HHSEARCH alignment of GI: 254780288 and SCOP domain: d1akoa_

Alignment
>d1akoa_ d.151.1.1 (A:) DNA-repair enzyme exonuclease III {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=0  Score=276.47  Aligned_cols=259  Identities=31%  Similarity=0.517  Sum_probs=184.6

Q ss_pred             CEEEEEEECCHHHHHHHHHHHHHHHCCCEEEEEEEECCHHHCCHHHHHHCCCEEEEEECCCCCCEEEEEEECCEEEEECC
Q ss_conf             07998710318888998999998728988999856579445897787328978999304776514898740313786325
Q gi|254780288|r    4 VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQKSYNGVAILSKYQPIEIVTHL   83 (281)
Q Consensus         4 lrI~TwNinglr~r~~~l~~~l~~~~pDIi~LQEvk~~~~~~~~~~~~~~gy~~~~~~~k~~~GvaIlsk~~~~~v~~~~   83 (281)
                      |||+||||||+|+|.+++.++|++++||||||||||+.++++..+.+..++|.+.........+........+.......
T Consensus         1 Mki~S~NvnG~r~r~~~i~~~i~~~~~DIi~LQEv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (268)
T d1akoa_           1 MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQKGHYGVALLTKETPIAVRRGF   80 (268)
T ss_dssp             CEEEEEECSCGGGCHHHHHHHHHHHCCSEEEEECCCCCGGGCCHHHHHHTTCEEEEEEETTEEEEEEEESSCCSEEEESS
T ss_pred             CEEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEEECCHHHCCHHHHHHCCCEEEECCCCCCCCCCCCCCCCCHHCCCCC
T ss_conf             98999980799984998999998779988999856568111998888656962553144344334321123540001474


Q ss_pred             CCCCCCCCCCEECCCCCCCCCEEEEEEEECCCCCCC-CCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCC
Q ss_conf             556443233010110002320799963104667854-4310123677776553322232014760000110146867420
Q gi|254780288|r   84 PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI-TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD  162 (281)
Q Consensus        84 ~~~~~d~~~R~i~~~i~~~~~~i~v~n~y~P~g~~~-~~~~~~~k~~~~~~l~~~l~~~~~~~~~vIi~GDFN~a~~~~D  162 (281)
                      ......................+.++..+...+... ...+......+.......+........+.++++++|.++.+.|
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d  160 (268)
T d1akoa_          81 PGDDEEAQRRIIMAEIPSLLGNVTVINGYFPQGESRDHPIKFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLD  160 (268)
T ss_dssp             TTCCHHHHTTEEEEEEEETTEEEEEEEEECCCCCBTTCTTHHHHHHHHHHHHHHHHHHHCCTTSCEEEEEECCCCCSGGG
T ss_pred             CCCCCCCCCCCCEEECCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHH
T ss_conf             00112354321000000136874799831015786310023167788999999999987623886788740113763544


Q ss_pred             CHHHHH------CCCCCCCCHHHHHHHHHCCCCCHHHHCCCCCCCCCC-EECCCCCCCCCCCCCCCEEEEEEECHHHHHH
Q ss_conf             000121------048734463455653210331000000133788872-0035787675255777135699947789833
Q gi|254780288|r  163 CYNPII------WENDACFTLEVRQSFQKLQNMGFTDAIRATHDTHHL-YSFWDYYADSWSKNKGIRIDHIMLSPEATSL  235 (281)
Q Consensus       163 ~~~~~~------~~~~~~~~~~er~~~~~l~~~gl~D~~r~~~~~~~~-yT~~~~~~~~~~~n~G~RID~il~s~~l~~~  235 (281)
                      +++...      .....++..++|+++.++.+.|+.|+|+..++.... ++|++++.+++.+|.|+||||||+|+++.++
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~g~RIDyI~~s~~l~~~  240 (268)
T d1akoa_         161 IGIGEENRKRWLRTGKCSFLPEEREWMDRLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC  240 (268)
T ss_dssp             BCSCHHHHHHHHHHTBTTSCHHHHHHHHHHHHTTEEEHHHHHSTTCCSCCSBCCTTTTHHHHTCCBCCEEEEEEHHHHTT
T ss_pred             HHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECHHHHHH
T ss_conf             43223124100024666789899999999970887330101178766654135776665317996177899967289543


Q ss_pred             HHCEEEECHHHCCCCCCCCCCEEEEEE
Q ss_conf             320287122206867676221999995
Q gi|254780288|r  236 LHSARIDTKPRGWTKPSDHTPVIVSLD  262 (281)
Q Consensus       236 v~~~~I~~~~~~~~~~SDH~Pv~~~l~  262 (281)
                      +.++.|+++.++...+|||+||+++|.
T Consensus       241 ~~~~~i~~~~~~~~~~SDH~PV~a~~~  267 (268)
T d1akoa_         241 CVETGIDYEIRSMEKPSDHAPVWATFR  267 (268)
T ss_dssp             EEEEEECHHHHTSSSCCSBCCEEEEEC
T ss_pred             HEEEEEECCCCCCCCCCCCCCEEEEEE
T ss_conf             149999421028999997225799997


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: DNase I-like
domain: DNA-repair enzyme exonuclease III
species: Escherichia coli [TaxId: 562]