BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780288|ref|YP_003064701.1| exodeoxyribonuclease III
protein [Candidatus Liberibacter asiaticus str. psy62]
         (281 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780288|ref|YP_003064701.1| exodeoxyribonuclease III protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254039965|gb|ACT56761.1| exodeoxyribonuclease III protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 281

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC
Sbjct: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT
Sbjct: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR
Sbjct: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR
Sbjct: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240

Query: 241 IDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDSTSQNMKPI 281
           IDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDSTSQNMKPI
Sbjct: 241 IDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDSTSQNMKPI 281


>gi|92117300|ref|YP_577029.1| exodeoxyribonuclease III (xth) [Nitrobacter hamburgensis X14]
 gi|91800194|gb|ABE62569.1| Exodeoxyribonuclease III [Nitrobacter hamburgensis X14]
          Length = 266

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 125/261 (47%), Positives = 175/261 (67%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+ +L AW+ E  PD++CLQE K  D+ FP E +++L Y++ T GQK
Sbjct: 1   MRIATWNVNSVRQRLDHLLAWLGETAPDVVCLQEIKCVDEQFPREAIEALGYNVVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSK+   E    L GDD DVQ+RF+E   ++    +RI  LYLP+GNP  + K
Sbjct: 61  TFNGVALLSKFPFDETRPRLAGDDGDVQSRFLEGVVSLKHGVVRIACLYLPNGNPPNTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ WI R + ++ +RL+ EE  + AGD+N+IP P D YNP  W +DA F  + R++F
Sbjct: 121 YPYKLKWISRLIEYSKERLKSEETFVLAGDFNVIPAPRDVYNPAAWVDDALFRPQTREAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA+RA  D    Y+FWDY A +W KN G+RIDH++LSP+A+  L +  ID 
Sbjct: 181 QTLLGLGLTDALRAASDATGDYTFWDYQAGAWQKNNGLRIDHLLLSPQASDRLSAVGIDR 240

Query: 244 KPRGWTKPSDHTPVIVSLDIP 264
             RGW K SDH PV + LD+ 
Sbjct: 241 HVRGWEKASDHVPVWIDLDLD 261


>gi|110634038|ref|YP_674246.1| exodeoxyribonuclease III [Mesorhizobium sp. BNC1]
 gi|110285022|gb|ABG63081.1| Exodeoxyribonuclease III [Chelativorans sp. BNC1]
          Length = 262

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 137/260 (52%), Positives = 183/260 (70%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W++E NPDI+CLQE K+ D+ FP E +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIENLVHWLQEANPDIVCLQEIKSLDEQFPREPIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK +  E+   LPG+D D QARFIE  F+     LR+ +LYLP+GNPI S K
Sbjct: 61  GFNGVALLSKLRFDEVSRGLPGNDGDEQARFIEGVFSTEGGALRVASLYLPNGNPIASEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W+ R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA +  E RQ+F
Sbjct: 121 FAYKLAWMDRLELWAKRRLMLEEPLVLAGDYNVIPEPADAKNPENWLGDALYQPESRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L N+GFTDA+R+  +    Y+FWDY A +W KN GIRIDH+MLSPEA   + SA +  
Sbjct: 181 RRLCNLGFTDALRSATNEPGTYTFWDYQAGAWQKNNGIRIDHLMLSPEAADRIASASVQK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV+V L I
Sbjct: 241 HTRAWEKPSDHVPVVVDLRI 260


>gi|75676002|ref|YP_318423.1| exodeoxyribonuclease III xth [Nitrobacter winogradskyi Nb-255]
 gi|74420872|gb|ABA05071.1| Exodeoxyribonuclease III [Nitrobacter winogradskyi Nb-255]
          Length = 266

 Score =  238 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 127/260 (48%), Positives = 173/260 (66%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+ +L  W++E  PD++CLQE K  D+ FP E +++L Y++ T GQK
Sbjct: 1   MRIATWNVNSVRQRLDHLITWLRETAPDVVCLQEIKCVDEQFPREAIEALGYNVVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSK+   E    L GDD DVQARF+E   T+    +R+  LYLP+GNP  + K
Sbjct: 61  TFNGVALLSKFPFDETRPRLAGDDGDVQARFLEGVVTLEHGAVRVACLYLPNGNPPNTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ WI R + ++ +RL+ EE  I AGD+N+IP P D YN   W +DA F    RQ+F
Sbjct: 121 YPYKLKWISRLIEYSRERLKSEEAFILAGDFNVIPAPCDVYNSAAWVDDALFRPRTRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA+RA  D    Y+FWDY A +W KN G+RIDH++LSP+A+  L  A ID 
Sbjct: 181 QTLLGLGLTDALRAVSDAAGEYTFWDYQAGAWQKNNGLRIDHLLLSPQASDRLSGAGIDR 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             RGW K SDH PV + LD+
Sbjct: 241 HVRGWEKASDHVPVWIDLDL 260


>gi|85716516|ref|ZP_01047487.1| Exodeoxyribonuclease III xth [Nitrobacter sp. Nb-311A]
 gi|85696705|gb|EAQ34592.1| Exodeoxyribonuclease III xth [Nitrobacter sp. Nb-311A]
          Length = 279

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 126/262 (48%), Positives = 173/262 (66%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
            ++ +ATWNVNSIR R+ +L  W+ E  PD++CLQE K  D+ FP E +++L Y++ T G
Sbjct: 12  RLMRIATWNVNSIRQRLDHLITWLGETTPDVVCLQEIKCVDEQFPREAIEALGYNVVTHG 71

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK++NGVA+LSK+   E    L GDD DVQ+RF+E   ++    +RI  LYLP+GNP  +
Sbjct: 72  QKTFNGVALLSKFPFDETRPRLAGDDGDVQSRFLEGVVSLKQGIVRIACLYLPNGNPPNT 131

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY  K+ WI R + ++ +RL+ EE  + AGD+N+IP P D YNP  W +DA F    RQ
Sbjct: 132 EKYPYKLKWISRLIEYSKERLKSEEAFVLAGDFNVIPAPRDVYNPASWVDDALFRPHTRQ 191

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +FQ L  +G TDA+RA  D    Y+FWDY A +W KN G+RIDH++LSP+A+  L    I
Sbjct: 192 AFQTLLGLGLTDALRAASDAAGEYTFWDYQAGAWQKNNGLRIDHLLLSPQASDRLGGVGI 251

Query: 242 DTKPRGWTKPSDHTPVIVSLDI 263
           D   RGW K SDH PV + LD+
Sbjct: 252 DRHVRGWEKASDHVPVWIDLDL 273


>gi|83942567|ref|ZP_00955028.1| exodeoxyribonuclease III [Sulfitobacter sp. EE-36]
 gi|83846660|gb|EAP84536.1| exodeoxyribonuclease III [Sulfitobacter sp. EE-36]
          Length = 265

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 121/262 (46%), Positives = 162/262 (61%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           +V+ +AT+N+N I+ARI  L  W+ E  PD+  LQE K+ D+ FP E  +   Y++ET G
Sbjct: 4   AVMKIATFNINGIKARIDALPQWLDEAQPDVAILQEIKSVDEGFPRELFEDRGYNVETHG 63

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QKS+NGVAILSK    ++   LPGD+ D QAR+IEAT   +  ++R+  LYLP+GNP   
Sbjct: 64  QKSFNGVAILSKLPLEDVTRGLPGDESDEQARYIEATVVGDHSSVRLCGLYLPNGNPAPG 123

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KYD K++W++R    A   L  E P +  GD+NIIPQ  D   P  W  DA F  E R 
Sbjct: 124 PKYDYKLAWMQRLEDRARALLAEETPFLLTGDFNIIPQAEDAATPDAWREDALFRPESRA 183

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           ++++L  +G T+A RA       YSFWDY A +W++N GIRIDH +LSP     L   +I
Sbjct: 184 AWRRLLALGLTEAFRARTQGPGHYSFWDYQAGAWNRNNGIRIDHFLLSPAIADSLRDCQI 243

Query: 242 DTKPRGWTKPSDHTPVIVSLDI 263
           D   RG  KPSDH PV V LD+
Sbjct: 244 DKDVRGREKPSDHVPVWVELDL 265


>gi|154253458|ref|YP_001414282.1| exodeoxyribonuclease III Xth [Parvibaculum lavamentivorans DS-1]
 gi|154157408|gb|ABS64625.1| exodeoxyribonuclease III Xth [Parvibaculum lavamentivorans DS-1]
          Length = 261

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 128/260 (49%), Positives = 177/260 (68%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++NVNSI+AR+ NL  W+KE  PDI+CLQE K  D+NFP   ++ L Y++   GQK
Sbjct: 1   MKIASFNVNSIKARLTNLTDWLKEAEPDIVCLQELKCIDENFPHGPIEELGYNVAVNGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILSK+   ++   LPG+D D  AR+IEA  + N   +R+ ++YLP+GNP+ + K
Sbjct: 61  TYNGVAILSKHPLEDVSRGLPGNDGDDHARYIEAVVSANGSVVRVASIYLPNGNPVDTDK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+ R +  A + L  EEPL+ AGDYN+IP   D +NP  W NDA F  E R  F
Sbjct: 121 FTYKLGWMDRLIDHARELLSYEEPLVLAGDYNVIPTIDDVHNPAAWVNDALFRPETRAKF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L N+G TDA RA H   H Y+FWDY A +W+K+ GIRIDH++LSP+A  LL ++ ID 
Sbjct: 181 RELINLGLTDAFRACHREAHRYTFWDYQAGAWAKDNGIRIDHLLLSPQAADLLKASDIDR 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             RG  KPSDH P+ V LD+
Sbjct: 241 AVRGREKPSDHVPIWVELDL 260


>gi|146340991|ref|YP_001206039.1| exodeoxyribonuclease III [Bradyrhizobium sp. ORS278]
 gi|146193797|emb|CAL77814.1| exodeoxyribonuclease III [Bradyrhizobium sp. ORS278]
          Length = 263

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 129/260 (49%), Positives = 170/260 (65%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR RI +L  W+KE +PDI+CLQE K  D  FP   +++L Y++ T GQK
Sbjct: 1   MRIATWNVNSIRQRIEHLVTWLKECSPDIVCLQEIKCTDDAFPRLEIEALGYNVVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSK    E  + L GD  DV ARF+E   ++ +  +RI  LYLP+GNP  + K
Sbjct: 61  TFNGVALLSKLPFDETKSGLDGDAEDVHARFLEGVVSLKSGVVRIACLYLPNGNPPNTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+ R   +A +RL+ EEPLI AGD+N+IP   D  NP  W  DA F  E R+SF
Sbjct: 121 YPYKLKWMSRLRDYARERLKTEEPLILAGDFNVIPAAADVSNPEAWVEDALFRPETRESF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA+RA +D    Y+FWDY A +W KN GIRIDH++LSP+A+  L    ID+
Sbjct: 181 QSLLGLGLTDALRAVNDAPGQYTFWDYQAGAWQKNAGIRIDHLLLSPQASDRLVEVGIDS 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV    D+
Sbjct: 241 YVRAWEKPSDHVPVWADFDL 260


>gi|227821924|ref|YP_002825894.1| exodeoxyribonuclease III protein [Sinorhizobium fredii NGR234]
 gi|227340923|gb|ACP25141.1| exodeoxyribonuclease III protein [Sinorhizobium fredii NGR234]
          Length = 319

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 141/261 (54%), Positives = 182/261 (69%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  + +ATWN+N ++AR+  L AW+K +NPDI CLQE K+ D  FP E +++L YHIET 
Sbjct: 57  MRPMKIATWNINGVKARLDGLVAWLKASNPDIACLQEIKSVDDAFPREEIEALGYHIETH 116

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQK +NGVA+LSK +P E+   LPGDD D Q+RFIE  F++    +R+  LYLP+GNP+ 
Sbjct: 117 GQKGFNGVALLSKLRPDEVNRGLPGDDSDEQSRFIEGVFSVAGGAVRVCCLYLPNGNPVG 176

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           + KY  K+ W++R   FA +RL LEEPLI AGDYN+IP+ HDC++  +W NDA F  E R
Sbjct: 177 TEKYPYKLGWMQRLASFAKERLLLEEPLILAGDYNVIPEAHDCWDVNVWRNDALFLPETR 236

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +F++L+N+G TDA+RAT D   LYSFWDY A  W KN GIRIDH+MLSPEA   L S  
Sbjct: 237 AAFRQLRNLGLTDAVRATTDEVPLYSFWDYQAGCWQKNFGIRIDHLMLSPEAVDKLVSTS 296

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           I+   R W KPSDH PV    
Sbjct: 297 IEKHVRAWEKPSDHVPVAAQF 317


>gi|83953786|ref|ZP_00962507.1| exodeoxyribonuclease III [Sulfitobacter sp. NAS-14.1]
 gi|83841731|gb|EAP80900.1| exodeoxyribonuclease III [Sulfitobacter sp. NAS-14.1]
          Length = 265

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 120/260 (46%), Positives = 160/260 (61%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI  L  W+ +  PD+  LQE K+ D+ FP E  +   Y++ET GQK
Sbjct: 6   MKIATFNINGIKARIDALPQWLDDAQPDVAILQEIKSVDEGFPRELFEDRGYNVETHGQK 65

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGDD D QAR+IEAT   +  ++R+  LYLP+GNP    K
Sbjct: 66  SFNGVAILSKLPLEDVTRGLPGDDSDEQARYIEATVVGDHSSVRLCGLYLPNGNPAPGPK 125

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W++R    A   L  E P +  GD+NIIPQ  D   P  W  DA F  E R ++
Sbjct: 126 YDYKLAWMQRLEDRARALLAEETPFLLTGDFNIIPQAEDAATPDAWREDALFRPESRAAW 185

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L  +G T+A RA       YSFWDY A +W++N GIRIDH +LSP     L   +ID 
Sbjct: 186 RRLLALGLTEAFRARTQGPGHYSFWDYQAGAWNRNNGIRIDHFLLSPAIADSLRDCQIDK 245

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             RG  KPSDH PV V LD+
Sbjct: 246 DVRGREKPSDHVPVWVELDL 265


>gi|83311632|ref|YP_421896.1| exonuclease III [Magnetospirillum magneticum AMB-1]
 gi|82946473|dbj|BAE51337.1| Exonuclease III [Magnetospirillum magneticum AMB-1]
          Length = 440

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 116/260 (44%), Positives = 162/260 (62%), Gaps = 5/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR+ N+  W+    PD++ LQE K +D++FP   +Q+  YH    GQK
Sbjct: 185 LRIATWNVNSVRARLGNVLDWLGSFAPDVVLLQEIKCQDQDFPLLEIQAAGYHAAVHGQK 244

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAILS++   ++ T L GDD D QAR+IEAT        R+ +LYLP+GNP    K
Sbjct: 245 SYNGVAILSRHPMSDVRTRLSGDDSDEQARYIEATIGGW----RLASLYLPNGNPAPGDK 300

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W+ R    A   L    P +  GD+NI P   D Y+P  W +DA    + R ++
Sbjct: 301 FDYKLAWMARLRTHAQALLAQGIPFVLGGDFNICPTDDDVYDPPKWRDDALCRPDSRAAW 360

Query: 184 QKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           + + N+G T+A RA H      YSFWDY A +W +++G+RIDH +LSP+A   LH+  ID
Sbjct: 361 RSIVNLGLTEAFRALHPGEKGRYSFWDYQAGAWQRDEGLRIDHFLLSPQAADCLHACEID 420

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
             PRG  K SDHTPV + L+
Sbjct: 421 KAPRGKEKASDHTPVWIELE 440


>gi|39935926|ref|NP_948202.1| exodeoxyribonuclease III [Rhodopseudomonas palustris CGA009]
 gi|39649780|emb|CAE28302.1| exodeoxyribonuclease III [Rhodopseudomonas palustris CGA009]
          Length = 303

