PSIBLAST alignment of GI: 254780288 and protein with PDB id: 2v0s

>gi|152149539|pdb|2V0S|A Chain A, Crystal Structure Of A Hairpin Exchange Variant (Lr1) Of The Targeting Line-1 Retrotransposon Endonuclease Length = 236
 Score = 81.4 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 94/262 (35%), Gaps = 34/262 (12%)

Query: 2   SVVTVATWNVNSIRARIHN--LAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIET 59
           S +T+ T N+N + + I    LA+WIK  +P + C+QET    ++     ++      + 
Sbjct: 6   SHITILTLNINGLNSAIKRHRLASWIKSQDPSVCCIQETHLTCRDTHRLKIKGWRKIYQA 65

Query: 60  CGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
            G++   GVAIL   +     T       D +  +I    +I  + L I N+Y P+    
Sbjct: 66  NGKQKKAGVAILVSDKTDFKPT---KIKRDKEGHYIMVKGSIQQEELTILNIYAPNTGAP 122

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K              +  + +L+   +  GD+N      D         D       
Sbjct: 123 RFIKQ-----------VLSDLQRDLDSHTLIMGDFNTPLSTLDRSTRQKVNKDT------ 165

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           ++    L      D  R  H     Y+F     +S        IDHI+ S    S     
Sbjct: 166 QELNSALHQADLIDIYRTLHPKSTEYTFSTANGESK-------IDHIVGSKALLSKCKRT 218

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            I T        SDH+ + + L
Sbjct: 219 EIITNYL-----SDHSAIKLEL 235