HHsearch alignment for GI: 254780288 and conserved domain: smart00128

>smart00128 IPPc Inositol polyphosphate phosphatase, catalytic domain homologues. Mg(2+)-dependent/Li(+)-sensitive enzymes.
Probab=99.42  E-value=1.7e-12  Score=89.50  Aligned_cols=146  Identities=23%  Similarity=0.313  Sum_probs=73.7

Q ss_pred             CEEEEEEECCHHHH-HHHHHHHHHH-------HCCCE--EEEEEE-ECCHHH-------CC--H-----HHHHH-CCCEE
Q ss_conf             07998710318888-9989999987-------28988--999856-579445-------89--7-----78732-89789
Q gi|254780288|r    4 VTVATWNVNSIRAR-IHNLAAWIKE-------NNPDI--ICLQET-KTEDKN-------FP--F-----ETLQS-LNYHI   57 (281)
Q Consensus         4 lrI~TwNinglr~r-~~~l~~~l~~-------~~pDI--i~LQEv-k~~~~~-------~~--~-----~~~~~-~gy~~   57 (281)
T Consensus         5 V~v~TWNVg~~~~~~~~~l~~wl~~~~~~~~~~~~Di~viglQE~~~~~~~~~~~~~~~~~~~w~~~i~~~l~~~~~Y~~   84 (310)
T smart00128        5 VLVGTWNVGGLKADPKVDVTSWLFQKIDVKQSEKPDIYVIGLQEVVDLENGVLLETIAGKERLWSKLIESSLNGDGQYNV   84 (310)
T ss_pred             EEEEEEECCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCHHHHHHHCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99999716985798877888764744334678999999997476773534666432522354499999986177887789


Q ss_pred             EEEECCCCCCEEEEEEECCE----EE-----EECCCCCCCCCCCCEECCCCCCCCCEEEEEEEECCCCCCCCCCCHHHHH
Q ss_conf             99304776514898740313----78-----6325556443233010110002320799963104667854431012367
Q gi|254780288|r   58 ETCGQKSYNGVAILSKYQPI----EI-----VTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTKYDDKI  128 (281)
Q Consensus        58 ~~~~~k~~~GvaIlsk~~~~----~v-----~~~~~~~~~d~~~R~i~~~i~~~~~~i~v~n~y~P~g~~~~~~~~~~k~  128 (281)
T Consensus        85 v~~~~l~gi~l~Vf~k~~~~~~i~~v~~~~v~~G~~g-~~gnKG-aV~vr~~i~~t~~~Fvn~HL~a~~~----~~~~Rn  158 (310)
T smart00128       85 LAKVRLVGILVLVFVKANHLVYIKDVETFTVKTGMGG-LWGNKG-AVAVRFKLSDTSFCFVNSHLAAGAS----NVEQRN  158 (310)
T ss_pred             EEEEECCCEEEEEEECHHHCCCCCCCCCCCCCCCCCC-CCCCCC-CEEEEEEECCEEEEEEEECCCCCCC----HHHHHH
T ss_conf             9888614449999980122564666410115678776-225575-1899999978688887623777743----077778


Q ss_pred             HHHHHHHHHHHH------HHCCCCHHHHHHHCC
Q ss_conf             777655332223------201476000011014
Q gi|254780288|r  129 SWIKRFLRFASQ------RLELEEPLIFAGDYN  155 (281)
Q Consensus       129 ~~~~~l~~~l~~------~~~~~~~vIi~GDFN  155 (281)
T Consensus       159 ~~~~~I~~~l~f~~~~~~~~~~~d~vf~~GDlN  191 (310)
T smart00128      159 QDYKTILRALSFPERAELSQFDHDVVFWFGDLN  191 (310)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCC
T ss_conf             899999986057876666666775059834763