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 130/260 (50%), Positives = 175/260 (67%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+ +L +W+++  PD++CLQE K  D+ FP E +++L Y++ T GQK
Sbjct: 41  MRIATWNVNSVRQRLDHLVSWLQDCQPDVVCLQEIKCVDEAFPREPIEALGYNVVTHGQK 100

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSKY   E    L GD+ DV ARF+E   ++    +R+  LYLP+GNP+ S K
Sbjct: 101 TFNGVALLSKYPLEEANPGLAGDESDVHARFLEGVVSLKHGVVRVACLYLPNGNPVGSEK 160

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+SW+ R   +A QRL+ EEPLI AGD+N+IPQ  D +NP  W  DA F  E R+SF
Sbjct: 161 YPYKLSWMARLRDYAQQRLKTEEPLILAGDFNVIPQAEDVHNPAAWTEDALFRPETRESF 220

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA+RAT D    Y+FWDY A +W KN GIRIDH++LSP+A   L    ID+
Sbjct: 221 QTLLGLGLTDALRATTDAPGQYTFWDYQAGAWQKNWGIRIDHLLLSPQAADRLRHVGIDS 280

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV    D+
Sbjct: 281 YVRNWEKPSDHVPVWADFDL 300


>gi|328543967|ref|YP_004304076.1| Exodeoxyribonuclease III [Polymorphum gilvum SL003B-26A1]
 gi|326413711|gb|ADZ70774.1| Exodeoxyribonuclease III [Polymorphum gilvum SL003B-26A1]
          Length = 260

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 127/258 (49%), Positives = 172/258 (66%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI  + AW++E  PD+ CLQE K+ D+ FP +  + L Y++ T GQK
Sbjct: 1   MKIATWNINGVKARIDTVLAWLQEARPDVACLQEIKSVDEAFPCQPFEDLGYNVATHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK    ++   LPGDD D QAR+IEA  + +   +R+G LYLP+GNP+ + K
Sbjct: 61  GFNGVALLSKRPLEDVRRGLPGDDGDEQARYIEACVSTDRGAVRVGCLYLPNGNPLGTDK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W+ R  R A+ RL  E+P +  GDYN+IP+P D  NP  W  DA F  E RQ F
Sbjct: 121 FPYKLAWMDRLRRHAALRLAEEQPFLLLGDYNVIPEPKDARNPQDWLGDALFQPESRQHF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L N+GFT+A+RA  D    Y+FWDY A +W KN GIRIDH++LSP+A  LL S  ID 
Sbjct: 181 RALVNLGFTEAVRACTDAADTYTFWDYQAGAWQKNNGIRIDHVLLSPQAGDLLASCGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R W KPSDH PV V L
Sbjct: 241 HVRAWEKPSDHVPVWVEL 258


>gi|316933979|ref|YP_004108961.1| exodeoxyribonuclease III Xth [Rhodopseudomonas palustris DX-1]
 gi|315601693|gb|ADU44228.1| exodeoxyribonuclease III Xth [Rhodopseudomonas palustris DX-1]
          Length = 263

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 133/260 (51%), Positives = 176/260 (67%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+ +L  W+K++  D++CLQE K  D+ FP E +++L Y++ T GQK
Sbjct: 1   MRIATWNVNSVRQRLDHLLTWLKDSQSDVVCLQEIKCVDEAFPREPIEALGYNVVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSKY   E    L GDD DV ARF+E   ++    +R+  LYLP+GNP+ S K
Sbjct: 61  TFNGVALLSKYPLEEANPGLAGDDGDVHARFLEGVVSLKHGVVRVACLYLPNGNPVGSEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+SW+ R   +A QRL  EEPLI AGD+N+IPQP D +NP  W  DA F  E R+SF
Sbjct: 121 YPYKLSWMARLRDYAQQRLRTEEPLILAGDFNVIPQPGDVHNPAAWTEDALFRPETRESF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +GFTDA+RAT D    Y+FWDY A +W KN G+RIDH++LSP+A   L    ID+
Sbjct: 181 QALLGLGFTDALRATTDAPGQYTFWDYQAGAWQKNWGLRIDHLLLSPQAADRLRHVGIDS 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV   LD+
Sbjct: 241 YVRNWEKPSDHVPVWADLDL 260


>gi|118589109|ref|ZP_01546516.1| exodeoxyribonuclease III [Stappia aggregata IAM 12614]
 gi|118438438|gb|EAV45072.1| exodeoxyribonuclease III [Stappia aggregata IAM 12614]
          Length = 260

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 124/258 (48%), Positives = 167/258 (64%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI  +  W+KE +PD+ CLQE K+ D+NFP +  + L Y +ET GQK
Sbjct: 1   MKIATWNINGVKARIDTVLEWLKEASPDVACLQEIKSVDENFPRQPFEDLGYAVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK    +I   LPG+D D QAR+IEA        +RIG LYLP+GNP+ + K
Sbjct: 61  GFNGVALLSKTPLDDIQRGLPGNDADEQARYIEARLATEKGPVRIGCLYLPNGNPLGTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+ R +  A +RLE E P +  GDYN+IP P D  NP  W  DA F  E RQ F
Sbjct: 121 FSYKLEWMDRLITHAQKRLEEETPFLLLGDYNVIPDPVDAKNPQNWLEDALFQPESRQRF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G T+A+R+  +    ++FWDY A +W KN GIRIDHI++SP+AT       ID 
Sbjct: 181 RALTHLGLTEAVRSCTEAPETFTFWDYQAGAWQKNNGIRIDHILMSPQATDRFSGCGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RGW KPSDH PV V L
Sbjct: 241 HVRGWEKPSDHVPVWVKL 258


>gi|315122848|ref|YP_004063337.1| exodeoxyribonuclease III protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496250|gb|ADR52849.1| exodeoxyribonuclease III protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 265

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 216/265 (81%), Positives = 242/265 (91%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           MS+VT+ATWNVNSIR RI N+  WI+ENNPDI+CLQETKTEDK FPFE +QSLNYHIETC
Sbjct: 1   MSLVTIATWNVNSIRVRIKNVITWIQENNPDIVCLQETKTEDKTFPFEAIQSLNYHIETC 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQKSYNGVAILSKYQPIE++  LPGDDLD QARFIEATFTIN+Q LRIGN+YLP+GNPI 
Sbjct: 61  GQKSYNGVAILSKYQPIEMIKKLPGDDLDEQARFIEATFTINSQILRIGNIYLPNGNPIA 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           STKYD KISWIKRFL+FASQRLELEE LIFAGDYNI+PQP DC++ I+ +NDACFTLEVR
Sbjct: 121 STKYDYKISWIKRFLQFASQRLELEEALIFAGDYNIVPQPRDCHDSIMLQNDACFTLEVR 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           Q+FQKLQNMGFTDAIRAT+D HH+YSFWDY++DSW KNKG+RIDH+MLSPEAT+ LHSA 
Sbjct: 181 QAFQKLQNMGFTDAIRATNDAHHIYSFWDYFSDSWRKNKGMRIDHVMLSPEATTFLHSAY 240

Query: 241 IDTKPRGWTKPSDHTPVIVSLDIPE 265
           ID KPRG  KPSDHTPVIV+LDIPE
Sbjct: 241 IDKKPRGCVKPSDHTPVIVALDIPE 265


>gi|148255795|ref|YP_001240380.1| exodeoxyribonuclease III [Bradyrhizobium sp. BTAi1]
 gi|146407968|gb|ABQ36474.1| Exodeoxyribonuclease III [Bradyrhizobium sp. BTAi1]
          Length = 263

 Score =  230 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 127/260 (48%), Positives = 167/260 (64%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R RI +L  W+KE +PDI+CLQE K  D  FP   +++L Y++ T GQK
Sbjct: 1   MRIATWNVNSVRQRIEHLVTWLKECSPDIVCLQEIKCTDDAFPRLEIEALGYNVVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSK    E  + L GD  DV ARF+E   ++    +RI  LYLP+GNP  + K
Sbjct: 61  TFNGVALLSKLPFDETRSGLDGDVEDVHARFLEGVVSLKHGVVRIACLYLPNGNPPNTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+ R   +  +RL+ EEPLI AGD+N+IP   D  NP  W  DA F  E R+SF
Sbjct: 121 YPYKLKWMSRLRDYTRERLKTEEPLILAGDFNVIPAAADVSNPEAWVEDALFRPETRESF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA+RA  D    Y+FWDY A +W KN GIRIDH++LSP+A+  L    ID+
Sbjct: 181 QALLGLGLTDALRAVTDAPGQYTFWDYQAGAWQKNAGIRIDHLLLSPQASDRLVEVGIDS 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV    D+
Sbjct: 241 YVRAWEKPSDHVPVWADFDL 260


>gi|126725257|ref|ZP_01741099.1| exodeoxyribonuclease III [Rhodobacterales bacterium HTCC2150]
 gi|126704461|gb|EBA03552.1| exodeoxyribonuclease III [Rhodobacterales bacterium HTCC2150]
          Length = 259

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 124/259 (47%), Positives = 168/259 (64%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I+ARI+ L  W+ E  PD++ LQE K+ D+NFP E  + + Y +ET GQK
Sbjct: 1   MKIASFNINGIKARINALPEWLAEAKPDVVLLQEIKSVDENFPRELFEDMGYTVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILS+    +I   LPGDD D QAR+IEAT    T  +R+  LYLP+GNP+   K
Sbjct: 61  SFNGVAILSRLPLEDITRGLPGDDTDEQARWIEATVMGKTP-VRVCGLYLPNGNPVPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W+ R    A + LE+EEP + AGDYNIIPQ  D  +P +W  DA    E R ++
Sbjct: 120 YDYKLAWMDRLQARAVELLEIEEPFVVAGDYNIIPQDEDAKHPEVWVEDALARPESRAAY 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L N+GFT+  R  +     YSFWDY   +W KN GIRIDH + SPE   L+   +ID+
Sbjct: 180 RRLLNLGFTEVFRTRNPGPGHYSFWDYQRGAWDKNDGIRIDHFLASPECADLVTDCQIDS 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RG  KPSDH PV + LD
Sbjct: 240 YVRGREKPSDHVPVWIELD 258


>gi|192291575|ref|YP_001992180.1| exodeoxyribonuclease III Xth [Rhodopseudomonas palustris TIE-1]
 gi|192285324|gb|ACF01705.1| exodeoxyribonuclease III Xth [Rhodopseudomonas palustris TIE-1]
          Length = 263

 Score =  230 bits (585), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 130/260 (50%), Positives = 175/260 (67%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+ +L +W+++  PD++CLQE K  D+ FP E +++L Y++ T GQK
Sbjct: 1   MRIATWNVNSVRQRLDHLVSWLQDCQPDVVCLQEIKCVDEAFPREPIEALGYNVVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSKY   E    L GD+ DV ARF+E   ++    +R+  LYLP+GNP+ S K
Sbjct: 61  TFNGVALLSKYPLEEANPGLAGDESDVHARFLEGVVSLKHGVVRVACLYLPNGNPVGSEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+SW+ R   +A QRL+ EEPLI AGD+N+IPQ  D +NP  W  DA F  E R+SF
Sbjct: 121 YPYKLSWMARLRDYAQQRLKTEEPLILAGDFNVIPQAEDVHNPAAWTEDALFRPETRESF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA+RAT D    Y+FWDY A +W KN GIRIDH++LSP+A   L    ID+
Sbjct: 181 QTLLGLGLTDALRATTDAPGQYTFWDYQAGAWQKNWGIRIDHLLLSPQAADRLRHVGIDS 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV    D+
Sbjct: 241 YVRNWEKPSDHVPVWADFDL 260


>gi|254469887|ref|ZP_05083292.1| exodeoxyribonuclease III [Pseudovibrio sp. JE062]
 gi|211961722|gb|EEA96917.1| exodeoxyribonuclease III [Pseudovibrio sp. JE062]
          Length = 260

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 122/258 (47%), Positives = 170/258 (65%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WN+N ++AR+  +  W++E  PD+ C QE K+ D+NFP    + L Y++ET GQK
Sbjct: 1   MKIASWNINGVKARLETVLKWLEEEQPDVACFQEIKSVDENFPRAPFEELGYNLETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    E+   LPGD+ D QAR+IEA    N + +R+G LYLP+GNP+ + K
Sbjct: 61  GFNGVAILSKRPFEEVNRRLPGDEQDEQARYIEAVIAGNNEPIRVGCLYLPNGNPVETEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+ R  + A ++LE EE  +  GDYN+IP+P D   P  W  DA F  E RQ F
Sbjct: 121 FPYKLRWMDRLHKHAEKQLEKEEAFLLVGDYNVIPEPEDAKKPEAWVGDALFRPESRQRF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L N+GFT+A+RAT+     Y+FWDY A +W ++ GIRIDH++LSPEA  ++    ID 
Sbjct: 181 RALLNLGFTEAVRATNSNAGTYTFWDYQAGAWQRDNGIRIDHLLLSPEAARIMQGVGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RGW KPSDH PV V L
Sbjct: 241 HVRGWEKPSDHVPVWVEL 258


>gi|299134949|ref|ZP_07028140.1| exodeoxyribonuclease III [Afipia sp. 1NLS2]
 gi|298589926|gb|EFI50130.1| exodeoxyribonuclease III [Afipia sp. 1NLS2]
          Length = 260

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 128/259 (49%), Positives = 171/259 (66%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+ +L  W+KE  PD++CLQE K  D+ FP E +++L Y++ T GQK
Sbjct: 1   MRIATWNVNSVRQRLDHLLTWLKEREPDLVCLQEIKCLDEAFPREPIEALGYNVVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSKY+  E    L GD  D+ ARF+E   +    T R+  LYLP+GNP+ + K
Sbjct: 61  TFNGVALLSKYRFEETRPQLAGDPEDLHARFLEGVVSHKDGTFRLACLYLPNGNPVNTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+ R + +A +RL+ EEP + AGD+N+IP P D YNP  W  DA F  + R  F
Sbjct: 121 YPYKLRWMDRLIEYARERLKSEEPFVLAGDFNVIPTPADVYNPQAWLEDALFLPQTRDKF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L N+G TDA RAT D    Y+FWDY A +W KN GIRIDH+++SP A+  L +A ID 
Sbjct: 181 QTLLNLGLTDAFRATSDAPRQYTFWDYQAGAWQKNNGIRIDHLLMSPPASDRLKAAGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RGW K SDH PV   LD
Sbjct: 241 HVRGWEKASDHVPVWADLD 259


>gi|294852226|ref|ZP_06792899.1| exodeoxyribonuclease III [Brucella sp. NVSL 07-0026]
 gi|294820815|gb|EFG37814.1| exodeoxyribonuclease III [Brucella sp. NVSL 07-0026]
          Length = 260

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 141/260 (54%), Positives = 190/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 61  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P    NP  W  DA F  + RQ+F
Sbjct: 121 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVGARNPQAWLGDALFQPQSRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 181 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 241 HVRAWEKPSDHVPVTVTLAV 260


>gi|241204407|ref|YP_002975503.1| exodeoxyribonuclease III Xth [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858297|gb|ACS55964.1| exodeoxyribonuclease III Xth [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 263

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 192/260 (73%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+K+++PDI+CLQE KT D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLTQWLKDSDPDIVCLQEIKTVDEGFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTL-RIGNLYLPHGNPITST 122
            +NGVAILSK  P E+   LPGD LD QARF+EA FT++   + R+  LYLP+GNP+ + 
Sbjct: 61  GFNGVAILSKNSPFEVNRGLPGDPLDEQARFLEAAFTLSDTRILRVCCLYLPNGNPVETE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R   FA++RL  EE L+ AGDYN+IP+PHDC++P +WENDA F  + R++
Sbjct: 121 KYPYKLAWMERLRTFAAERLAYEEMLVLAGDYNVIPEPHDCFDPKVWENDALFLPQTREA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L+N+G TDA+RAT D   LYSFWDY A +W KN GIRIDH++LSPEA   + SA I+
Sbjct: 181 FRRLENLGLTDALRATTDATQLYSFWDYQAGAWPKNNGIRIDHLLLSPEAADRMTSAAIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              R W KPSDH PVI   D
Sbjct: 241 KHVRAWEKPSDHVPVIAYFD 260


