PSIBLAST alignment of GI: 254780288 and protein with PDB id: 2j63

>gi|158428909|pdb|2J63|A Chain A, Crystal Structure Of Ap Endonuclease Lmap From Leishmania Major Length = 467
>gi|158428910|pdb|2J63|B Chain B, Crystal Structure Of Ap Endonuclease Lmap From Leishmania Major Length = 467
 Score =  111 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 50/316 (15%), Positives = 88/316 (27%), Gaps = 65/316 (20%)

Query: 2   SVVTVATWNVNSIRARIHN----LAAWIKENNPDIICLQETKTE----DKNFPFETLQSL 53
            +    TWNV  +R  +      L A+++   PD++CLQETK      D N     +   
Sbjct: 148 RMYKFITWNVAGLRGLLKKNASALRAFMEAEKPDVLCLQETKLNVDEADANATLGVVDGY 207

Query: 54  NYHIETCGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYL 113
           ++    C  K               +                          + +     
Sbjct: 208 SFVDHPCAFKRGYSGTRTYMKNSTTVKGLHARCTRGFALPSEPQADAAAGSRVLVEGAGD 267

Query: 114 PHGNPITST-----------------------------KYDDKISWIKRFLRFASQRLEL 144
             G  +T+                              +   ++      +R    RL+ 
Sbjct: 268 EEGRVLTTFLSPDPDSASSSSRIALVNTYVANSGMGLTRLPYRVQSFDPSMREYLHRLDT 327

Query: 145 E-------------------EPLIFAGDYNIIPQPHDCYNPIIWENDACF----TLEVRQ 181
                                  I+AGD N+  + +D Y    +++          E   
Sbjct: 328 WATENAAVPSAAAMGSGSSPHGFIWAGDLNVAERDYDRYYAGTFKSMQECSGFAPEERMS 387

Query: 182 SFQKLQNMGFTDAIRATHDTHHL-YSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
             + +Q     D  R  +      YSFW    +   +N G R+D+ ++S    S +    
Sbjct: 388 FRETMQRTNSVDIFRQLYPQAGPVYSFWSQRINGRPRNLGWRLDYFVVSSRLASYVVDCF 447

Query: 241 IDTKPRGWTKPSDHTP 256
                 G    SDH P
Sbjct: 448 PMPTVMG----SDHCP 459