PSIBLAST alignment of GI: 254780288 and protein with PDB id: 3fzi

>gi|290789945|pdb|3FZI|A Chain A, 1.9 Angstrom Structure Of The Thermophilic Exonuclease Iii Homologue Mth0212 Length = 265
>gi|290789950|pdb|3G0A|A Chain A, Mth0212 With Two Bound Manganese Ions Length = 265
>gi|290789955|pdb|3G1K|A Chain A, Mth0212 (Wt) Crystallized In A Monoclinic Space Group Length = 265
>gi|290789956|pdb|3G1K|B Chain B, Mth0212 (Wt) Crystallized In A Monoclinic Space Group Length = 265
>gi|290789957|pdb|3G2C|A Chain A, Mth0212 In Complex With A Short Ssdna (Cgta) Length = 265
>gi|290789958|pdb|3G2C|B Chain B, Mth0212 In Complex With A Short Ssdna (Cgta) Length = 265
>gi|290789969|pdb|3G3C|A Chain A, Mth0212 (Wt) In Complex With A 6bp Dsdna Containing A Single One Nucleotide Long 3'-Overhang Length = 265
 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 65/260 (25%), Positives = 106/260 (40%), Gaps = 12/260 (4%)

Query: 1   MSVVTVATWNVNSIRAR-IHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIET 59
           M+V+ + +WNVN +RA        W  E  PDI+CLQE K   +  P +      Y    
Sbjct: 1   MAVLKIISWNVNGLRAVHRKGFLKWFMEEKPDILCLQEIKAAPEQLPRKLRHVEGYRSFF 60

Query: 60  CG--QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGN 117
               +K Y+GVA+ +K  P  +      +  D + R   A F        + N+Y P+G 
Sbjct: 61  TPAERKGYSGVAMYTKVPPSSLREGFGVERFDTEGRIQIADFD----DFLLYNIYFPNGK 116

Query: 118 PITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTL 177
                    K+ +   FL   ++  +    +I  GD+N   +  D   P    N + F  
Sbjct: 117 MSEER-LKYKLEFYDAFLEDVNRERDSGRNVIICGDFNTAHREIDLARPKENSNVSGFLP 175

Query: 178 EVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLH 237
             R    K    G+ D  R  +     Y++W Y   +  +N G R+D+  ++ E    + 
Sbjct: 176 VERAWIDKFIENGYVDTFRMFNSDPGQYTWWSYRTRARERNVGWRLDYFFVNEEFKGKVK 235

Query: 238 SARIDTKPRGWTKPSDHTPV 257
            + I +   G    SDH P+
Sbjct: 236 RSWILSDVMG----SDHCPI 251