>gi|163746501|ref|ZP_02153859.1| exodeoxyribonuclease III, putative [Oceanibulbus indolifex HEL-45]
 gi|161380386|gb|EDQ04797.1| exodeoxyribonuclease III, putative [Oceanibulbus indolifex HEL-45]
          Length = 260

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 125/260 (48%), Positives = 161/260 (61%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I+AR   L  W+ E  PD++ LQE K+ D+ FP E L+   Y++ET GQK
Sbjct: 1   MKIASFNINGIKARAAALPEWLDEAQPDVVVLQEIKSVDEAFPREMLEERGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGDD D QAR+IEAT   +   LR+  LYLP+GNP+   K
Sbjct: 61  SFNGVAILSKLPLEDVTRGLPGDDEDDQARWIEATVVGDDMALRVCGLYLPNGNPVPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W+ R    A   L  E P + AGDYNIIPQ  D   P  W  DA F  E R ++
Sbjct: 121 YDYKLAWMARLQARAEALLAEETPFLMAGDYNIIPQAEDAAKPDSWREDALFRPESRAAW 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L N+G TDA RA       YSFWDY A +W++N GIRIDH +LSP     L   +ID 
Sbjct: 181 RRLVNLGLTDAFRARTQGPGHYSFWDYQAGAWNRNNGIRIDHFLLSPTVADRLRDCQIDR 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             RG  KPSDH PV V L I
Sbjct: 241 DVRGRDKPSDHVPVWVELAI 260


>gi|150396373|ref|YP_001326840.1| exodeoxyribonuclease III Xth [Sinorhizobium medicae WSM419]
 gi|150027888|gb|ABR60005.1| exodeoxyribonuclease III Xth [Sinorhizobium medicae WSM419]
          Length = 263

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 142/258 (55%), Positives = 183/258 (70%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++AR+  L  W+KE+NPDI CLQE K+ D  FP   ++SL YH+ET GQK
Sbjct: 1   MKIATWNINGVKARLDGLVGWLKESNPDIACLQEIKSIDDAFPRGEIESLGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK +P E+   LPGD  D Q+RFIE  F++N   LR+  LYLP+GNP+ + K
Sbjct: 61  GFNGVALLSKLRPDEVNRGLPGDASDEQSRFIEGVFSVNGGALRVCCLYLPNGNPVETEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W++R   FA QRL LEEPLI AGDYN+IP+PHDC++  +W NDA +  E R +F
Sbjct: 121 YPYKLAWMRRLAAFAEQRLMLEEPLILAGDYNVIPEPHDCWDVKVWRNDALYLPETRAAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDA+RAT D   LYSFWDY A  W KN GIRIDH+MLSPEA   L S  I+ 
Sbjct: 181 RRLRNLGFTDAVRATSDEAPLYSFWDYQAGCWPKNLGIRIDHLMLSPEAADKLVSTSIEK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R W KPSDH PV    
Sbjct: 241 HVRSWEKPSDHVPVTAEF 258


>gi|85703273|ref|ZP_01034377.1| exodeoxyribonuclease III [Roseovarius sp. 217]
 gi|85672201|gb|EAQ27058.1| exodeoxyribonuclease III [Roseovarius sp. 217]
          Length = 260

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 125/259 (48%), Positives = 165/259 (63%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI  L AW+ E  PD++ LQE K+ D  FP E  + L Y++ET GQK
Sbjct: 1   MKIATFNINGIKARIDALPAWLDEAAPDVVLLQEIKSVDDGFPREIFEDLGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    ++   LPGDD D QAR+IEAT   + + LR+  LYLP+GNP    K
Sbjct: 61  GFNGVAILSKRPLEDVTRGLPGDDTDEQARWIEATVMGDHRALRLCGLYLPNGNPTPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W++R    A   L  EEP++  GDYNIIPQ  D   P  W  DA    E R +F
Sbjct: 121 YDYKLAWMERLQARARDLLASEEPVLMGGDYNIIPQDEDAARPEAWREDALALPESRAAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFT+A RA       Y+FWDY A +W+KN GIRIDH +LSP+A  LL    ID 
Sbjct: 181 RRILNLGFTEAFRARVQGPGHYTFWDYQAGAWNKNDGIRIDHFLLSPQAADLLTDCGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + R   KPSDH P+ V +D
Sbjct: 241 EIRARDKPSDHVPLWVEID 259


>gi|23501759|ref|NP_697886.1| exodeoxyribonuclease III [Brucella suis 1330]
 gi|161618833|ref|YP_001592720.1| exodeoxyribonuclease III (xth) [Brucella canis ATCC 23365]
 gi|225627361|ref|ZP_03785398.1| exodeoxyribonuclease III Xth [Brucella ceti str. Cudo]
 gi|225852385|ref|YP_002732618.1| exodeoxyribonuclease III Xth [Brucella melitensis ATCC 23457]
 gi|254701637|ref|ZP_05163465.1| exodeoxyribonuclease III Xth [Brucella suis bv. 5 str. 513]
 gi|254704180|ref|ZP_05166008.1| exodeoxyribonuclease III Xth [Brucella suis bv. 3 str. 686]
 gi|254706917|ref|ZP_05168745.1| exodeoxyribonuclease III Xth [Brucella pinnipedialis M163/99/10]
 gi|254709975|ref|ZP_05171786.1| exodeoxyribonuclease III Xth [Brucella pinnipedialis B2/94]
 gi|254713975|ref|ZP_05175786.1| exodeoxyribonuclease III Xth [Brucella ceti M644/93/1]
 gi|256031468|ref|ZP_05445082.1| exodeoxyribonuclease III Xth [Brucella pinnipedialis M292/94/1]
 gi|256044546|ref|ZP_05447450.1| exodeoxyribonuclease III Xth [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060978|ref|ZP_05451136.1| exodeoxyribonuclease III Xth [Brucella neotomae 5K33]
 gi|256113411|ref|ZP_05454260.1| exodeoxyribonuclease III Xth [Brucella melitensis bv. 3 str. Ether]
 gi|256159594|ref|ZP_05457356.1| exodeoxyribonuclease III Xth [Brucella ceti M490/95/1]
 gi|256254874|ref|ZP_05460410.1| exodeoxyribonuclease III Xth [Brucella ceti B1/94]
 gi|256264117|ref|ZP_05466649.1| exodeoxyribonuclease III [Brucella melitensis bv. 2 str. 63/9]
 gi|256369301|ref|YP_003106809.1| exodeoxyribonuclease III [Brucella microti CCM 4915]
 gi|260168602|ref|ZP_05755413.1| exodeoxyribonuclease III [Brucella sp. F5/99]
 gi|261222058|ref|ZP_05936339.1| exodeoxyribonuclease III Xth [Brucella ceti B1/94]
 gi|261314381|ref|ZP_05953578.1| exodeoxyribonuclease III Xth [Brucella pinnipedialis M163/99/10]
 gi|261317523|ref|ZP_05956720.1| exodeoxyribonuclease III Xth [Brucella pinnipedialis B2/94]
 gi|261321730|ref|ZP_05960927.1| exodeoxyribonuclease III Xth [Brucella ceti M644/93/1]
 gi|261324980|ref|ZP_05964177.1| exodeoxyribonuclease III Xth [Brucella neotomae 5K33]
 gi|261752190|ref|ZP_05995899.1| exodeoxyribonuclease III Xth [Brucella suis bv. 5 str. 513]
 gi|261754849|ref|ZP_05998558.1| exodeoxyribonuclease III Xth [Brucella suis bv. 3 str. 686]
 gi|265988558|ref|ZP_06101115.1| exodeoxyribonuclease III Xth [Brucella pinnipedialis M292/94/1]
 gi|265990972|ref|ZP_06103529.1| exodeoxyribonuclease III Xth [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994809|ref|ZP_06107366.1| exodeoxyribonuclease III Xth [Brucella melitensis bv. 3 str. Ether]
 gi|265998023|ref|ZP_06110580.1| exodeoxyribonuclease III Xth [Brucella ceti M490/95/1]
 gi|23347687|gb|AAN29801.1| exodeoxyribonuclease III [Brucella suis 1330]
 gi|161335644|gb|ABX61949.1| exodeoxyribonuclease III (xth) [Brucella canis ATCC 23365]
 gi|225617366|gb|EEH14411.1| exodeoxyribonuclease III Xth [Brucella ceti str. Cudo]
 gi|225640750|gb|ACO00664.1| exodeoxyribonuclease III Xth [Brucella melitensis ATCC 23457]
 gi|255999461|gb|ACU47860.1| exodeoxyribonuclease III [Brucella microti CCM 4915]
 gi|260920642|gb|EEX87295.1| exodeoxyribonuclease III Xth [Brucella ceti B1/94]
 gi|261294420|gb|EEX97916.1| exodeoxyribonuclease III Xth [Brucella ceti M644/93/1]
 gi|261296746|gb|EEY00243.1| exodeoxyribonuclease III Xth [Brucella pinnipedialis B2/94]
 gi|261300960|gb|EEY04457.1| exodeoxyribonuclease III Xth [Brucella neotomae 5K33]
 gi|261303407|gb|EEY06904.1| exodeoxyribonuclease III Xth [Brucella pinnipedialis M163/99/10]
 gi|261741943|gb|EEY29869.1| exodeoxyribonuclease III Xth [Brucella suis bv. 5 str. 513]
 gi|261744602|gb|EEY32528.1| exodeoxyribonuclease III Xth [Brucella suis bv. 3 str. 686]
 gi|262552491|gb|EEZ08481.1| exodeoxyribonuclease III Xth [Brucella ceti M490/95/1]
 gi|262765922|gb|EEZ11711.1| exodeoxyribonuclease III Xth [Brucella melitensis bv. 3 str. Ether]
 gi|263001756|gb|EEZ14331.1| exodeoxyribonuclease III Xth [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094335|gb|EEZ18180.1| exodeoxyribonuclease III [Brucella melitensis bv. 2 str. 63/9]
 gi|264660755|gb|EEZ31016.1| exodeoxyribonuclease III Xth [Brucella pinnipedialis M292/94/1]
 gi|326408891|gb|ADZ65956.1| exodeoxyribonuclease III Xth [Brucella melitensis M28]
          Length = 260

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 191/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 61  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 121 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 181 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 241 HVRAWEKPSDHVPVTVTLAV 260


>gi|254718977|ref|ZP_05180788.1| exodeoxyribonuclease III Xth [Brucella sp. 83/13]
 gi|265983967|ref|ZP_06096702.1| exodeoxyribonuclease III Xth [Brucella sp. 83/13]
 gi|264662559|gb|EEZ32820.1| exodeoxyribonuclease III Xth [Brucella sp. 83/13]
          Length = 260

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 141/260 (54%), Positives = 190/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +   +R+ +LYLP+GNPI + K
Sbjct: 61  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGVYSTDNGVVRVVSLYLPNGNPIDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 121 FPYKLSWMQRLENWAKERLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 181 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 241 HVRAWEKPSDHVPVTVTLAV 260


>gi|298291878|ref|YP_003693817.1| exodeoxyribonuclease III [Starkeya novella DSM 506]
 gi|296928389|gb|ADH89198.1| exodeoxyribonuclease III [Starkeya novella DSM 506]
          Length = 262

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 128/258 (49%), Positives = 171/258 (66%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+ +  AW+ E  PD++CLQE K  D+ FP E  +SL Y++   GQK
Sbjct: 1   MRIATWNVNSVKQRLEHAVAWLGETRPDVVCLQEIKCVDEAFPREAFESLGYNVAVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    E+ + LPGDD DVQ+RFIE   +      RI  +YLP+GNP+ + K
Sbjct: 61  GFNGVAVLSRLPFDEVSSGLPGDDEDVQSRFIEVVVSTPEGVARICGIYLPNGNPVDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+KR     + RL  EEPLI  GDYN+IP+P D  NP  W NDA F  + R +F
Sbjct: 121 YPYKLNWMKRLKAHVANRLAYEEPLIVCGDYNVIPEPVDAANPAAWVNDALFLPQTRSAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L ++G T+A+RAT D   LYSFWDY A +W KN GIRIDH++LSP+A   L +  ID 
Sbjct: 181 RELIHLGMTEAVRATTDEPGLYSFWDYQAGAWQKNNGIRIDHLLLSPQAADRLKAVGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R W KPSDH PV V L
Sbjct: 241 HVRAWEKPSDHVPVWVDL 258


>gi|27379872|ref|NP_771401.1| exonuclease III [Bradyrhizobium japonicum USDA 110]
 gi|27353025|dbj|BAC50026.1| exonuclease III [Bradyrhizobium japonicum USDA 110]
          Length = 273

 Score =  228 bits (582), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 132/260 (50%), Positives = 174/260 (66%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + VATWNVNS+R RI  L  W+KE  PDI+CLQE K  D+ FP   +++L Y++ T GQK
Sbjct: 11  IRVATWNVNSVRQRIDLLLTWLKECQPDIVCLQEIKCVDEAFPRLEIEALGYNVVTHGQK 70

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSK +  E  + L GDD D  ARF+E   T+    LRI  LYLP+GNP+ + K
Sbjct: 71  TFNGVALLSKLRFDETKSGLAGDDEDAHARFLEGVVTLKHGVLRIACLYLPNGNPVGTEK 130

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+ R L ++ +RL+ EEPLI AGD+N+IP   D +NP  W  DA F  E R+SF
Sbjct: 131 YPYKLKWMSRLLEYSKERLKTEEPLILAGDFNVIPHARDVHNPAAWTEDALFKTETRESF 190

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA+RA  D   LY+FWDY A +W KN G+RIDH++LSP+A+  L +  ID+
Sbjct: 191 QSLLGLGLTDALRAVTDEPGLYTFWDYQAGAWQKNHGLRIDHLLLSPQASDRLANVGIDS 250

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV   LD+
Sbjct: 251 YVRAWEKPSDHVPVWADLDL 270


>gi|307946864|ref|ZP_07662199.1| exodeoxyribonuclease III [Roseibium sp. TrichSKD4]
 gi|307770528|gb|EFO29754.1| exodeoxyribonuclease III [Roseibium sp. TrichSKD4]
          Length = 260

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 127/258 (49%), Positives = 176/258 (68%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++AR+  + AW++E  P+I CLQE K+ D+NFP E ++ L Y+++T GQK
Sbjct: 1   MKIATWNINGVKARLDTVLAWLQEAEPEIACLQEIKSVDENFPREAIEELGYNVKTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVA+LS     ++   LPGDD D QARFIE T + +   +R+G LYLP+GNP+ + K
Sbjct: 61  SFNGVALLSNRPLEDVQRGLPGDDSDEQARFIEGTVSTDNGVVRVGCLYLPNGNPLGTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+ R +  A +RL+ E P +  GDYN+IP P D  NP  W NDA F  E RQ F
Sbjct: 121 FPYKLGWMDRLIAHAKRRLDDEIPYLLLGDYNVIPDPMDAKNPENWGNDALFQPESRQKF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++GFT+A+RA  D    ++FWDY A +W KN GIRIDHI+LSP+A+ L+    ID 
Sbjct: 181 RTLTHLGFTEAVRACTDAPETFTFWDYQAGAWQKNNGIRIDHILLSPQASDLMAGCGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RGW KPSDH PV V+L
Sbjct: 241 HVRGWEKPSDHVPVWVNL 258


>gi|254693606|ref|ZP_05155434.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 3 str. Tulya]
 gi|261213872|ref|ZP_05928153.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 3 str. Tulya]
 gi|260915479|gb|EEX82340.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 3 str. Tulya]
          Length = 260

 Score =  228 bits (581), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 191/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 61  CFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 121 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 181 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 241 HVRAWEKPSDHVPVTVTLAV 260


>gi|209885397|ref|YP_002289254.1| exodeoxyribonuclease III [Oligotropha carboxidovorans OM5]
 gi|209873593|gb|ACI93389.1| exodeoxyribonuclease III [Oligotropha carboxidovorans OM5]
          Length = 260

