HHsearch alignment for GI: 254780288 and conserved domain: COG2374

>COG2374 Predicted extracellular nuclease [General function prediction only].
Probab=99.47  E-value=1.7e-12  Score=89.51  Aligned_cols=240  Identities=20%  Similarity=0.296  Sum_probs=130.8

Q ss_pred             CCEEEEEEE----CCH-------------H--------HH-HHHHHHHHHHHCCCEEEEEEEECC----HH--HCC---H
Q ss_conf             007998710----318-------------8--------88-998999998728988999856579----44--589---7
Q gi|254780288|r    3 VVTVATWNV----NSI-------------R--------AR-IHNLAAWIKENNPDIICLQETKTE----DK--NFP---F   47 (281)
Q Consensus         3 ~lrI~TwNi----ngl-------------r--------~r-~~~l~~~l~~~~pDIi~LQEvk~~----~~--~~~---~   47 (281)
T Consensus       463 ~LkiasfNVlNyf~~~~~~g~~~~~~~d~rga~~~~e~~~Q~~k~v~ai~~ldaDV~GL~Eien~~~~~~s~~ai~~lV~  542 (798)
T COG2374         463 SLKIASFNVLNYFNKLSGDGGGASTFSDCRGANTTEEFARQRAKIVTAILTLDADVLGLMEIENNGYGTDSGDAIAQLVN  542 (798)
T ss_pred             EEEEEEEEHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             34431332122420377777775553102476635677787788888886124012102355206777774778999999


Q ss_pred             HHHHHC----CCEEEEEECC-C----CCCEEEEEEECCEEEEEC--------CC--CCCCCCCCCE-ECCCC--CCCCCE
Q ss_conf             787328----9789993047-7----651489874031378632--------55--5644323301-01100--023207
Q gi|254780288|r   48 ETLQSL----NYHIETCGQK-S----YNGVAILSKYQPIEIVTH--------LP--GDDLDVQARF-IEATF--TINTQT  105 (281)
Q Consensus        48 ~~~~~~----gy~~~~~~~k-~----~~GvaIlsk~~~~~v~~~--------~~--~~~~d~~~R~-i~~~i--~~~~~~  105 (281)
T Consensus       543 ~lna~~G~~~~y~~v~p~~~~~lgtD~I~vg~iY~~~~V~~~g~~~~~~~~a~~~v~~~~~~n~R~~laqtF~~~~~~ek  622 (798)
T COG2374         543 ALNAKAGAGTRYAFVAPGRNGGLGTDAIRVGFIYKPSAVSLVGKAAIVDNDAFLGVGEIDDNNARPPLAQTFQDLSGGEK  622 (798)
T ss_pred             HHHHHCCCCCEEEEEECCCCCCCCCCCEEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCE
T ss_conf             99863279952899846755776777256788961536776365321155333554556654457405666532057717


Q ss_pred             EEEEEEECCCCC---CCCC-------CCHHHHHHHHHHHHHHHHH--HHCCCCHHHHHHHCCCCCCCCCCHHHHHCCCCC
Q ss_conf             999631046678---5443-------1012367777655332223--201476000011014686742000012104873
Q gi|254780288|r  106 LRIGNLYLPHGN---PITS-------TKYDDKISWIKRFLRFASQ--RLELEEPLIFAGDYNIIPQPHDCYNPIIWENDA  173 (281)
Q Consensus       106 i~v~n~y~P~g~---~~~~-------~~~~~k~~~~~~l~~~l~~--~~~~~~~vIi~GDFN~a~~~~D~~~~~~~~~~~  173 (281)
T Consensus       623 fvvVvNHfkSKgs~~p~~gd~~dgQg~~~~~R~~~AqaL~~~la~~~~~~~d~~~viLGD~N~-y~--------------  687 (798)
T COG2374         623 FVVVVNHFKSKGSDCPVDGDTQDGQGNSNQTRVRAAQALAAFLATNPTGKADADIVILGDFND-YA--------------  687 (798)
T ss_pred             EEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCH-HH--------------
T ss_conf             999983012668888775656664441046889999999999862856556788799724321-31--------------


Q ss_pred             CCCHHHHHHHHHCCCCCHHHHCCCCCCCCCCEECCCCCCCCCCCCCCCEEEEEEECHHHHHHHHCEEEEC---HH-----
Q ss_conf             4463455653210331000000133788872003578767525577713569994778983332028712---22-----
Q gi|254780288|r  174 CFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT---KP-----  245 (281)
Q Consensus       174 ~~~~~er~~~~~l~~~gl~D~~r~~~~~~~~yT~~~~~~~~~~~n~G~RID~il~s~~l~~~v~~~~I~~---~~-----  245 (281)
T Consensus       688 -~edp----I~~l~~aGy~~l~~~~~~~~~~YSY~------f~G~~gt-LDhaLas~sl~~~v~~a~ewHINAdE~~~ld  755 (798)
T COG2374         688 -FEDP----IQALEGAGYMNLAARFHDAGDRYSYV------FNGQSGT-LDHALASASLAAQVSGATEWHINADEPDALD  755 (798)
T ss_pred             -HCCH----HHHHHHCCCHHHHHHCCCCCCCEEEE------ECCCCCH-HHHHHHHHHHHHHCCCCEEEEECCCCCCHHH
T ss_conf             -0137----89986248301100105778734899------8782640-7666522445521567426530456662322


Q ss_pred             ---------------HCCCCCCCCCCEEEEEECCCCCCC
Q ss_conf             ---------------068676762219999955887766
Q gi|254780288|r  246 ---------------RGWTKPSDHTPVIVSLDIPEPRKK  269 (281)
Q Consensus       246 ---------------~~~~~~SDH~Pv~~~l~lp~~~~~  269 (281)
T Consensus       756 Yn~~Fk~q~~~~~~~~~~fR~SDHDPvvvglnL~~~a~~  794 (798)
T COG2374         756 YNLEFKGQNVSLYKTTNPFRASDHDPVVVGLNLLGTASL  794 (798)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCC
T ss_conf             102103565533356775535789976999870266656