. Tulya] Length = 108
>gi|254697258|ref|ZP_05159086.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 2 str. 86/8/59] Length = 108
>gi|254701639|ref|ZP_05163467.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 5 str. 513] Length = 108
>gi|254704182|ref|ZP_05166010.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 3 str. 686] Length = 108
>gi|254706915|ref|ZP_05168743.1| iron-sulfur cluster assembly accessory protein [Brucella pinnipedialis M163/99/10] Length = 108
>gi|254709977|ref|ZP_05171788.1| iron-sulfur cluster assembly accessory protein [Brucella pinnipedialis B2/94] Length = 108
>gi|254713977|ref|ZP_05175788.1| iron-sulfur cluster assembly accessory protein [Brucella ceti M644/93/1] Length = 108
>gi|254716964|ref|ZP_05178775.1| iron-sulfur cluster assembly accessory protein [Brucella ceti M13/05/1] Length = 108
>gi|254718979|ref|ZP_05180790.1| iron-sulfur cluster assembly accessory protein [Brucella sp. 83/13] Length = 108
>gi|254730157|ref|ZP_05188735.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 4 str. 292] Length = 108
>gi|256031470|ref|ZP_05445084.1| iron-sulfur cluster assembly accessory protein [Brucella pinnipedialis M292/94/1] Length = 108
>gi|256044548|ref|ZP_05447452.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis bv. 1 str. Rev.1] Length = 108
>gi|256060980|ref|ZP_05451138.1| iron-sulfur cluster assembly accessory protein [Brucella neotomae 5K33] Length = 108
>gi|256113413|ref|ZP_05454262.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis bv. 3 str. Ether] Length = 108
>gi|256159596|ref|ZP_05457358.1| iron-sulfur cluster assembly accessory protein [Brucella ceti M490/95/1] Length = 108
>gi|256254876|ref|ZP_05460412.1| iron-sulfur cluster assembly accessory protein [Brucella ceti B1/94] Length = 108
>gi|256257374|ref|ZP_05462910.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 9 str. C68] Length = 108
>gi|256264115|ref|ZP_05466647.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis bv. 2 str. 63/9] Length = 108
>gi|256369303|ref|YP_003106811.1| HesB/YadR/YfhF family protein [Brucella microti CCM 4915] Length = 108
>gi|260168604|ref|ZP_05755415.1| HesB/YadR/YfhF family protein [Brucella sp. F5/99] Length = 108
>gi|260545433|ref|ZP_05821174.1| iron-sulfur cluster assembly accessory protein [Brucella abortus NCTC 8038] Length = 108
>gi|260563901|ref|ZP_05834387.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis bv. 1 str. 16M] Length = 108
>gi|260566568|ref|ZP_05837038.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 4 str. 40] Length = 108
>gi|260754624|ref|ZP_05866972.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 6 str. 870] Length = 108
>gi|260757847|ref|ZP_05870195.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 4 str. 292] Length = 108
>gi|260761670|ref|ZP_05874013.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 2 str. 86/8/59] Length = 108
>gi|260883651|ref|ZP_05895265.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 9 str. C68] Length = 108
>gi|261213874|ref|ZP_05928155.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 3 str. Tulya] Length = 108
>gi|261218769|ref|ZP_05933050.1| iron-sulfur cluster assembly accessory protein [Brucella ceti M13/05/1] Length = 108
>gi|261222060|ref|ZP_05936341.1| iron-sulfur cluster assembly accessory protein [Brucella ceti B1/94] Length = 108
>gi|261314379|ref|ZP_05953576.1| iron-sulfur cluster assembly accessory protein [Brucella pinnipedialis M163/99/10] Length = 108
>gi|261317525|ref|ZP_05956722.1| iron-sulfur cluster assembly accessory protein [Brucella pinnipedialis B2/94] Length = 108
>gi|261321732|ref|ZP_05960929.1| iron-sulfur cluster assembly accessory protein [Brucella ceti M644/93/1] Length = 108
>gi|261324982|ref|ZP_05964179.1| iron-sulfur cluster assembly accessory protein [Brucella neotomae 5K33] Length = 108
>gi|261752192|ref|ZP_05995901.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 5 str. 513] Length = 108
>gi|261754851|ref|ZP_05998560.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 3 str. 686] Length = 108
>gi|261758078|ref|ZP_06001787.1| iron-sulfur cluster assembly accessory protein [Brucella sp. F5/99] Length = 108
>gi|265983969|ref|ZP_06096704.1| iron-sulfur cluster assembly accessory protein [Brucella sp. 83/13] Length = 108
>gi|265988560|ref|ZP_06101117.1| iron-sulfur cluster assembly accessory protein [Brucella pinnipedialis M292/94/1] Length = 108
>gi|265990974|ref|ZP_06103531.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis bv. 1 str. Rev.1] Length = 108
>gi|265994811|ref|ZP_06107368.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis bv. 3 str. Ether] Length = 108
>gi|265998025|ref|ZP_06110582.1| iron-sulfur cluster assembly accessory protein [Brucella ceti M490/95/1] Length = 108
>gi|294852227|ref|ZP_06792900.1| HesB/YadR/YfhF family protein [Brucella sp. NVSL 07-0026] Length = 108
>gi|297248224|ref|ZP_06931942.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 5 str. B3196] Length = 108
>gi|306837327|ref|ZP_07470208.1| iron-sulfur cluster assembly accessory protein [Brucella sp. NF 2653] Length = 108
>gi|306840367|ref|ZP_07473134.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO2] Length = 108