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 128/259 (49%), Positives = 171/259 (66%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+ +L  W+KE  PD++CLQE K  D+ FP E L++L Y++ T GQK
Sbjct: 1   MRIATWNVNSVRQRLDHLVTWLKEREPDLVCLQEIKCLDEAFPREPLEALGYNVVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSKY+  E    L GD  D+ ARF+E   +    T R+  LYLP+GNP+ + K
Sbjct: 61  TFNGVALLSKYRFEETRPQLAGDPDDLHARFLEGVVSHKDGTFRLACLYLPNGNPVNTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+SW+ R + +A +R++ EEP + AGD+N+IP P D YNP  W  DA F  + R  F
Sbjct: 121 YPYKLSWMDRLITYARERIKSEEPFVLAGDFNVIPTPADVYNPQAWLGDALFLPQTRDKF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L N+G TDA+RAT D    Y+FWDY A +W KN GIRIDH+++SP A   L +  ID 
Sbjct: 181 QTLLNLGLTDALRATTDAPQQYTFWDYQAGAWQKNNGIRIDHLLMSPPAADRLQAVGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RGW K SDH PV   LD
Sbjct: 241 HVRGWEKASDHVPVWADLD 259


>gi|327191803|gb|EGE58803.1| exodeoxyribonuclease III protein [Rhizobium etli CNPAF512]
          Length = 263

 Score =  228 bits (580), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 192/260 (73%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+K+++PDI+CLQE KT D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLTQWLKDSDPDIVCLQEIKTIDEGFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTL-RIGNLYLPHGNPITST 122
            +NGVAILSK  P E+   LPGD LD QARF+EA FT+    + R+  +YLP+GNP+ + 
Sbjct: 61  GFNGVAILSKSSPSEVNRGLPGDALDEQARFLEAVFTLPDTRILRVCCIYLPNGNPVETE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R   FA++RL+ EE L+ AGDYN+IP+PHDC++P +WENDA F  + R++
Sbjct: 121 KYPYKLAWMERLRSFAAERLDYEEMLVLAGDYNVIPEPHDCFDPKVWENDALFLPQTREA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F+KL+N+G TDA+RAT D   LYSFWDY A +W KN GIRIDH++LSPEA   + SA I+
Sbjct: 181 FRKLENLGLTDAVRATTDATQLYSFWDYQAGAWPKNNGIRIDHLLLSPEAADRMTSAAIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              R W KPSDH PVI   D
Sbjct: 241 KHVRAWEKPSDHVPVIAYFD 260


>gi|294677951|ref|YP_003578566.1| exodeoxyribonuclease III [Rhodobacter capsulatus SB 1003]
 gi|294476771|gb|ADE86159.1| exodeoxyribonuclease III-1 [Rhodobacter capsulatus SB 1003]
          Length = 259

 Score =  228 bits (580), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 127/259 (49%), Positives = 164/259 (63%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR   L AW++   PD++ LQE K+ D+ FP E L    Y + T GQK
Sbjct: 1   MKIATFNINGIKARAEALPAWLRAAEPDVVLLQEIKSTDEAFPQEVLDGTGYTVHTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILS+    ++   LPGDD D QAR+IEAT  I T+ +R+  LYLP+GNP    K
Sbjct: 61  SFNGVAILSRLPLEDVTRGLPGDDSDDQARWIEAT-VIGTRAVRVCGLYLPNGNPAPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W+ R        L  EEPL+FAGDYN+IPQ  D   P  W  DA    E R +F
Sbjct: 120 YDYKLAWMARMQARVETLLRSEEPLVFAGDYNVIPQDEDAAKPESWRADALALPETRAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+G TDA RA       YSFWDY A +W KN GIRIDH++LSP+A  LL  A ID 
Sbjct: 180 RRIVNLGLTDAFRARVPGPGQYSFWDYQAGAWQKNNGIRIDHLLLSPQAADLLRDAGIDK 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + R   KPSDH PV + LD
Sbjct: 240 EVRAGEKPSDHVPVWIDLD 258


>gi|190891504|ref|YP_001978046.1| exodeoxyribonuclease III protein [Rhizobium etli CIAT 652]
 gi|190696783|gb|ACE90868.1| exodeoxyribonuclease III protein [Rhizobium etli CIAT 652]
          Length = 263

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 141/260 (54%), Positives = 191/260 (73%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+K+++PDI+CLQE KT D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLTQWLKDSDPDIVCLQEIKTIDEGFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTL-RIGNLYLPHGNPITST 122
            +NGVAILSK  P E+   LPGD LD QARF+EA FT+    + R+  +YLP+GNP+ + 
Sbjct: 61  GFNGVAILSKSSPSEVNRGLPGDALDEQARFLEAVFTLPDTRILRVCCIYLPNGNPVETE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R   FA++RL  EE L+ AGDYN+IP+PHDC++P +WENDA F  + R++
Sbjct: 121 KYPYKLAWMERLRSFAAERLAYEEMLVLAGDYNVIPEPHDCFDPKVWENDALFLPQTREA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L+N+G TDA+RAT D   LYSFWDY A +W KN GIRIDH++LSPEA   + SA I+
Sbjct: 181 FRRLENLGLTDAVRATTDATRLYSFWDYQAGAWPKNNGIRIDHLLLSPEAADRMTSAAIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              R W KPSDH PVI   D
Sbjct: 241 KHVRAWEKPSDHVPVIAYFD 260


>gi|163759458|ref|ZP_02166543.1| exodeoxyribonuclease III [Hoeflea phototrophica DFL-43]
 gi|162283055|gb|EDQ33341.1| exodeoxyribonuclease III [Hoeflea phototrophica DFL-43]
          Length = 260

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 143/258 (55%), Positives = 189/258 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL AW++E++PDI CLQE K+ D+ FP   L++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIENLQAWLRESDPDIACLQEIKSVDEGFPRLELEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK  P E+   LPGDD D QARFIEA F+ ++  LR+ +LYLP+GNP+ + K
Sbjct: 61  GFNGVAILSKQSPEEVNRGLPGDDTDEQARFIEAVFSKDSGVLRVVSLYLPNGNPVDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++R   FA  RL LEEPL+ AGDYN+IP+P DC+NP  WE DA F  E R +F
Sbjct: 121 FPYKLRWMERLQAFAEDRLALEEPLVLAGDYNVIPEPVDCHNPKAWEGDALFRPESRTAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDA+R+ +D    Y+FWDY A +W KN GIRIDH+MLSPEA   L  A ++ 
Sbjct: 181 RRLENLGFTDALRSANDQAETYTFWDYQAGAWPKNNGIRIDHLMLSPEAADNLEWANVEK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RGW KPSDH PV +SL
Sbjct: 241 HVRGWEKPSDHVPVAISL 258


>gi|116251798|ref|YP_767636.1| exodeoxyribonuclease III [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256446|emb|CAK07530.1| putative exodeoxyribonuclease III [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 263

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 191/260 (73%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+K++NPDI+CLQE KT D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLTQWLKDSNPDIVCLQEIKTVDEGFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTL-RIGNLYLPHGNPITST 122
            +NGVAILSK  P E+   LPGD LD QARF+EA FT++   + R+  +YLP+GNP+ + 
Sbjct: 61  GFNGVAILSKSSPFEVNRGLPGDPLDEQARFLEAAFTLSDMRILRVCCIYLPNGNPVETE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R   FA++RL  EE LI AGDYN+IP+PHDC++P +WENDA F  + R++
Sbjct: 121 KYPYKLAWMERLQTFAAERLAYEEMLILAGDYNVIPEPHDCFDPRVWENDALFLPQTREA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L+N+G TDA+RAT D    YSFWDY A +W KN GIRIDH++LSPEA   + SA I+
Sbjct: 181 FRRLENLGLTDAVRATTDATQFYSFWDYQAGAWPKNNGIRIDHLLLSPEAADRMTSAAIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              R W KPSDH PVI   D
Sbjct: 241 KHVRAWEKPSDHVPVIAYFD 260


>gi|90423996|ref|YP_532366.1| exodeoxyribonuclease III [Rhodopseudomonas palustris BisB18]
 gi|90106010|gb|ABD88047.1| Exodeoxyribonuclease III [Rhodopseudomonas palustris BisB18]
          Length = 267

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 132/264 (50%), Positives = 176/264 (66%), Gaps = 1/264 (0%)

Query: 1   MSV-VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIET 59
           M V + +ATWNVNS+R R+ +L  W+K+  PDI+CLQE K  D+ FP E +++L Y++ T
Sbjct: 1   MKVPMRIATWNVNSVRQRLDHLLVWLKDCAPDIVCLQEIKCVDEAFPREAIEALGYNVVT 60

Query: 60  CGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
            GQK++NGVA+LSKY   E    L GDD D+ ARFIE   ++ +  +R+  LYLP+GNP 
Sbjct: 61  HGQKTFNGVALLSKYPLEEATPRLAGDDDDLHARFIEGVVSLKSGVVRVACLYLPNGNPP 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            + KY  K+ W+ R L +A +RL+ EEPLI AGD+N+IP P D YNP  W  DA F  + 
Sbjct: 121 ETEKYAYKLKWMSRLLDYAKERLKTEEPLILAGDFNVIPAPGDVYNPAAWVGDALFKPQT 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+SFQ L  +G +DA+RA  D    Y+FWDY A +W KN GIRIDH++LSP+A   L   
Sbjct: 181 RESFQALLGLGLSDALRAVTDAPSQYTFWDYQAGAWQKNWGIRIDHLLLSPQAADRLTGV 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDI 263
            ID   R W KPSDH PV + LD+
Sbjct: 241 GIDKHVRSWEKPSDHVPVWIDLDL 264


>gi|114707219|ref|ZP_01440117.1| exodeoxyribonuclease III [Fulvimarina pelagi HTCC2506]
 gi|114537415|gb|EAU40541.1| exodeoxyribonuclease III [Fulvimarina pelagi HTCC2506]
          Length = 260

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 129/258 (50%), Positives = 180/258 (69%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WN+N I+ARI  L AW++E NPDI CLQE K++D+ FP + ++ L YH+ET GQK
Sbjct: 1   MLIASWNINGIKARIDGLTAWLQERNPDIACLQEIKSQDETFPKKVIEDLGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK +P  +   LPGD+ D QAR+IE  +  ++  LR+ ++YLP+GNP+ + K
Sbjct: 61  GFNGVALLSKEKPESVRRGLPGDESDEQARYIEGLWQTDSGPLRVASIYLPNGNPLGTAK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           ++ K++W+ R  R A   L  EE LI AGDYN+IPQP D ++P  W NDA F  E R + 
Sbjct: 121 FEYKLAWMDRLERHAEALLAHEERLILAGDYNVIPQPKDVHDPAAWLNDALFQPESRGNL 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L ++GF DA+R T D   LY+FWDY A +W KN GIRIDH++LSPEA  +L S  ID 
Sbjct: 181 RRLVHLGFADALRMTDDRAELYTFWDYQAGAWQKNNGIRIDHLLLSPEAQIVLRSVGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + R W KPSDH P++  L
Sbjct: 241 QVRSWEKPSDHVPILAEL 258


>gi|62289818|ref|YP_221611.1| exodeoxyribonuclease III [Brucella abortus bv. 1 str. 9-941]
 gi|82699743|ref|YP_414317.1| AP endonuclease [Brucella melitensis biovar Abortus 2308]
 gi|254689123|ref|ZP_05152377.1| AP endonuclease [Brucella abortus bv. 6 str. 870]
 gi|254697256|ref|ZP_05159084.1| AP endonuclease [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730155|ref|ZP_05188733.1| AP endonuclease [Brucella abortus bv. 4 str. 292]
 gi|256257372|ref|ZP_05462908.1| AP endonuclease [Brucella abortus bv. 9 str. C68]
 gi|260754622|ref|ZP_05866970.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 6 str. 870]
 gi|260757845|ref|ZP_05870193.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 4 str. 292]
 gi|260761668|ref|ZP_05874011.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883649|ref|ZP_05895263.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 9 str. C68]
 gi|62195950|gb|AAX74250.1| Xth-1, exodeoxyribonuclease III [Brucella abortus bv. 1 str. 9-941]
 gi|82615844|emb|CAJ10848.1| AP endonuclease, family 1:Exodeoxyribonuclease III
           xth:Endonuclease/exonuclease/phosphatase family
           [Brucella melitensis biovar Abortus 2308]
 gi|260668163|gb|EEX55103.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 4 str. 292]
 gi|260672100|gb|EEX58921.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674730|gb|EEX61551.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 6 str. 870]
 gi|260873177|gb|EEX80246.1| exodeoxyribonuclease III Xth [Brucella abortus bv. 9 str. C68]
          Length = 260

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 143/260 (55%), Positives = 192/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINSVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 61  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 121 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 181 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 241 HVRAWEKPSDHVPVTVTLAV 260


>gi|86749875|ref|YP_486371.1| exodeoxyribonuclease III [Rhodopseudomonas palustris HaA2]
 gi|86572903|gb|ABD07460.1| Exodeoxyribonuclease III [Rhodopseudomonas palustris HaA2]
          Length = 276

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 129/264 (48%), Positives = 176/264 (66%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + + +ATWNVNS+R R+ +L +W+ E  PD++CLQE K  D+ FP E +++L Y++ T G
Sbjct: 12  NDMRIATWNVNSVRQRLDHLVSWLNECAPDVVCLQEIKCVDEAFPREAIEALGYNVVTHG 71

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK++NGVA+LSKY   E    L GDD D  ARF+E   ++    +R+  LYLP+GNP+ S
Sbjct: 72  QKTFNGVALLSKYPLEEATPRLAGDDDDTHARFLEGVVSLKRGVVRVACLYLPNGNPVES 131

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY  K+ W+ R L +  QRL+ EEPLI AGD+N+IPQP D +NP  W +DA F  + R+
Sbjct: 132 EKYPYKLRWMSRLLEYTQQRLKTEEPLILAGDFNVIPQPIDVHNPAGWVDDALFRPQTRE 191

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           SFQ L  +G TDA+RA+ D    Y+FWDY A +W KN G+RIDH++LSP+AT  L +  I
Sbjct: 192 SFQALLGLGLTDALRASTDAPGQYTFWDYQAGAWQKNWGLRIDHLLLSPQATDRLRNVGI 251

Query: 242 DTKPRGWTKPSDHTPVIVSLDIPE 265
           D   R W KPSDH PV    D+  
Sbjct: 252 DAYVRNWEKPSDHVPVWADFDLDA 275


>gi|254500814|ref|ZP_05112965.1| exodeoxyribonuclease III [Labrenzia alexandrii DFL-11]
 gi|222436885|gb|EEE43564.1| exodeoxyribonuclease III [Labrenzia alexandrii DFL-11]
          Length = 260

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 125/258 (48%), Positives = 169/258 (65%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++AR+  +  W+KE +PD+ C QE K+ D+NFP +  + L Y++ET GQK
Sbjct: 1   MKIATWNINGVKARLETVQEWLKEASPDVACFQEIKSVDENFPRQPFEDLGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    ++   LPG+D D QAR+IEAT T     +R G LYLP+GNP+ + K
Sbjct: 61  GFNGVAILSKTPLEDVERRLPGNDDDEQARYIEATVTHGDGVVRFGCLYLPNGNPLGTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+ R L  A +RL  E P I  GDYN+IP P D  NP  W +DA F  E RQ F
Sbjct: 121 FPYKLGWMDRLLVHAEKRLAEEVPFILLGDYNVIPDPVDAKNPENWTDDALFQPESRQKF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G T+AIRA  +    ++FWDY A +W KN GIRIDHI++SP+A   +    ID 
Sbjct: 181 RALTHLGMTEAIRACTEAPETFTFWDYQAGAWQKNNGIRIDHILMSPQANDKMLGCGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RGW KPSDH PV V+L
Sbjct: 241 HVRGWEKPSDHVPVWVTL 258


