HHsearch alignment for GI: 254780288 and conserved domain: PRK11756

>PRK11756 exonuclease III; Provisional.
Probab=100.00  E-value=0  Score=540.19  Aligned_cols=260  Identities=33%  Similarity=0.547  Sum_probs=245.0

Q ss_pred             CEEEEEEECCHHHHHHHHHHHHHHHCCCEEEEEEEECCHHHCCHHHHHHCCCEEEEEECCCCCCEEEEEEECCEEEEECC
Q ss_conf             07998710318888998999998728988999856579445897787328978999304776514898740313786325
Q gi|254780288|r    4 VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQKSYNGVAILSKYQPIEIVTHL   83 (281)
Q Consensus         4 lrI~TwNinglr~r~~~l~~~l~~~~pDIi~LQEvk~~~~~~~~~~~~~~gy~~~~~~~k~~~GvaIlsk~~~~~v~~~~   83 (281)
T Consensus         1 MkI~SwNVNgiRar~~~l~~~l~~~~pDIlcLQEtK~~~~~~p~~~~~~~gY~~~~~~~KgysGVAi~sk~~p~~v~~g~   80 (268)
T PRK11756          1 MKFVSFNINGLRARPHQLEAIIEKHQPDVIGLQETKVHDEMFPLEEVEALGYHVFYHGQKGHYGVALLSKQTPIAVRKGF   80 (268)
T ss_pred             CEEEEEEEHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHCCHHHHHHCCCEEEEECCCCCCCEEEEECCCCHHEEECC
T ss_conf             98999986668675888999997779989999877388112898898526958999616773444687236724458648


Q ss_pred             CCCCCCCCCCEECCCCCCCCCEEEEEEEECCCCCCCCC-CCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCC
Q ss_conf             55644323301011000232079996310466785443-10123677776553322232014760000110146867420
Q gi|254780288|r   84 PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD  162 (281)
Q Consensus        84 ~~~~~d~~~R~i~~~i~~~~~~i~v~n~y~P~g~~~~~-~~~~~k~~~~~~l~~~l~~~~~~~~~vIi~GDFN~a~~~~D  162 (281)
T Consensus        81 ~~~~~d~egR~i~~~~~~~~g~~~lin~Y~PnG~~~~~~~k~~~K~~f~~~l~~~l~~~~~~~k~vIi~GD~NVA~~~iD  160 (268)
T PRK11756         81 PTDDEEAQRRIIMATIPTPNGNLTVINGYFPQGESRDHPTKFPAKRQFYQDLQNYLETELSPDNPLLIMGDMNISPTDLD  160 (268)
T ss_pred             CCCCCCCCCCEEEEEEECCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHH
T ss_conf             88854445627999996377629999985048887772567788999999999999997647995899564343583431


Q ss_pred             CHHHHHCC------CCCCCCHHHHHHHHHCCCCCHHHHCCCCCCCC-CCEECCCCCCCCCCCCCCCEEEEEEECHHHHHH
Q ss_conf             00012104------87344634556532103310000001337888-720035787675255777135699947789833
Q gi|254780288|r  163 CYNPIIWE------NDACFTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL  235 (281)
Q Consensus       163 ~~~~~~~~------~~~~~~~~er~~~~~l~~~gl~D~~r~~~~~~-~~yT~~~~~~~~~~~n~G~RID~il~s~~l~~~  235 (281)
T Consensus       161 v~~~~~n~k~~~~~g~~~f~~eER~~~~~ll~~G~vD~fR~~~p~~~~~yTwW~yr~~a~~~n~G~RIDy~l~S~~l~~~  240 (268)
T PRK11756        161 IGIGEENRKRWLRTGKCSFLPEEREWLERLMDWGLVDTFRQLNPDVNDRFSWFDYRSKGFDDNRGLRIDLILATQPLAER  240 (268)
T ss_pred             CCCCCCCHHHHCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEECCCCCCCEEEECCCCCCCCCCCEEEEEEEEECHHHHHH
T ss_conf             35740033553436865688899999862203896887723058998736873655686314871768999859999845


Q ss_pred             HHCEEEECHHHCCCCCCCCCCEEEEEEC
Q ss_conf             3202871222068676762219999955
Q gi|254780288|r  236 LHSARIDTKPRGWTKPSDHTPVIVSLDI  263 (281)
Q Consensus       236 v~~~~I~~~~~~~~~~SDH~Pv~~~l~l  263 (281)
T Consensus       241 v~~~~I~~~~rg~~~~SDH~PV~~~l~l  268 (268)
T PRK11756        241 CVETGIDYDIRGMEKPSDHAPIWATFKL  268 (268)
T ss_pred             HEEEEECHHHHCCCCCCCEEEEEEEEEC
T ss_conf             3064851888279999980018999969