BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780287|ref|YP_003064700.1| iron-sulfur cluster assembly
accessory protein [Candidatus Liberibacter asiaticus str. psy62]
         (109 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780287|ref|YP_003064700.1| iron-sulfur cluster assembly accessory protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 109

 Score =  219 bits (559), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%)

Query: 1   MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKN 60
           MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKN
Sbjct: 1   MVPIIKITDAAATQIKTILESNSDKKALRITIEGGGCSGFSYKFDLESKQSEDDIVFEKN 60

Query: 61  GAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
           GAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI
Sbjct: 61  GAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109


>gi|254781064|ref|YP_003065477.1| FeS assembly scaffold SufA [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 116

 Score = 84.0 bits (206), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 63/111 (56%), Gaps = 2/111 (1%)

Query: 1   MVPIIKITDAAATQIKTIL-ESNSDKKALRITIEGGGCSGFSYKFDLESKQSED-DIVFE 58
           M  I+ +T+AA  +IK I+  S    + +RI+++ GGC+G  Y  DL +    D D + E
Sbjct: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60

Query: 59  KNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109
           K+G +++ID  SL Y+  +EIDF    L   F   NPN  S CGCG S  I
Sbjct: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111


>gi|255764506|ref|YP_003065297.2| GTP cyclohydrolase I [Candidatus Liberibacter asiaticus str. psy62]
          Length = 205

 Score = 23.5 bits (49), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 18/30 (60%)

Query: 5   IKITDAAATQIKTILESNSDKKALRITIEG 34
           ++I +    QI   +ES++D K + + IEG
Sbjct: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEG 161


>gi|254780821|ref|YP_003065234.1| FolC bifunctional protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 429

 Score = 23.1 bits (48), Expect = 1.2,   Method: Composition-based stats.
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 52  EDDIVFEKNGAQIFIDKISLAYLT 75
           +D   FEKN   ++ DKIS   LT
Sbjct: 209 DDFYAFEKNKCLVYQDKISQTNLT 232


>gi|254780925|ref|YP_003065338.1| bifunctional preprotein translocase subunit SecD/SecF [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 833

 Score = 22.7 bits (47), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 22/39 (56%)

Query: 29  RITIEGGGCSGFSYKFDLESKQSEDDIVFEKNGAQIFID 67
           ++ I G   +G +  FD ++ +   DI F++ GA+ F +
Sbjct: 246 KVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFE 284


>gi|254780986|ref|YP_003065399.1| hypothetical protein CLIBASIA_04435 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 94

 Score = 22.7 bits (47), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 9/41 (21%)

Query: 32 IEGGGCSGFSY---------KFDLESKQSEDDIVFEKNGAQ 63
          + G GC G S           F   +KQ + DI F+K G+ 
Sbjct: 10 MAGIGCLGISIALVYLYIHQHFKKRTKQKKVDIAFKKKGSM 50


>gi|254781043|ref|YP_003065456.1| succinate dehydrogenase flavoprotein subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 611

 Score = 22.3 bits (46), Expect = 2.2,   Method: Composition-based stats.
 Identities = 9/20 (45%), Positives = 13/20 (65%)

Query: 59  KNGAQIFIDKISLAYLTNSE 78
           KN A+ FI+  +L  + NSE
Sbjct: 166 KNNAEFFIEYFALDLIINSE 185


>gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 750

 Score = 20.8 bits (42), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 14/28 (50%)

Query: 82  VDNLLSKSFQIRNPNATSNCGCGTSFSI 109
           +DNLLS   Q+  PN+         F++
Sbjct: 370 IDNLLSGKCQLEGPNSAEEPIITLQFAL 397


>gi|254781004|ref|YP_003065417.1| threonyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 652

 Score = 20.8 bits (42), Expect = 7.2,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%)

Query: 39  GFSYKFDLESKQSEDDIV-FEKNGAQI 64
           GF Y FD E   S D++   EK   +I
Sbjct: 103 GFYYDFDKEQPFSSDELAQIEKKMQEI 129


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.316    0.133    0.368 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 64,179
Number of Sequences: 1233
Number of extensions: 2252
Number of successful extensions: 14
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of query: 109
length of database: 328,796
effective HSP length: 62
effective length of query: 47
effective length of database: 252,350
effective search space: 11860450
effective search space used: 11860450
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 32 (16.9 bits)