>gi|153009683|ref|YP_001370898.1| exodeoxyribonuclease III Xth [Ochrobactrum anthropi ATCC 49188]
 gi|151561571|gb|ABS15069.1| exodeoxyribonuclease III Xth [Ochrobactrum anthropi ATCC 49188]
          Length = 260

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 136/260 (52%), Positives = 186/260 (71%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+KE++PDI CLQE K+ D  FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIENLQHWLKESSPDIACLQEIKSVDDQFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P E+   LPGDD D QARFIE  ++ +   +R+ +LYLP+GNP+ + K
Sbjct: 61  GFNGVALLSKKSPDEVNRGLPGDDGDEQARFIEGVYSTDKGVVRVVSLYLPNGNPVDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A  RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 121 FPYKLSWMQRLELWAKDRLALEEPLVLAGDYNVIPEPDDAKNPEQWVGDALFKPQSRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEA +   S+ ++ 
Sbjct: 181 RRLENLGFTDAIRASTDDSGIYSFWDYQAGAWQKNNGIRIDHLMLSPEAANRFISSDVEK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV ++L +
Sbjct: 241 HVRAWEKPSDHVPVTITLSV 260


>gi|115524629|ref|YP_781540.1| exodeoxyribonuclease III [Rhodopseudomonas palustris BisA53]
 gi|115518576|gb|ABJ06560.1| Exodeoxyribonuclease III [Rhodopseudomonas palustris BisA53]
          Length = 263

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 124/260 (47%), Positives = 172/260 (66%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+ +L  W+ + +PDI+CLQE K  D+ FP E +++L Y++ T GQK
Sbjct: 1   MRIATWNVNSVRQRLDHLLTWLNDCSPDIVCLQEIKCVDEAFPREPIEALGYNVVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSK+   E    L GD+ DV ARF+E   ++    +R+  LYLP+GNP+ + K
Sbjct: 61  TFNGVALLSKHPLDEATPRLAGDEEDVHARFLEGVVSLKHGVVRVACLYLPNGNPVDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++R   +  +RL  EEPLI AGD+N+IP P D YN + W +DA F  + R+SF
Sbjct: 121 YPYKLKWMQRLFDYTKERLRTEEPLILAGDFNVIPAPADVYNALAWVDDALFKPQTRESF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA+RA+ D    Y+FWDY A +W KN GIRIDH++LSP+A   L    ID 
Sbjct: 181 QALLGLGLTDALRASTDAAGQYTFWDYQAGAWQKNWGIRIDHLLLSPQAADRLTGVGIDR 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV    D+
Sbjct: 241 HVRSWEKPSDHVPVWADFDL 260


>gi|163843144|ref|YP_001627548.1| exodeoxyribonuclease III (xth) [Brucella suis ATCC 23445]
 gi|163673867|gb|ABY37978.1| exodeoxyribonuclease III (xth) [Brucella suis ATCC 23445]
          Length = 260

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 191/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 61  GFNGVALLSKKSPDEINKDLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 121 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 181 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 241 HVRAWEKPSDHVPVTVTLAV 260


>gi|15965272|ref|NP_385625.1| putative exodeoxyribonuclease III protein [Sinorhizobium meliloti
           1021]
 gi|307309295|ref|ZP_07588963.1| exodeoxyribonuclease III Xth [Sinorhizobium meliloti BL225C]
 gi|307317036|ref|ZP_07596477.1| exodeoxyribonuclease III Xth [Sinorhizobium meliloti AK83]
 gi|15074452|emb|CAC46098.1| Putative exodeoxyribonuclease III [Sinorhizobium meliloti 1021]
 gi|306897124|gb|EFN27869.1| exodeoxyribonuclease III Xth [Sinorhizobium meliloti AK83]
 gi|306900296|gb|EFN30913.1| exodeoxyribonuclease III Xth [Sinorhizobium meliloti BL225C]
          Length = 263

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 140/258 (54%), Positives = 183/258 (70%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++AR+  L  W++E+NPDI CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARLDGLVGWLRESNPDIACLQEIKSVDETFPRGEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK +P EI   LPGD  D Q+RFIE  F++N   LR+  LYLP+GNP+ + K
Sbjct: 61  GFNGVALLSKVRPDEINRGLPGDPADEQSRFIEGVFSVNGGALRVCCLYLPNGNPVETEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W++R   FA QRL LEEPLI AGDYN+IP+ HDC++  +W NDA +  E R +F
Sbjct: 121 YPYKLAWMRRLAAFAEQRLVLEEPLILAGDYNVIPEAHDCWDVKVWRNDALYLPETRAAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDA+RAT D   LYSFWDY A  W KN GIRIDH+MLSPEA   L S  I+ 
Sbjct: 181 RRLRNLGFTDAVRATSDEAPLYSFWDYQAGCWQKNFGIRIDHLMLSPEAADKLVSTSIEK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R W KPSDH PV    
Sbjct: 241 HVRAWEKPSDHVPVTAEF 258


>gi|197105436|ref|YP_002130813.1| exodeoxyribonuclease III [Phenylobacterium zucineum HLK1]
 gi|196478856|gb|ACG78384.1| exodeoxyribonuclease III [Phenylobacterium zucineum HLK1]
          Length = 259

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 119/259 (45%), Positives = 164/259 (63%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  +  W +   PD+ CLQE K  D+ FP E  + L Y++   GQK
Sbjct: 1   MRIATWNVNSINARLETVVRWFEAAQPDVACLQEIKCVDEKFPAEPFERLGYNLAIHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LSK    ++   LP  D D  AR+IEA  +   Q +R+ ++YLP+GNP+ + K
Sbjct: 61  TYNGVALLSKRPLEDVTRGLPEGDGDEHARYIEAVVSGP-QPVRVASIYLPNGNPVGTEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W+ R  R A   L+LEEPL+ AGDYN+IP+P D   P  WE+DA F  + R +F
Sbjct: 120 FAYKLAWMGRLHRHAQNLLKLEEPLVLAGDYNVIPEPRDAEFPKNWEDDALFQPQSRAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L+N+G T+A          Y+FWDY A +W +N GIRIDH +LSP+A  LL    I  
Sbjct: 180 RALKNLGLTEAYLQADGAPGAYTFWDYQAGAWQRNNGIRIDHALLSPQAADLLRGVTIHR 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RGW KPSDH P++V LD
Sbjct: 240 DVRGWEKPSDHVPLVVELD 258


>gi|83952174|ref|ZP_00960906.1| exodeoxyribonuclease III [Roseovarius nubinhibens ISM]
 gi|83837180|gb|EAP76477.1| exodeoxyribonuclease III [Roseovarius nubinhibens ISM]
          Length = 260

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 122/260 (46%), Positives = 165/260 (63%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I+ARI  L AW+ E  PD+  LQE K+ D+NFP E  +   Y +ET GQK
Sbjct: 1   MKIASFNINGIKARIDALPAWLDEAQPDVAILQEIKSVDENFPREIFEERGYQVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGDD D QAR+IEAT   +   LR+  LYLP+GNP    K
Sbjct: 61  SFNGVAILSKLPLEDVTRGLPGDDADEQARYIEATVIGDHSALRLCGLYLPNGNPAPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W++R    A   L LEEP + AGDYNIIPQ  D   P  W  DA    + R ++
Sbjct: 121 YDYKLAWMERLQARAEALLALEEPFLMAGDYNIIPQDEDAKRPEAWREDALALPQSRAAY 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+G T+A RA       Y+FWDY A +W+++ GIRIDH +LSP+    L   +ID 
Sbjct: 181 RRIVNLGLTEAFRARTQGPGHYTFWDYQAGAWNRDDGIRIDHFLLSPQCADRLTDCQIDK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             RG  KPSDH P+ ++LDI
Sbjct: 241 HVRGGDKPSDHVPIWITLDI 260


>gi|209549080|ref|YP_002280997.1| exodeoxyribonuclease III Xth [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534836|gb|ACI54771.1| exodeoxyribonuclease III Xth [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 263

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 138/260 (53%), Positives = 190/260 (73%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+K+++PDI+CLQE KT D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLTQWLKDSDPDIVCLQEIKTIDEGFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTL-RIGNLYLPHGNPITST 122
            +NGVAILSK  P E+   LPGD LD Q+RF+EA FT+    + R+  +YLP+GNP+ + 
Sbjct: 61  GFNGVAILSKTSPSEVNRGLPGDPLDEQSRFLEAVFTLPDTRILRVCCIYLPNGNPVDTE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R   FA++RL  EE L+ AGDYN+IP+PHDC++P +WE+DA F  + R++
Sbjct: 121 KYPYKLAWMERLRSFAAERLAYEEMLVLAGDYNVIPEPHDCFDPKVWESDALFLPQTREA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L+N+G TDA+RAT D    YSFWDY A +W KN GIRIDH++LSPEA   + SA I+
Sbjct: 181 FRRLENLGLTDAVRATTDATQFYSFWDYQAGAWPKNNGIRIDHLLLSPEAADRMTSAAIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              R W KPSDH PVI   D
Sbjct: 241 KHVRAWEKPSDHVPVIAYFD 260


>gi|86357443|ref|YP_469335.1| exodeoxyribonuclease III protein [Rhizobium etli CFN 42]
 gi|86281545|gb|ABC90608.1| exodeoxyribonuclease III protein [Rhizobium etli CFN 42]
          Length = 263

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 140/260 (53%), Positives = 190/260 (73%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+K+++PDI+CLQE KT D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLTQWLKDSDPDIVCLQEIKTIDEGFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTL-RIGNLYLPHGNPITST 122
            +NGVAILSK  P E+   LPGD LD QARF+EA FT+    + R+  +YLP+GNP+ + 
Sbjct: 61  GFNGVAILSKTSPFEVNRGLPGDPLDEQARFLEAVFTLPDTRILRVCCIYLPNGNPVDTE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R   FA++RL  EE L+ AGDYN+IP+PHDC++P  WE+DA F  + R++
Sbjct: 121 KYPYKLAWMERLRSFAAERLAYEEMLVLAGDYNVIPEPHDCFDPRAWESDALFLPQTRRA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L+N+G TDA+RAT D   LYSFWDY A +W KN GIRIDH++LSPEA   + SA I+
Sbjct: 181 FRRLENLGLTDAVRATTDATRLYSFWDYQAGAWPKNNGIRIDHLLLSPEAADRMTSAAIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              R W KPSDH PVI   D
Sbjct: 241 KHVRAWEKPSDHVPVIAYFD 260


>gi|17987376|ref|NP_540010.1| exodeoxyribonuclease III [Brucella melitensis bv. 1 str. 16M]
 gi|17983063|gb|AAL52274.1| exodeoxyribonuclease iii [Brucella melitensis bv. 1 str. 16M]
          Length = 296

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 191/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 37  MKIATWNINGVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 96

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 97  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 156

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 157 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 216

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 217 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 276

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 277 HVRAWEKPSDHVPVTVTLAV 296


>gi|260459779|ref|ZP_05808033.1| exodeoxyribonuclease III Xth [Mesorhizobium opportunistum WSM2075]
 gi|259034581|gb|EEW35838.1| exodeoxyribonuclease III Xth [Mesorhizobium opportunistum WSM2075]
          Length = 264

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 134/261 (51%), Positives = 178/261 (68%), Gaps = 1/261 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWN+N +RARI NL  W+ E+ PDI+CLQE KT D  FP   +++L Y++ET GQK
Sbjct: 1   MKIVTWNINGVRARIGNLTHWLTESAPDIVCLQEIKTVDDQFPRAEIEALGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            +NGVA+LSK +  E+   LPGDD D QARFIE  F+ +   LR+ +LYLP+GNPI    
Sbjct: 61  GFNGVALLSKLRFDEVTKGLPGDDADEQARFIEGVFSTDKGALRVASLYLPNGNPIDDEK 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+  K+SW+ R  R+A +RL LEE L+ AGDYN+IP+P D   P  W  DA F  + RQ+
Sbjct: 121 KFPYKLSWMARLERWAEERLRLEEALVLAGDYNVIPEPIDARFPENWLGDALFQPQTRQA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L N+GFT+A+RA  D    Y+FWDY A +W KN GIRIDH++LSPEA +   SA I+
Sbjct: 181 FRRLLNLGFTEAVRAVTDAPDTYTFWDYQAGAWQKNNGIRIDHLLLSPEAANRFSSASIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
              R W KPSDH PV + L +
Sbjct: 241 KHVRAWEKPSDHVPVAIDLAL 261


>gi|148559237|ref|YP_001258847.1| exodeoxyribonuclease III [Brucella ovis ATCC 25840]
 gi|148370494|gb|ABQ60473.1| exodeoxyribonuclease III [Brucella ovis ATCC 25840]
          Length = 279

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 191/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 20  MKIATWNINGVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 79

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 80  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 139

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 140 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 199

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 200 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFTSANIEK 259

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 260 HVRAWEKPSDHVPVTVTLAV 279


>gi|218673944|ref|ZP_03523613.1| exodeoxyribonuclease III Xth [Rhizobium etli GR56]
          Length = 263

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 138/260 (53%), Positives = 191/260 (73%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+K+++PDI+CLQE KT D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIDNLTQWLKDSDPDIVCLQEIKTIDEGFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTL-RIGNLYLPHGNPITST 122
            +NGVAILSK  P E+   LPGD LD Q+RF+EA FT+    + R+  +YLP+GNP+ + 
Sbjct: 61  GFNGVAILSKTSPSEVNRGLPGDALDEQSRFLEAVFTLPDTRILRVCCIYLPNGNPVDTE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R   FA++RL  EE L+ AGDYN+IP+PHDC++P +WE+DA F  + R++
Sbjct: 121 KYPYKLAWMERLRMFAAERLAYEEILVLAGDYNVIPEPHDCFDPKVWESDALFLPQTREA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L+N+G TDA+RAT D   LYSFWDY A +W KN GIRIDH++LSPEA   + SA I+
Sbjct: 181 FRRLENLGLTDAVRATTDATRLYSFWDYQAGAWPKNNGIRIDHLLLSPEAADRMTSAAIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              R W KPSDH PV+   D
Sbjct: 241 KHVRAWEKPSDHVPVVAYFD 260


>gi|13471192|ref|NP_102761.1| exodeoxyribonuclease III [Mesorhizobium loti MAFF303099]
 gi|14021936|dbj|BAB48547.1| exodeoxyribonuclease III [Mesorhizobium loti MAFF303099]
          Length = 264

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 133/261 (50%), Positives = 181/261 (69%), Gaps = 1/261 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWN+N +RARI NL  W+ E+ PDI+CLQE KT D+ FP   +++L Y++ET GQK
Sbjct: 1   MKIVTWNINGVRARIGNLTHWLTESAPDIVCLQEIKTVDEQFPRAEIEALGYNVETNGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            +NGVA+LSK +  E++  LPGDD D QARFIE  F+ +   LR+ +LYLP+GNPI    
Sbjct: 61  GFNGVALLSKLRFDEVIRGLPGDDTDEQARFIEGVFSTDKGALRVASLYLPNGNPIDDEK 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+  K++W+ R  R+A +RL+LEE L+ AGDYN+IP+P D   P  W  DA F  + RQ+
Sbjct: 121 KFPYKLNWMARLERWAEERLKLEEALVLAGDYNVIPEPIDARFPENWLGDALFQPQTRQA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L N+GFT+A+RA  D    Y+FWDY A +W KN GIRIDH++LSPEA +   SA I+
Sbjct: 181 FRRLLNLGFTEAVRAVTDAPDTYTFWDYQAGAWQKNNGIRIDHLLLSPEAANRFSSASIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
              R W KPSDH PV + L +
Sbjct: 241 KHVRAWEKPSDHVPVAIDLAL 261


>gi|237815303|ref|ZP_04594301.1| exodeoxyribonuclease III (xth) [Brucella abortus str. 2308 A]
 gi|237790140|gb|EEP64350.1| exodeoxyribonuclease III (xth) [Brucella abortus str. 2308 A]
          Length = 284

