HHsearch alignment for GI: 254780288 and conserved domain: KOG2756

>KOG2756 consensus.
Probab=99.80  E-value=6.5e-19  Score=125.64  Aligned_cols=229  Identities=19%  Similarity=0.275  Sum_probs=129.3

Q ss_pred             CCCEEEEEEECCH-----HHHHHHHHHHHHHHCCCEEEEEEEECCHHHCCHHHHHHCCCEEEEEECCCCCCEEEEE--EE
Q ss_conf             7007998710318-----8889989999987289889998565794458977873289789993047765148987--40
Q gi|254780288|r    2 SVVTVATWNVNSI-----RARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQKSYNGVAILS--KY   74 (281)
Q Consensus         2 ~~lrI~TwNingl-----r~r~~~l~~~l~~~~pDIi~LQEvk~~~~~~~~~~~~~~gy~~~~~~~k~~~GvaIls--k~   74 (281)
T Consensus        98 ~~~S~~~WnidgLdln~l~~RMrAv~H~i~l~sPdiiflQEV-~p~~y~~~~K~~-s~y~i~~~~~~~~~~~~~l~~s~~  175 (349)
T KOG2756          98 SMFSLITWNIDGLDLNNLSERMRAVCHYLALYSPDVIFLQEV-IPPYYSYLKKRS-SNYEIITGHEEGYFTAIMLKKSRV  175 (349)
T ss_pred             CEEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEC-CCHHHHHHHHHH-HHEEEEEECCCEEEEEEEEEHHHC
T ss_conf             378889861156544318999999999998529877987533-735667898765-430689951451565221102442


Q ss_pred             CCEEE-EECCCCCCCCCCCCE-ECCCCCCCCCEEEEEEEECCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHCCCCHHHHH
Q ss_conf             31378-632555644323301-011000232079996310466785443101236777-765533222320147600001
Q gi|254780288|r   75 QPIEI-VTHLPGDDLDVQARF-IEATFTINTQTLRIGNLYLPHGNPITSTKYDDKISW-IKRFLRFASQRLELEEPLIFA  151 (281)
Q Consensus        75 ~~~~v-~~~~~~~~~d~~~R~-i~~~i~~~~~~i~v~n~y~P~g~~~~~~~~~~k~~~-~~~l~~~l~~~~~~~~~vIi~  151 (281)
T Consensus       176 ~Vks~~~i~F~NS~M---~R~L~I~Ev~v~G~Kl~l~tsHLEStr~h~P~r-~~qF~~~~~k~~EaIe~l--PnA~ViFG  249 (349)
T KOG2756         176 KVKSQEIIPFPNSKM---MRNLLIVEVNVSGNKLCLMTSHLESTRGHAPER-MNQFKMVLKKMQEAIESL--PNATVIFG  249 (349)
T ss_pred             CCCCCCEEECCCCHH---HHEEEEEEEEECCEEEEEEECCCCCCCCCCCHH-HHHHHHHHHHHHHHHHHC--CCCEEEEC
T ss_conf             852012110575212---104679998517706999841335788998178-899999999999999859--99769965


Q ss_pred             HHCCCCCCCCCCHHHHHCCCCCCCCHHHHHHHHHC-CCCCHHHHCCCCC-CCCCCEECCCCCCCCCCCCCC-----CEEE
Q ss_conf             10146867420000121048734463455653210-3310000001337-888720035787675255777-----1356
Q gi|254780288|r  152 GDYNIIPQPHDCYNPIIWENDACFTLEVRQSFQKL-QNMGFTDAIRATH-DTHHLYSFWDYYADSWSKNKG-----IRID  224 (281)
Q Consensus       152 GDFN~a~~~~D~~~~~~~~~~~~~~~~er~~~~~l-~~~gl~D~~r~~~-~~~~~yT~~~~~~~~~~~n~G-----~RID  224 (281)
T Consensus       250 GD~Nlr-------D------------~e---v~r~~lPD~~vDvWE~lg~p~~~~FTwDT~~-N--~nl~G~~a~k~RfD  304 (349)
T KOG2756         250 GDTNLR-------D------------RE---VTRCGLPDNIVDVWEFLGKPKHCQFTWDTQM-N--SNLGGTAACKLRFD  304 (349)
T ss_pred             CCCCCH-------H------------HH---CCCCCCCCHHHHHHHHHCCCCCCCEEEECCC-C--CCCCCHHHHHHHHH
T ss_conf             866401-------3------------33---1367899137899998189876741444344-8--64321488888777


Q ss_pred             EEEE-----CHHHHHHHHCEEEECHHHC-CCCCCCCCCEEEEEEC
Q ss_conf             9994-----7789833320287122206-8676762219999955
Q gi|254780288|r  225 HIML-----SPEATSLLHSARIDTKPRG-WTKPSDHTPVIVSLDI  263 (281)
Q Consensus       225 ~il~-----s~~l~~~v~~~~I~~~~~~-~~~~SDH~Pv~~~l~l  263 (281)
T Consensus       305 Ri~~r~~~~~G~~~~~~l~l~g~~kiRgc~~fPSDHwgll~Tl~~  349 (349)
T KOG2756         305 RIFFRAAAEEGHIIPRSLDLLGLEKLRGCGRFPSDHWGLLCTLDI  349 (349)
T ss_pred             HHHEECHHHCCCCCCCCCCHHHHHHHCCCCCCCCCCCEEEEEECC
T ss_conf             673000122188565444524256645788678543014666159