>gi|306843772|ref|ZP_07476370.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO1] Length = 108
>gi|17983061|gb|AAL52272.1| hesb protein [Brucella melitensis bv. 1 str. 16M] Length = 108
>gi|23347689|gb|AAN29803.1| HesB/YadR/YfhF family protein [Brucella suis 1330] Length = 108
>gi|62195952|gb|AAX74252.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 1 str. 9-941] Length = 108
>gi|82615846|emb|CAJ10850.1| Protein of unknown function, HesB/YadR/YfhF [Brucella melitensis biovar Abortus 2308] Length = 108
>gi|148370591|gb|ABQ60570.1| HesB/YadR/YfhF family protein [Brucella ovis ATCC 25840] Length = 108
>gi|161335646|gb|ABX61951.1| iron-sulfur cluster assembly accessory protein [Brucella canis ATCC 23365] Length = 108
>gi|189019633|gb|ACD72355.1| Protein of unknown function, HesB/YadR/YfhF [Brucella abortus S19] Length = 108
>gi|225617368|gb|EEH14413.1| iron-sulfur cluster assembly accessory protein [Brucella ceti str. Cudo] Length = 108
>gi|225640752|gb|ACO00666.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis ATCC 23457] Length = 108
>gi|237790142|gb|EEP64352.1| iron-sulfur cluster assembly accessory protein [Brucella abortus str. 2308 A] Length = 108
>gi|255999463|gb|ACU47862.1| HesB/YadR/YfhF family protein [Brucella microti CCM 4915] Length = 108
>gi|260096840|gb|EEW80715.1| iron-sulfur cluster assembly accessory protein [Brucella abortus NCTC 8038] Length = 108
>gi|260153917|gb|EEW89009.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis bv. 1 str. 16M] Length = 108
>gi|260156086|gb|EEW91166.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 4 str. 40] Length = 108
>gi|260668165|gb|EEX55105.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 4 str. 292] Length = 108
>gi|260672102|gb|EEX58923.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 2 str. 86/8/59] Length = 108
>gi|260674732|gb|EEX61553.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 6 str. 870] Length = 108
>gi|260873179|gb|EEX80248.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 9 str. C68] Length = 108
>gi|260915481|gb|EEX82342.1| iron-sulfur cluster assembly accessory protein [Brucella abortus bv. 3 str. Tulya] Length = 108
>gi|260920644|gb|EEX87297.1| iron-sulfur cluster assembly accessory protein [Brucella ceti B1/94] Length = 108
>gi|260923858|gb|EEX90426.1| iron-sulfur cluster assembly accessory protein [Brucella ceti M13/05/1] Length = 108
>gi|261294422|gb|EEX97918.1| iron-sulfur cluster assembly accessory protein [Brucella ceti M644/93/1] Length = 108
>gi|261296748|gb|EEY00245.1| iron-sulfur cluster assembly accessory protein [Brucella pinnipedialis B2/94] Length = 108
>gi|261300962|gb|EEY04459.1| iron-sulfur cluster assembly accessory protein [Brucella neotomae 5K33] Length = 108
>gi|261303405|gb|EEY06902.1| iron-sulfur cluster assembly accessory protein [Brucella pinnipedialis M163/99/10] Length = 108
>gi|261738062|gb|EEY26058.1| iron-sulfur cluster assembly accessory protein [Brucella sp. F5/99] Length = 108
>gi|261741945|gb|EEY29871.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 5 str. 513] Length = 108
>gi|261744604|gb|EEY32530.1| iron-sulfur cluster assembly accessory protein [Brucella suis bv. 3 str. 686] Length = 108
>gi|262552493|gb|EEZ08483.1| iron-sulfur cluster assembly accessory protein [Brucella ceti M490/95/1] Length = 108
>gi|262765924|gb|EEZ11713.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis bv. 3 str. Ether] Length = 108
>gi|263001758|gb|EEZ14333.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis bv. 1 str. Rev.1] Length = 108
>gi|263094333|gb|EEZ18178.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis bv. 2 str. 63/9] Length = 108
>gi|264660757|gb|EEZ31018.1| iron-sulfur cluster assembly accessory protein [Brucella pinnipedialis M292/94/1] Length = 108
>gi|264662561|gb|EEZ32822.1| iron-sulfur cluster assembly accessory protein [Brucella sp. 83/13] Length = 108
>gi|294820816|gb|EFG37815.1| HesB/YadR/YfhF family protein [Brucella sp. NVSL 07-0026] Length = 108
>gi|297175393|gb|EFH34740.1| HesB/YadR/YfhF family protein [Brucella abortus bv. 5 str. B3196] Length = 108
>gi|306275850|gb|EFM57566.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO1] Length = 108
>gi|306289652|gb|EFM60852.1| iron-sulfur cluster assembly accessory protein [Brucella sp. BO2] Length = 108
>gi|306407579|gb|EFM63777.1| iron-sulfur cluster assembly accessory protein [Brucella sp. NF 2653] Length = 108
>gi|326408893|gb|ADZ65958.1| HESB protein [Brucella melitensis M28] Length = 108
>gi|326538611|gb|ADZ86826.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis M5-90] Length = 108
 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 66/105 (62%), Positives = 86/105 (81%)

Query: 5   IKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQI 64
           I ++D+AA +I  IL+S   K ALR+++EGGGCSGFSYK+DL   Q+EDDIV EK GA++
Sbjct: 4   ITVSDSAARRIAKILDSEPGKTALRVSVEGGGCSGFSYKYDLVDAQTEDDIVIEKLGARV 63

Query: 65  FIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
            ID IS+ Y+  SEIDFVD+L+ +SFQIRNPNAT++CGCGTSF+I
Sbjct: 64  LIDSISVPYMDGSEIDFVDDLMGQSFQIRNPNATASCGCGTSFAI 108