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 143/260 (55%), Positives = 192/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 25  MKIATWNINSVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 84

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 85  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 144

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 145 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 204

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 205 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 264

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 265 HVRAWEKPSDHVPVTVTLAV 284


>gi|144899913|emb|CAM76777.1| Endonuclease/exonuclease/phosphatase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 256

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 113/260 (43%), Positives = 160/260 (61%), Gaps = 4/260 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           +V +ATWN+NS++AR+ N+  W++   PD++ LQE K +D  FP    QS  + +   GQ
Sbjct: 1   MVRIATWNINSVKARLPNVMDWLQSAKPDVLLLQEIKCQDDGFPTLDFQSAGWQVAVHGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           KSYNGVAILS++    +   LPGD+ D QAR+I+A        LRI +LYLP+GNP    
Sbjct: 61  KSYNGVAILSRHTLDNVQIRLPGDEADEQARYIQADIQG----LRIASLYLPNGNPCPGE 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W++R +  +   L+   P +  GDYNI P   D Y+P  W +DA    E R  
Sbjct: 117 KFDYKLRWMRRLVDHSKTLLDQGMPFVLGGDYNICPTDADVYDPAGWADDALCRPESRAL 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L ++G T+A RA H    LY+FWDY A +W +  G+RIDH +LSP A   L +  ID
Sbjct: 177 FRELCHLGLTEAFRALHPQPGLYTFWDYQAGAWPRGNGLRIDHFLLSPAAADRLIACDID 236

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
            +PRG  K SDHTP+ + L+
Sbjct: 237 KEPRGREKASDHTPIWIDLN 256


>gi|189024059|ref|YP_001934827.1| Exodeoxyribonuclease III [Brucella abortus S19]
 gi|297248222|ref|ZP_06931940.1| exodeoxyribonuclease III [Brucella abortus bv. 5 str. B3196]
 gi|189019631|gb|ACD72353.1| Exodeoxyribonuclease III [Brucella abortus S19]
 gi|297175391|gb|EFH34738.1| exodeoxyribonuclease III [Brucella abortus bv. 5 str. B3196]
          Length = 296

 Score =  225 bits (574), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 143/260 (55%), Positives = 192/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 37  MKIATWNINSVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 96

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 97  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 156

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 157 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 216

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 217 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 276

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 277 HVRAWEKPSDHVPVTVTLAV 296


>gi|254420197|ref|ZP_05033921.1| exodeoxyribonuclease III [Brevundimonas sp. BAL3]
 gi|196186374|gb|EDX81350.1| exodeoxyribonuclease III [Brevundimonas sp. BAL3]
          Length = 265

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 120/265 (45%), Positives = 166/265 (62%), Gaps = 1/265 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+ AR+  + AW+++  PD+ C QE K  D+ FP E  +SL Y++ET GQK
Sbjct: 1   MRIATWNVNSVNARLPTVLAWLEQAAPDVACFQEIKCVDEKFPREAFESLGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVA+LSKY   +I   LPGD+ D QAR++EA      + LR+ ++YLP+GNPI + K
Sbjct: 61  SYNGVALLSKYPLSDIRRGLPGDETDEQARYLEAVIEAP-RPLRVASIYLPNGNPIGTEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W +R  R A   L  EEPL   GDYN+IP+  D  NP  W +DA F  + RQ+F
Sbjct: 120 FDYKLAWFERLNRHARDLLAFEEPLALCGDYNVIPEAEDAKNPAAWTDDALFQPQSRQAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L+N+G  D+     +    YSFWDY A +W +N GIRID  +LSP+A   L       
Sbjct: 180 RALKNLGLADSHEVGGEPAGTYSFWDYQAGAWQRNHGIRIDFALLSPQAADRLRGVETHR 239

Query: 244 KPRGWTKPSDHTPVIVSLDIPEPRK 268
             R   KPSDH PV+V +D+    +
Sbjct: 240 DARDMDKPSDHVPVVVDIDLSAGTE 264


>gi|319783180|ref|YP_004142656.1| exodeoxyribonuclease III Xth [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169068|gb|ADV12606.1| exodeoxyribonuclease III Xth [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 264

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 134/261 (51%), Positives = 180/261 (68%), Gaps = 1/261 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWN+N +RARI NL  W+ E+ PDI+CLQE KT D+ FP   +++L Y++ET GQK
Sbjct: 1   MKIVTWNINGVRARIGNLTHWLTESAPDIVCLQEIKTVDEQFPRAEIEALGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            +NGVA+LSK +  E++  LPGDD D QARFIE  F+ +   LR+ +LYLP+GNPI    
Sbjct: 61  GFNGVALLSKLRFDEVIRGLPGDDADEQARFIEGVFSTDKGALRVASLYLPNGNPIDDEK 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+  K+SW+ R  R+A +RL LEE L+ AGDYN+IP+P D   P  W  DA F  + RQ+
Sbjct: 121 KFPYKLSWMARLERWAEERLRLEEALVLAGDYNVIPEPIDARFPENWLGDALFQPQTRQA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L N+GFT+A+RA  D    Y+FWDY A +W KN GIRIDH++LSPEA +   SA I+
Sbjct: 181 FRRLLNLGFTEAVRAVTDARDTYTFWDYQAGAWQKNNGIRIDHLLLSPEAANRFSSASIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
              R W KPSDH PV + L +
Sbjct: 241 KHVRAWEKPSDHVPVAIDLAL 261


>gi|239831752|ref|ZP_04680081.1| exodeoxyribonuclease III (xth) [Ochrobactrum intermedium LMG 3301]
 gi|239824019|gb|EEQ95587.1| exodeoxyribonuclease III (xth) [Ochrobactrum intermedium LMG 3301]
          Length = 272

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 138/260 (53%), Positives = 186/260 (71%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+KE++PDI+CLQE K+ D  FP   +++L YH+ET GQK
Sbjct: 13  MKIATWNINGVKARIDNLLHWLKESSPDIVCLQEIKSVDDQFPRLEIEALGYHVETHGQK 72

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +   +R+ +LYLP+GNP+ + K
Sbjct: 73  GFNGVALLSKKSPDEINRGLPGDDSDEQARFIEGVYSTDKGVVRVVSLYLPNGNPVDTEK 132

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A  RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 133 FPYKLSWMQRLELWARDRLALEEPLVLAGDYNVIPEPEDARNPGQWVGDALFQPQSRQAF 192

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+NMGFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEA +   S+ ++ 
Sbjct: 193 RRLENMGFTDAIRASTDEAGIYSFWDYQAGAWQKNNGIRIDHLMLSPEAANRFISSDVEK 252

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV + L +
Sbjct: 253 HVRAWEKPSDHVPVTIRLAV 272


>gi|90419377|ref|ZP_01227287.1| exodeoxyribonuclease III [Aurantimonas manganoxydans SI85-9A1]
 gi|90336314|gb|EAS50055.1| exodeoxyribonuclease III [Aurantimonas manganoxydans SI85-9A1]
          Length = 260

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 131/258 (50%), Positives = 176/258 (68%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++AR+  L AW++E +PDI CLQE K  D+ FP E +++L YH+ET GQK
Sbjct: 1   MLIATWNINGVKARLDALLAWLQERSPDIACLQEIKNVDETFPREAIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK +P+ I   LPGD  D  ARFIE  +  + + LR+ +LYLP+GNP+ + K
Sbjct: 61  GFNGVALLSKEKPVSIEPRLPGDSSDEHARFIEGVWDFHGRPLRVASLYLPNGNPLGTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W++R L  A   +  EE L+ AGDYNIIP+  D   P  W  DA F  E R ++
Sbjct: 121 FTYKLAWMQRLLAHARDSMAREELLVLAGDYNIIPERGDAARPDKWTGDALFQPESRAAY 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L N+G +DAIRAT D    YSFWDY A +W KN GIRIDH++LSPEA   + SA ID 
Sbjct: 181 RRLINLGLSDAIRATTDADGTYSFWDYQAGAWQKNNGIRIDHLLLSPEAQDRMASAGIDR 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RGW KPSDH PV+V L
Sbjct: 241 HVRGWEKPSDHVPVLVEL 258


>gi|260566570|ref|ZP_05837040.1| exodeoxyribonuclease III [Brucella suis bv. 4 str. 40]
 gi|261758076|ref|ZP_06001785.1| exodeoxyribonuclease III [Brucella sp. F5/99]
 gi|260156088|gb|EEW91168.1| exodeoxyribonuclease III [Brucella suis bv. 4 str. 40]
 gi|261738060|gb|EEY26056.1| exodeoxyribonuclease III [Brucella sp. F5/99]
          Length = 279

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 191/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 20  MKIATWNINGVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 79

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 80  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 139

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 140 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 199

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 200 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 259

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 260 HVRAWEKPSDHVPVTVTLAV 279


>gi|163739595|ref|ZP_02147004.1| exodeoxyribonuclease III [Phaeobacter gallaeciensis BS107]
 gi|161387054|gb|EDQ11414.1| exodeoxyribonuclease III [Phaeobacter gallaeciensis BS107]
          Length = 268

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 128/269 (47%), Positives = 170/269 (63%), Gaps = 10/269 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI+ L  W+ E  PD++ LQE K+ D+ FP E  +   Y++ET GQK
Sbjct: 1   MKIATFNINGIKARINALPEWLDEAQPDVVVLQEIKSVDEAFPRELFEDRGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           S+NGVAILSK    ++   LPGDD D QAR+IEAT  +  Q +RI  LYLP+GNP+    
Sbjct: 61  SFNGVAILSKLPLEDVRRGLPGDDSDEQARWIEAT-VVGKQAIRICGLYLPNGNPVELDA 119

Query: 123 --------KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDAC 174
                   KY  K++W++R  + A   L  E P + AGDYNIIPQ  D   P  W++DA 
Sbjct: 120 EGQPVEGGKYAYKLAWMERLRQRAKDLLAEEMPALMAGDYNIIPQAEDAKTPEAWKDDAL 179

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
              E R +FQ++  +GFT+A RA H     YSFWDY A +W++N GIRIDH +LSP+A  
Sbjct: 180 HRPESRAAFQRIMALGFTEAFRARHQGPGHYSFWDYQAGAWNRNNGIRIDHFLLSPQAAD 239

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           LL   +ID   RG  KPSDH PV V LD+
Sbjct: 240 LLRDCQIDKDVRGRDKPSDHVPVWVDLDL 268


>gi|260563899|ref|ZP_05834385.1| exodeoxyribonuclease III [Brucella melitensis bv. 1 str. 16M]
 gi|260153915|gb|EEW89007.1| exodeoxyribonuclease III [Brucella melitensis bv. 1 str. 16M]
          Length = 279

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 142/260 (54%), Positives = 191/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 20  MKIATWNINGVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 79

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 80  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 139

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 140 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 199

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 200 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 259

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 260 HVRAWEKPSDHVPVTVTLAV 279


>gi|254487256|ref|ZP_05100461.1| exodeoxyribonuclease III [Roseobacter sp. GAI101]
 gi|214044125|gb|EEB84763.1| exodeoxyribonuclease III [Roseobacter sp. GAI101]
          Length = 260

 Score =  225 bits (572), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 122/259 (47%), Positives = 158/259 (61%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI  L  W+ E  PD+  LQE KT D  FP E  +   Y++ET GQK
Sbjct: 1   MKIATFNINGIKARIDALPQWLDEAQPDVAILQEIKTVDDAFPRELFEDRGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGDD D QAR+IEAT   +   +R+  LYLP+GNP    K
Sbjct: 61  SFNGVAILSKRPLEDVTRGLPGDDGDEQARYIEATVMGDKSAIRLCGLYLPNGNPAPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K+ W+ R    A   L  E P +  GDYN+IPQ  D   P  W +DA F  E R ++
Sbjct: 121 FDYKLEWMARLEDRARALLAEETPFLMTGDYNVIPQAEDAATPDAWRDDALFRPETRAAW 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +KL  +G T+A RA       YSFWDY A +W++N GIRIDH +LSP    +L   +ID 
Sbjct: 181 RKLVALGLTEAFRARTQGPGHYSFWDYQAGAWNRNNGIRIDHFLLSPVVADMLRDCQIDK 240

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + RG  KPSDH PV V LD
Sbjct: 241 EIRGRDKPSDHVPVWVDLD 259


>gi|149202739|ref|ZP_01879711.1| exodeoxyribonuclease III [Roseovarius sp. TM1035]
 gi|149144021|gb|EDM32055.1| exodeoxyribonuclease III [Roseovarius sp. TM1035]
          Length = 260

 Score =  224 bits (571), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 124/259 (47%), Positives = 163/259 (62%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI  L AW+ E +PD+  LQE K+ D  FP E  +   Y++ET GQK
Sbjct: 1   MKIATFNINGIKARIDALPAWLDEASPDVALLQEIKSVDDGFPRELFEERGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    ++   LPGDD D QAR+IEAT   + + LR+  LYLP+GNP    K
Sbjct: 61  GFNGVAILSKRPLEDVTRGLPGDDTDEQARWIEATVVGDHRALRLCGLYLPNGNPAPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W+ R    A   L  EEP++  GDYNIIPQ  D   P  W  DA    E R +F
Sbjct: 121 YDYKLAWMDRLHARARDLLASEEPVLMGGDYNIIPQDEDAARPDAWREDALARPESRAAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFT+A RA       Y+FWDY A +W+KN GIRIDH +LSP+A  L+    ID 
Sbjct: 181 RRILNLGFTEAFRAQVQGPGHYTFWDYQAGAWNKNDGIRIDHFLLSPQAADLMTDCGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RG  KPSDH P+ V L+
Sbjct: 241 DIRGRDKPSDHVPLWVELN 259


>gi|110680357|ref|YP_683364.1| exodeoxyribonuclease III, putative [Roseobacter denitrificans OCh
           114]
 gi|109456473|gb|ABG32678.1| exodeoxyribonuclease III, putative [Roseobacter denitrificans OCh
           114]
          Length = 260

 Score =  224 bits (571), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 126/258 (48%), Positives = 165/258 (63%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI  L AW+KE  PD+  LQE K+ D+ FP    + + Y++ET GQK
Sbjct: 1   MKIATFNINGIKARIDALPAWLKEAQPDVALLQEIKSVDEAFPRTVFEDMGYNLETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGD+ D QAR+IEAT   +T  +R+  LYLP+GNP    K
Sbjct: 61  SFNGVAILSKLPLEDVTRGLPGDETDEQARYIEATVMGDTAPVRVCGLYLPNGNPAPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K+ W+ R    A   L  E   + AGDYNIIPQ  D   P  W  DA F LE R +F
Sbjct: 121 YDYKLDWMARLYDRAKALLADETTFVMAGDYNIIPQAEDAAKPESWREDALFRLESRTAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L N+G T+A RA       YSFWDY A +W++N GIRIDH++LSP+A  +L   +ID 
Sbjct: 181 RRLLNLGLTEAFRARTQGPGHYSFWDYQAGAWNRNNGIRIDHLLLSPQAADMLVDCQIDK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + RG  KPSDH PV V L
Sbjct: 241 EVRGRDKPSDHVPVWVDL 258


>gi|163741419|ref|ZP_02148810.1| exodeoxyribonuclease III [Phaeobacter gallaeciensis 2.10]
 gi|161385153|gb|EDQ09531.1| exodeoxyribonuclease III [Phaeobacter gallaeciensis 2.10]
          Length = 268

 Score =  224 bits (571), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 128/269 (47%), Positives = 170/269 (63%), Gaps = 10/269 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI+ L  W+ E  PD++ LQE K+ D+ FP E  +   Y++ET GQK
Sbjct: 1   MKIATFNINGIKARINALPEWLDEAQPDVVVLQEIKSVDEAFPRELFEDRGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           S+NGVAILSK    ++   LPGDD D QAR+IEAT  +  Q +RI  LYLP+GNP+    
Sbjct: 61  SFNGVAILSKLPLEDVRRGLPGDDSDEQARWIEAT-VVGKQAIRICGLYLPNGNPVELDA 119

