HHsearch results for GI: 254780288 and protein with PDBid: 2j63_A

>2j63_A AP-endonuclease; base excision repair, lyase; 2.48A {Leishmania major}
Probab=100.00  E-value=0  Score=413.39  Aligned_cols=258  Identities=21%  Similarity=0.306  Sum_probs=199.5

Q ss_pred             CCCEEEEEEECCHHHHHHH----HHHHHHHHCCCEEEEEEEECCHHHCCHHHHH--HCCCEEEEE---ECCCCCCEEEEE
Q ss_conf             7007998710318888998----9999987289889998565794458977873--289789993---047765148987
Q gi|254780288|r    2 SVVTVATWNVNSIRARIHN----LAAWIKENNPDIICLQETKTEDKNFPFETLQ--SLNYHIETC---GQKSYNGVAILS   72 (281)
Q Consensus         2 ~~lrI~TwNinglr~r~~~----l~~~l~~~~pDIi~LQEvk~~~~~~~~~~~~--~~gy~~~~~---~~k~~~GvaIls   72 (281)
                      .||||+||||||||+++++    +.+||++++||||||||||+..+.++.+.+.  ..||.+++.   +++||+||||++
T Consensus       148 ~~mKIiSWNVNGlR~~~kk~~~~l~~~L~~~~pDIIcLQEtk~~~~~~~~~~~~~~~~gY~~~~~~~~~kkgysGvAi~s  227 (467)
T 2j63_A          148 RMYKFITWNVAGLRGLLKKNASALRAFMEAEKPDVLCLQETKLNVDEADANATLGVVDGYSFVDHPCAFKRGYSGTRTYM  227 (467)
T ss_dssp             TEEEEEEEECSCHHHHHHHCTTHHHHHHHHHCCSEEEEECCCCCTTCHHHHHTSSCCTTEEEEEECCSSSTTSCCEEEEE
T ss_pred             CEEEEEEEECCCHHHHHHCCHHHHHHHHHHCCCCEEEEEEEECCHHHCCHHHHHHCCCCCCEEEECCCCCCCCCCEEEEE
T ss_conf             44689999404777754306589999998569998999874246444697888751378516874246655304089998


Q ss_pred             EECCEEE------EEC-----------------CCCCCCCCCCCEECCCCC------CCCCEEEEEEEECCCCCCCCCCC
Q ss_conf             4031378------632-----------------555644323301011000------23207999631046678544310
Q gi|254780288|r   73 KYQPIEI------VTH-----------------LPGDDLDVQARFIEATFT------INTQTLRIGNLYLPHGNPITSTK  123 (281)
Q Consensus        73 k~~~~~v------~~~-----------------~~~~~~d~~~R~i~~~i~------~~~~~i~v~n~y~P~g~~~~~~~  123 (281)
                      |.++...      ..+                 +.....|.+||++.+.+.      .....+.|+|+|+|++.. +..+
T Consensus       228 K~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~D~egR~~~~~~~~~~~~~~~~~~~~l~n~y~pn~~~-~~~~  306 (467)
T 2j63_A          228 KNSTTVKGLHARCTRGFALPSEPQADAAAGSRVLVEGAGDEEGRVLTTFLSPDPDSASSSSRIALVNTYVANSGM-GLTR  306 (467)
T ss_dssp             ECCCCCCTSCCEEEESSCCCCC-----------CCCCCCCTTCCEEEEEECSSCCC----CCEEEEEEECCCCCT-TSTT
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCEEEEEECCCCCCC-CCHH
T ss_conf             177643343311112544567665444444333565556655525899841565333445888999864677655-4202


Q ss_pred             HHHHHH-HHHHHHHHHHHH------------------HCCCCHHHHHHHCCCCCCCCCCHH---HHHCCCCCCCCHHHHH
Q ss_conf             123677-776553322232------------------014760000110146867420000---1210487344634556
Q gi|254780288|r  124 YDDKIS-WIKRFLRFASQR------------------LELEEPLIFAGDYNIIPQPHDCYN---PIIWENDACFTLEVRQ  181 (281)
Q Consensus       124 ~~~k~~-~~~~l~~~l~~~------------------~~~~~~vIi~GDFN~a~~~~D~~~---~~~~~~~~~~~~~er~  181 (281)
                      +++|.+ |...+..++..+                  ...++++|||||||++|.+.|.++   +..+.+.+||+++||.
T Consensus       307 ~~~r~~~~d~~~~~~l~~L~~~~~~~~~~~~~~~~~~~~~~~~vIl~GDfNv~~~~~D~~~~~~~~~~~~~~g~~~eER~  386 (467)
T 2j63_A          307 LPYRVQSFDPSMREYLHRLDTWATENAAVPSAAAMGSGSSPHGFIWAGDLNVAERDYDRYYAGTFKSMQECSGFAPEERM  386 (467)
T ss_dssp             HHHHHHTHHHHHHHHHHHHHHHHTTTTC----------CCSCEEEEEEECCCCCSTTSBCCCSCHHHHTTSTTSCHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHH
T ss_conf             67788999999999999998866531011013445552257746872443557521102222324303678778989999


Q ss_pred             HHHHCC-CCCHHHHCCCCCCCC-CCEECCCCCCCCCCCCCCCEEEEEEECHHHHHHHHCEEEECHHHCCCCCCCCCCEEE
Q ss_conf             532103-310000001337888-720035787675255777135699947789833320287122206867676221999
Q gi|254780288|r  182 SFQKLQ-NMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDTKPRGWTKPSDHTPVIV  259 (281)
Q Consensus       182 ~~~~l~-~~gl~D~~r~~~~~~-~~yT~~~~~~~~~~~n~G~RID~il~s~~l~~~v~~~~I~~~~~~~~~~SDH~Pv~~  259 (281)
                      +|..++ +.||+|+||.+||.. +.||||+|+.++|.+|.||||||||+|+.|.++|.+|.|+.+.+    +|||+||++
T Consensus       387 ~~~~~l~~~glvDafR~~hP~~~~~YT~W~~r~~~r~~n~G~RIDyilvS~~L~~~V~~~~I~~~~~----gSDH~PV~l  462 (467)
T 2j63_A          387 SFRETMQRTNSVDIFRQLYPQAGPVYSFWSQRINGRPRNLGWRLDYFVVSSRLASYVVDCFPMPTVM----GSDHCPFQM  462 (467)
T ss_dssp             HHHHHHHHTTEEEHHHHHCTTBCSCCSBCCTTTTTTTTTCCBCCEEEEEEGGGGGGEEEEEECTTCC----SSSBCCEEE
T ss_pred             HHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECHHHHHHCEEEEECCCCC----CCCCCCEEE
T ss_conf             9999998679899443035998998388287778432598660259997769970230899868999----688046499


Q ss_pred             EEECC
Q ss_conf             99558
Q gi|254780288|r  260 SLDIP  264 (281)
Q Consensus       260 ~l~lp  264 (281)
                      +|..|
T Consensus       463 ~Lr~p  467 (467)
T 2j63_A          463 WMRHP  467 (467)
T ss_dssp             EEECC
T ss_pred             EEECC
T ss_conf             98689