Query: 123 --------KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDAC 174
                   KY  K++W++R  + A   L  E P + AGDYNIIPQ  D   P  W++DA 
Sbjct: 120 EGRPVEGGKYAYKLAWMERLRQRAKDLLAEEMPALMAGDYNIIPQAEDAKTPDAWKDDAL 179

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
              E R +FQ++  +GFT+A RA H     YSFWDY A +W++N GIRIDH +LSP+A  
Sbjct: 180 HRPESRAAFQRIVALGFTEAFRARHQGPGHYSFWDYQAGAWNRNNGIRIDHFLLSPQAAD 239

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           LL   +ID   RG  KPSDH PV V LD+
Sbjct: 240 LLRDCQIDKDVRGRDKPSDHVPVWVDLDL 268


>gi|154248160|ref|YP_001419118.1| exodeoxyribonuclease III Xth [Xanthobacter autotrophicus Py2]
 gi|154162245|gb|ABS69461.1| exodeoxyribonuclease III Xth [Xanthobacter autotrophicus Py2]
          Length = 262

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 122/260 (46%), Positives = 170/260 (65%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+ +   W+ E  PDI+C+QE K + + FP E  + L Y++   GQK
Sbjct: 1   MRIATWNVNSIRQRLDHAVRWLGETRPDIVCIQEIKCQTEAFPKEAFEQLGYNVTVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++   L GDD DVQARFIEA  ++    +R+  LYLP+GNP+ + K
Sbjct: 61  GFNGVALLSRLPLEDVTHGLAGDDGDVQARFIEAVVSVKGGVVRVACLYLPNGNPVDTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ +++R   FA+ RL+LEEPLI AGD+N+IP+  D  +P  W  DA F    R +F
Sbjct: 121 YPYKLGFMERLEAFAADRLKLEEPLILAGDFNVIPEARDAADPSAWVGDALFLPRTRSAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TDA+RAT D   LY+FWDY A +W ++ GIRIDH++LSP+A   L +  ID 
Sbjct: 181 RSLTHLGLTDALRATSDAGRLYTFWDYQAGAWQRDMGIRIDHLLLSPQAADKLIATGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH P+   L I
Sbjct: 241 HVRAWEKPSDHVPIWADLAI 260


>gi|260545435|ref|ZP_05821176.1| exodeoxyribonuclease III [Brucella abortus NCTC 8038]
 gi|260096842|gb|EEW80717.1| exodeoxyribonuclease III [Brucella abortus NCTC 8038]
          Length = 279

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 143/260 (55%), Positives = 192/260 (73%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS++ARI NL  W++E++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 20  MKIATWNINSVKARIDNLQHWLRESSPDIVCLQEIKSVDEQFPRLEIEALGYHVETHGQK 79

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LSK  P EI   LPGDD D QARFIE  ++ +T  +R+ +LYLP+GNPI + K
Sbjct: 80  GFNGVALLSKKSPDEINKGLPGDDSDEQARFIEGIYSTDTGVVRVVSLYLPNGNPIDTEK 139

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW++R   +A +RL LEEPL+ AGDYN+IP+P D  NP  W  DA F  + RQ+F
Sbjct: 140 FPYKLSWMQRLENWAKKRLTLEEPLVLAGDYNVIPEPVDARNPQAWLGDALFQPQSRQAF 199

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L+N+GFTDAIRA+ D   +YSFWDY A +W KN GIRIDH+MLSPEAT+   SA I+ 
Sbjct: 200 RRLENLGFTDAIRASTDESGVYSFWDYQAGAWQKNNGIRIDHLMLSPEATNRFISANIEK 259

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R W KPSDH PV V+L +
Sbjct: 260 HVRAWEKPSDHVPVTVTLAV 279


>gi|260574689|ref|ZP_05842692.1| exodeoxyribonuclease III Xth [Rhodobacter sp. SW2]
 gi|259023106|gb|EEW26399.1| exodeoxyribonuclease III Xth [Rhodobacter sp. SW2]
          Length = 263

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 120/259 (46%), Positives = 161/259 (62%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I+ARI  L AW+ +  PD++ LQE K+ D+ FP    + L Y +ET GQK
Sbjct: 5   MKIASFNINGIKARIEALPAWLADAAPDVVVLQEIKSVDEGFPRGLFEDLGYRVETHGQK 64

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    ++   LPGD  D QAR+IEAT  I  + +R+  LY P+GNP    K
Sbjct: 65  GFNGVAILSKLPLEDVTRGLPGDPTDEQARWIEAT-VIGARAVRVAGLYAPNGNPAPGPK 123

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K+ W+ R    A   L  EEP++ AGDYN+IPQ  D   P  W  DA +  + R + 
Sbjct: 124 YDYKLGWMARMRERALGLLATEEPVVLAGDYNVIPQAMDAAKPEAWLEDALYLPQSRAAL 183

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q++ N+G+ DA R  H     YSFWDY A +W +N GIRIDH++LSP+A+ LL  A ID 
Sbjct: 184 QRIVNLGYADAFRLRHPGPGHYSFWDYQAGAWERNNGIRIDHLLLSPQASDLLRDAGIDK 243

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             R   KPSDH PV + LD
Sbjct: 244 AVRAGDKPSDHVPVWIDLD 262


>gi|218463283|ref|ZP_03503374.1| exodeoxyribonuclease III protein [Rhizobium etli Kim 5]
          Length = 263

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 139/260 (53%), Positives = 190/260 (73%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT N+N ++ARI NL  W+K+++PDI+CLQE KT D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATCNINGVKARIDNLTQWLKDSDPDIVCLQEIKTIDEGFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTL-RIGNLYLPHGNPITST 122
            +NGVAILSK  P E+   LPGD LD Q+RF+EA FT+    + R+  +YLP+GNP+ + 
Sbjct: 61  GFNGVAILSKTSPSEVNRGLPGDALDEQSRFLEAVFTLPNTRILRVCCIYLPNGNPVETE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R   FA++RL  EE L+ AGDYN+IP+PHDC++P +WENDA F  + R++
Sbjct: 121 KYPYKLAWMERLRSFAAERLAYEEMLVLAGDYNVIPEPHDCFDPKVWENDALFLPQTREA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L+N+G TDA+RAT D   LYSFWDY A +W KN GIRIDH++LSPEA   + SA I+
Sbjct: 181 FRRLENLGLTDAVRATTDATRLYSFWDYQAGAWPKNNGIRIDHLLLSPEAADRMTSAAIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              R W KPSDH PVI   D
Sbjct: 241 KHVRAWEKPSDHVPVIAYFD 260


>gi|221639069|ref|YP_002525331.1| Exodeoxyribonuclease III [Rhodobacter sphaeroides KD131]
 gi|221159850|gb|ACM00830.1| Exodeoxyribonuclease III [Rhodobacter sphaeroides KD131]
          Length = 268

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 121/258 (46%), Positives = 169/258 (65%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N ++AR+  L AW++   PD++ LQE K+ D+ FP    +   +H+ET GQK
Sbjct: 10  MKIATFNINGVKARLEALLAWLEAAEPDVVLLQEIKSVDEGFPRAAFEEKGWHLETHGQK 69

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILS+    ++V  LPGD  DVQAR+IEAT  +  + +R+  LYLP+GNP    K
Sbjct: 70  GFNGVAILSRLPLEDVVRGLPGDPEDVQARWIEAT-VVGERAVRVCGLYLPNGNPAPGPK 128

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K+ W++R    A++ L  EEP++ AGDYN+IPQ  D   P +W  DA F  E R +F
Sbjct: 129 YDYKLGWMERMKTRAAELLATEEPVVLAGDYNVIPQAEDAARPEVWVTDALFLPESRAAF 188

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+G+T+A RA       YSFWDY A +W KN GIRIDH++LSP+A  L+   RID 
Sbjct: 189 RRILNLGYTEAFRARTFGPGHYSFWDYQAGAWEKNNGIRIDHLLLSPQAADLMTDVRIDR 248

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + R   KPSDH PV V L
Sbjct: 249 EVRSGEKPSDHVPVWVEL 266


>gi|163735846|ref|ZP_02143275.1| exodeoxyribonuclease III, putative [Roseobacter litoralis Och 149]
 gi|161390932|gb|EDQ15272.1| exodeoxyribonuclease III, putative [Roseobacter litoralis Och 149]
          Length = 260

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 125/258 (48%), Positives = 165/258 (63%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI  L AW+KE  PD+  LQE K+ D+ FP    + + Y++ET GQK
Sbjct: 1   MKIATFNINGIKARIDALPAWLKEAQPDVALLQEIKSVDEAFPRSVFEDMGYNLETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGD+ D QAR+IEAT   +T  +R+  LYLP+GNP    K
Sbjct: 61  SFNGVAILSKLPLEDVTRGLPGDESDEQARYIEATVMGDTAPVRVCGLYLPNGNPAPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K+ W+ R      + L  E   + AGDYNIIPQ  D   P  W +DA F LE R +F
Sbjct: 121 YDYKLDWMARLYDRVKELLADETTFVMAGDYNIIPQAEDAAKPESWRDDALFRLESRTAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +KL N+G T+A RA       YSFWDY A +W++N GIRIDH++LSP+A  +L   +ID 
Sbjct: 181 RKLINLGLTEAFRARTAGPGHYSFWDYQAGAWNRNNGIRIDHLLLSPQAADMLVDCQIDK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RG  KPSDH PV + L
Sbjct: 241 DVRGRDKPSDHVPVWIDL 258


>gi|91977274|ref|YP_569933.1| exodeoxyribonuclease III [Rhodopseudomonas palustris BisB5]
 gi|91683730|gb|ABE40032.1| Exodeoxyribonuclease III [Rhodopseudomonas palustris BisB5]
          Length = 263

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 132/259 (50%), Positives = 177/259 (68%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R RI +L +W+K   PD++CLQE K  D+ FP E +++L Y+I T GQK
Sbjct: 1   MRIATWNVNSVRQRIDHLVSWLKACEPDVVCLQEIKCVDEAFPREPIEALGYNIVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSKY   E    L GD+ DV ARF+E   ++    +R+  LYLP+GNP+ + K
Sbjct: 61  TFNGVALLSKYPLEEATPRLAGDETDVHARFLEGVVSLKRGVVRVACLYLPNGNPVETEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+SW+ R L+++ +RL+ EEPLI AGD+N+IPQ  D YNP  W +DA F  + R+SF
Sbjct: 121 YPYKLSWMSRLLQYSKERLKTEEPLILAGDFNVIPQASDVYNPAGWVDDALFRPQTRESF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA+RAT D    Y+FWDY A +W KN GIRIDH++LSP+AT  L    ID+
Sbjct: 181 QALLGLGLTDALRATTDAPGQYTFWDYQAGAWQKNWGIRIDHLLLSPQATDRLVGVGIDS 240

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             R W KPSDH PV    D
Sbjct: 241 HVRSWEKPSDHVPVWADFD 259


>gi|77463209|ref|YP_352713.1| exodeoxyribonuclease III [Rhodobacter sphaeroides 2.4.1]
 gi|77387627|gb|ABA78812.1| Exodeoxyribonuclease III [Rhodobacter sphaeroides 2.4.1]
          Length = 259

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 121/258 (46%), Positives = 169/258 (65%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N ++AR+  L AW++   PD++ LQE K+ D+ FP    +   +H+ET GQK
Sbjct: 1   MKIATFNINGVKARLEALLAWLEAAEPDVVLLQEIKSVDEGFPRAAFEDKGWHLETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILS+    ++V  LPGD  DVQAR+IEAT  +  + +R+  LYLP+GNP    K
Sbjct: 61  GFNGVAILSRLPLEDVVRGLPGDPEDVQARWIEAT-VVGERAVRVCGLYLPNGNPAPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K+ W++R    A++ L  EEP++ AGDYN+IPQ  D   P +W  DA F  E R +F
Sbjct: 120 YDYKLGWMERMKARAAELLATEEPVVLAGDYNVIPQAEDAARPEVWVTDALFLPESRAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+G+T+A RA       YSFWDY A +W KN GIRIDH++LSP+A  L+   RID 
Sbjct: 180 RRIVNLGYTEAFRARTFGPGHYSFWDYQAGAWEKNNGIRIDHLLLSPQAADLMTDVRIDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + R   KPSDH PV V L
Sbjct: 240 EVRSGEKPSDHVPVWVEL 257


>gi|126462083|ref|YP_001043197.1| exodeoxyribonuclease III [Rhodobacter sphaeroides ATCC 17029]
 gi|126103747|gb|ABN76425.1| Exodeoxyribonuclease III [Rhodobacter sphaeroides ATCC 17029]
          Length = 259

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 121/258 (46%), Positives = 169/258 (65%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N ++AR+  L AW++   PD++ LQE K+ D+ FP    +   +H+ET GQK
Sbjct: 1   MKIATFNINGVKARLEALLAWLEAAEPDVVLLQEIKSVDEGFPRAAFEDKGWHLETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILS+    ++V  LPGD  DVQAR+IEAT  +  + +R+  LYLP+GNP    K
Sbjct: 61  GFNGVAILSRLPLEDVVRGLPGDPEDVQARWIEAT-VVGERAVRVCGLYLPNGNPAPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K+ W++R    A++ L  EEP++ AGDYN+IPQ  D   P +W  DA F  E R +F
Sbjct: 120 YDYKLGWMERMKARAAELLATEEPVVLAGDYNVIPQAEDAARPEVWVTDALFLPESRAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+G+T+A RA       YSFWDY A +W KN GIRIDH++LSP+A  L+   RID 
Sbjct: 180 RRILNLGYTEAFRARTFGPGHYSFWDYQAGAWEKNNGIRIDHLLLSPQAADLMTDVRIDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + R   KPSDH PV V L
Sbjct: 240 EVRSGEKPSDHVPVWVEL 257


>gi|121605670|ref|YP_982999.1| exodeoxyribonuclease III Xth [Polaromonas naphthalenivorans CJ2]
 gi|120594639|gb|ABM38078.1| Exodeoxyribonuclease III [Polaromonas naphthalenivorans CJ2]
          Length = 260

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 93/260 (35%), Positives = 137/260 (52%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+  N  D++CLQE K  D  FP + L++  Y     GQK
Sbjct: 1   MKIATWNVNSLTVRLPQVLDWLAANPVDVLCLQELKLSDDKFPLQELEAAGYQSAVFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+     IV ++ G   +       AT  + T  +R+ N Y  +G    S K
Sbjct: 61  TYNGVAILSRTPARNIVKNITGFTDEQSRVI-AATLDMPTGEVRVVNGYFVNGQSPGSEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           ++ K+ W++    +  + L     L+  GD+NI     D Y+P         T E RQ F
Sbjct: 120 FEYKMKWLESLRNWLREELAEHPNLVLLGDFNITADDRDSYDPEGLRETIHHTSEERQHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G  DA R        YS+WDY   ++ +N+G+RIDHI++S     L+ S  ID 
Sbjct: 180 QALVKLGLNDAFRMFDQPEKSYSWWDYREMAFRRNRGLRIDHILVSEALKPLVRSCVIDK 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
            PR   +PSDH PV++ LD+
Sbjct: 240 LPRKNERPSDHVPVVLELDL 259


>gi|225023438|ref|ZP_03712630.1| hypothetical protein EIKCOROL_00296 [Eikenella corrodens ATCC
           23834]
 gi|224943787|gb|EEG24996.1| hypothetical protein EIKCOROL_00296 [Eikenella corrodens ATCC
           23834]
          Length = 255

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 94/259 (36%), Positives = 139/259 (53%), Gaps = 4/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+ +++ W+ ++ PD++CLQE K +   FP    + L Y     GQK
Sbjct: 1   MKIATWNVNSLKVRLPHVSDWLIQHQPDVLCLQELKLDQDQFPLSAFEMLGYRAVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILSK +   + T LP    D Q R I AT       +R+ ++Y  +G  + S K
Sbjct: 61  TYNGVAILSKEEVQNVHTGLPALPNDPQRRVIAATIGG----VRVVDVYCVNGEAVGSEK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    L     L+  GD+NI P   D Y+P  W+     + E R  F
Sbjct: 117 FAYKQQWFAALAEFIRSELAQYPELVLLGDFNIAPADLDVYDPEKWQGKILCSAEERAWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H    LY++WDY  + + +  G+RIDHI+ S      L +A +DT
Sbjct: 177 QTLLDLGLTDSLRRLHPAEPLYTWWDYRMNMFRRKLGLRIDHILASQALLPRLAAAGVDT 236

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR   +PSDH PV    +
Sbjct: 237 APRALERPSDHAPVWAEFE 255


>gi|149914968|ref|ZP_01903497.1| exodeoxyribonuclease III [Roseobacter sp. AzwK-3b]
 gi|149811156|gb|EDM70993.1| exodeoxyribonuclease III [Roseobacter sp. AzwK-3b]
          Length = 260

 Score =  222 bits (565), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 117/259 (45%), Positives = 163/259 (62%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I+AR   L  W+ E  PD++ LQE K+ D+ FP E  +   Y +ET GQK
Sbjct: 1   MKIASFNINGIKARAQALTDWLDEAQPDVVVLQEIKSVDEGFPCELFEDRGYRVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILS+    ++   LPGDD D QAR+IE T   +   +R+  LYLP+GNP    K
Sbjct: 61  SFNGVAILSRLPLEDVTRGLPGDDEDEQARWIEGTVIGDKAAVRVCGLYLPNGNPAPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W++R    A   L  EEP + AGDYN+IPQ  D   P  W  DA    E R +F
Sbjct: 121 YDYKLAWMERLKARAEALLAAEEPALMAGDYNVIPQDEDAKRPEAWRKDALALPETRAAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFT+A RA H     Y+FWDY A +W+++ GIRIDH +L+P+A  LL   +ID 
Sbjct: 181 RRIVNLGFTEAFRAFHKGPSHYTFWDYQAGAWNRDDGIRIDHFLLTPQAADLLGDCQIDR 240

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             R   KPSDH P+ ++LD
Sbjct: 241 DIRDREKPSDHVPIWITLD 259


>gi|158424436|ref|YP_001525728.1| exodeoxyribonuclease III [Azorhizobium caulinodans ORS 571]
 gi|158331325|dbj|BAF88810.1| exodeoxyribonuclease III [Azorhizobium caulinodans ORS 571]
          Length = 262

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 120/260 (46%), Positives = 168/260 (64%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R  +  AW+KE  PD++CLQE K + + FP E  ++L Y++   GQK
Sbjct: 1   MRIATWNVNSVRLRTEHAVAWLKEAQPDVVCLQEIKCQTEQFPREPFEALGYNVAVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    ++   L GDD DVQARFIEA  ++    +R+  +YLP+GNP  + K
Sbjct: 61  GFNGVAILSKRPLEDVTNGLAGDDSDVQARFIEAVVSVPGGVVRVCCIYLPNGNPPQTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K+ ++ R   F   RL+LEEPLI AGD+N+IP   D  +P  W  DA +    R +F
Sbjct: 121 YDYKLGFMARLKAFTESRLKLEEPLILAGDFNVIPDARDAADPAAWVEDALYLPRTRAAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+G TDA+RAT D   L++FWDY A +W ++ GIRIDH++LSP+A   L  A ID 
Sbjct: 181 REIINLGMTDALRATSDAERLFTFWDYQAGAWQRDFGIRIDHLLLSPQAADRLIGAGIDK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R   +PSDH P  + L +
Sbjct: 241 HLRALERPSDHVPAWIDLKM 260


>gi|254509791|ref|ZP_05121858.1| exodeoxyribonuclease III [Rhodobacteraceae bacterium KLH11]
 gi|221533502|gb|EEE36490.1| exodeoxyribonuclease III [Rhodobacteraceae bacterium KLH11]
          Length = 259

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 126/260 (48%), Positives = 171/260 (65%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR   L  W+ +  PD++ LQE K+ D+NFP E  +   Y++E  GQK
Sbjct: 1   MKIATFNINGIKARAEALPRWLDDAQPDVVLLQEIKSIDENFPREIFEDRGYNVEAHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK Q  ++   LPGDD+D QAR+IEAT  +  + +RI  LYLP+GNP+   K
Sbjct: 61  SFNGVAILSKLQLEDVTRGLPGDDMDEQARWIEAT-VVGKKAVRICGLYLPNGNPVPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W++R    A   L  EEP + AGDYNIIPQ  D   P  W  DA F  E R ++
Sbjct: 120 YDYKLAWMERLYDRARALLAAEEPALMAGDYNIIPQAEDAKRPNAWREDALFRPESRAAY 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +K+ N+GFT+A RA       YSFWDY A +W+KN GIRIDH +L+P+   L+   RID+
Sbjct: 180 RKILNLGFTEAFRARTQGPGHYSFWDYQAGAWNKNDGIRIDHFLLTPQTADLMRDCRIDS 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + RG  KPSDH PV + LD+
Sbjct: 240 EVRGHEKPSDHVPVWIDLDL 259


>gi|167647089|ref|YP_001684752.1| exodeoxyribonuclease III Xth [Caulobacter sp. K31]
 gi|167349519|gb|ABZ72254.1| exodeoxyribonuclease III Xth [Caulobacter sp. K31]
          Length = 262

 Score =  221 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 151/262 (57%), Gaps = 2/262 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+ AR+  +  W +   PD+  LQE K  D+ FP E  + L Y++   GQK
Sbjct: 1   MRIATWNVNSVNARLERVLEWFESAAPDVAVLQEIKCIDEKFPTEAFERLGYNVAVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT--QTLRIGNLYLPHGNPITS 121
           +YNGVA+LSK+   ++   LP    D           +       R+  +YLP+GNP+ +
Sbjct: 61  TYNGVAMLSKFPLEDVRRGLPFLHDDEVDEQSRYIEAVIGAPTPFRMVGIYLPNGNPVDT 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            K+D K++W++R    A   L LEEPL+ AGDYN+IP+  D  NP  W NDA F LE R 
Sbjct: 121 EKFDYKLAWMRRLHAHAQGLLALEEPLVIAGDYNVIPEVEDVANPEAWVNDALFRLESRG 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +F+ L+N+G TDA          Y+FWDY A +W +N GIRIDH++LSP+A   L    I
Sbjct: 181 AFRALKNLGLTDAYMQADGAPGGYTFWDYQAGAWPRNLGIRIDHLLLSPQAADKLAGVVI 240

Query: 242 DTKPRGWTKPSDHTPVIVSLDI 263
               R   KPSDH PV+  L +
Sbjct: 241 HRDERDKEKPSDHVPVVAELAL 262


>gi|260433435|ref|ZP_05787406.1| exodeoxyribonuclease III [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417263|gb|EEX10522.1| exodeoxyribonuclease III [Silicibacter lacuscaerulensis ITI-1157]
          Length = 259

 Score =  221 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 125/260 (48%), Positives = 171/260 (65%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I+AR   L  W+ +  PD+  LQE K+ D+NFP E  +   Y++ET GQK
Sbjct: 1   MKIASFNINGIKARADALLRWLDDARPDVAVLQEIKSVDENFPREIFEERGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVA+LSK    ++   LPGDD D QAR+IEAT  +  + LRI  LYLP+GNP    K
Sbjct: 61  SFNGVAVLSKLPLEDVTRGLPGDDDDEQARWIEAT-VVGKKALRICGLYLPNGNPAPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W++R  + A + L+ EEP + AGDYN+IPQ  D   P  W  DA F  E R +F
Sbjct: 120 FDYKLAWMERLHQRAVELLKSEEPALMAGDYNVIPQAEDAKRPEAWREDALFRSESRAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFTDA RA       Y+FWDY A +W++N GIRIDH +L+P+A  LL   RID 
Sbjct: 180 RRILNLGFTDAFRARTQGPGHYTFWDYQAGAWNRNDGIRIDHFLLTPQAADLLQDCRIDA 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + RG  KPSDH P+ V LDI
Sbjct: 240 EVRGQEKPSDHVPIWVDLDI 259


>gi|254464825|ref|ZP_05078236.1| exodeoxyribonuclease III [Rhodobacterales bacterium Y4I]
 gi|206685733|gb|EDZ46215.1| exodeoxyribonuclease III [Rhodobacterales bacterium Y4I]
          Length = 268

 Score =  221 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 130/269 (48%), Positives = 168/269 (62%), Gaps = 10/269 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR   L  W+ E  PD++ LQE K+ D+ FP E  +   Y++ET GQK
Sbjct: 1   MKIATFNINGIKARAQALPDWLDEAQPDVVVLQEIKSVDEAFPREIFEERGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           S+NGVAILSK    ++   LPGDD D QAR+IEAT T   Q +RI  LYLP+GNP+    
Sbjct: 61  SFNGVAILSKLPLEDVRRGLPGDDSDEQARWIEATVTG-KQAIRICGLYLPNGNPVELEA 119

Query: 123 --------KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDAC 174
                   KY  K++W++R    A   L  E P + AGDYNIIPQ  D   P  W  DA 
Sbjct: 120 DGSPVAGGKYAYKLAWMERLKARAEALLADEMPALMAGDYNIIPQAEDAKRPEAWAEDAL 179

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
           F  + R +FQ++ N+GFT+A RA H     YSFWDY A +W++N GIRIDHI+L+P+A  
Sbjct: 180 FRPQSRAAFQRIVNLGFTEAFRARHQGPGHYSFWDYQAGAWNRNDGIRIDHILLTPQAAD 239

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           LL   +ID   RG  KPSDH PV V LDI
Sbjct: 240 LLLDCQIDKDVRGREKPSDHVPVWVELDI 268


>gi|319792482|ref|YP_004154122.1| exodeoxyribonuclease iii xth [Variovorax paradoxus EPS]
 gi|315594945|gb|ADU36011.1| exodeoxyribonuclease III Xth [Variovorax paradoxus EPS]
          Length = 261

 Score =  221 bits (564), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 95/258 (36%), Positives = 138/258 (53%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+ AR+ ++  W+  N  D++CLQE K  D  FP E L+S  Y     GQK
Sbjct: 1   MKIATWNVNSLTARLQHVLDWLIANPVDVLCLQELKMTDDKFPLEVLKSAGYEAAVFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS     ++V ++ G   +       AT    T  LR+ N Y  +G    S K
Sbjct: 61  TYNGVAILSLAPMRDVVKNIGGFTDEQSRVI-AATVETPTGPLRVVNGYFVNGQAPGSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           ++ K+ W+     +  Q L     L+  GD+NI P+  D ++P+  +     T E R+ F
Sbjct: 120 FEYKLKWLDALRDWLRQELVAHPNLVLLGDFNITPEDRDSFDPVGLKETIHHTTEEREHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L  +G TD+ R        YS+WDY    + KN+G+RIDHI++S      +    ID 
Sbjct: 180 KALLGLGLTDSFRMFEQPEKSYSWWDYRMLGYQKNRGLRIDHILVSETLLPRVKGCIIDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W KPSDH PV++ L
Sbjct: 240 VPRKWEKPSDHAPVVLDL 257


>gi|89055306|ref|YP_510757.1| exodeoxyribonuclease III [Jannaschia sp. CCS1]
 gi|88864855|gb|ABD55732.1| Exodeoxyribonuclease III [Jannaschia sp. CCS1]
          Length = 261

 Score =  221 bits (564), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 128/259 (49%), Positives = 170/259 (65%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           ++ +AT+N+N ++ARI  L  W+ E  PD+  LQE K+ D+NFP E L+   Y +ET GQ
Sbjct: 1   MMRIATFNINGVKARIGALGDWLDEAKPDVALLQEIKSVDENFPREMLEDRGYTVETHGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K +NGVAILSK    ++   LPGDD D QAR+IEAT   +TQ +R+  LYLP+GNP    
Sbjct: 61  KGFNGVAILSKLPLEDVSRGLPGDDTDEQARWIEATVMGDTQAVRVCGLYLPNGNPTPGP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KYD K++W++R  R A   L  E P++ AGDYNIIPQ  D   P +W++DA    E R +
Sbjct: 121 KYDYKLAWMERMHRHAQGLLASEMPVVMAGDYNIIPQDADAARPEVWQDDALARSESRAA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L  +GFT+A RA +    +YSFWDY A +W+KN GIRIDH +LSPEA  LL    I+
Sbjct: 181 FRRLLALGFTEAFRARNQAPGMYSFWDYQAGAWNKNDGIRIDHHLLSPEAADLLQECWIE 240

Query: 243 TKPRGWTKPSDHTPVIVSL 261
              RG  KPSDH PV + L
Sbjct: 241 KDVRGRDKPSDHVPVWIDL 259


>gi|170740918|ref|YP_001769573.1| exodeoxyribonuclease III Xth [Methylobacterium sp. 4-46]
 gi|168195192|gb|ACA17139.1| exodeoxyribonuclease III Xth [Methylobacterium sp. 4-46]
          Length = 270

 Score =  221 bits (563), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 123/265 (46%), Positives = 172/265 (64%), Gaps = 2/265 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNSIR R+ +L A+++E  PD++CLQE K  D++FP   ++   Y + T GQK
Sbjct: 1   MRITTWNVNSIRQRLGHLLAFLEEAKPDVVCLQELKCVDESFPRTEIEEAGYVVATHGQK 60

Query: 64  SYNGVAILSKYQP--IEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           ++NGVA+L++      E+   LPGD  D QAR+IEA        LR+ ++YLP+GNP+ +
Sbjct: 61  AFNGVALLARQPLPLRELRRGLPGDPEDAQARYIEALIPTPAANLRVASIYLPNGNPVGT 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            K+DDK+++++R    A Q  E EE L+ AGDYN+IP+P D  +P  W  DA F  E R 
Sbjct: 121 PKFDDKLAFLRRLTAHARQLREREEVLVLAGDYNVIPEPVDVADPAAWLGDALFRPESRA 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +F+ L N GF DA+RA  +   LY+FWDY A +W +N GIRIDH++LSP+A   L SA +
Sbjct: 181 AFRALLNEGFADALRACDERPGLYTFWDYQAGAWPRNLGIRIDHLLLSPQALDRLVSASV 240

Query: 242 DTKPRGWTKPSDHTPVIVSLDIPEP 266
               RG  KPSDH PV V LD+  P
Sbjct: 241 QKHLRGLEKPSDHVPVTVELDLDRP 265


>gi|222085777|ref|YP_002544307.1| exodeoxyribonuclease III protein [Agrobacterium radiobacter K84]
 gi|221723225|gb|ACM26381.1| exodeoxyribonuclease III protein [Agrobacterium radiobacter K84]
          Length = 263

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 148/260 (56%), Positives = 193/260 (74%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+K+++PDI CLQE KT D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIENLCQWLKDSDPDIACLQEIKTVDEGFPRLEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT-LRIGNLYLPHGNPITST 122
            +NGVAILSK +P E+   LPGDD D QARFIEA F++     LR+  LYLP+GNP+ + 
Sbjct: 61  GFNGVAILSKAKPDEVTRGLPGDDSDEQARFIEAVFSVPDHGALRVCCLYLPNGNPVDTE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R  +FA+ RL LEEP+I AGDYN+IP+PHDC++P +WENDA F  + RQ+
Sbjct: 121 KYPYKLAWMERLRKFAADRLALEEPIILAGDYNVIPEPHDCFDPKVWENDALFLPQTRQA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L+N+GFTDA+R T D   LYSFWDY A +W KN GIRIDH+MLSPEA   L S  I+
Sbjct: 181 FRQLENLGFTDAVRTTTDAVKLYSFWDYQAGAWPKNNGIRIDHLMLSPEAADRLTSTAIE 240

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              R W KPSDH PVI  LD
Sbjct: 241 KHMRAWEKPSDHVPVIAHLD 260


>gi|16126254|ref|NP_420818.1| exodeoxyribonuclease III [Caulobacter crescentus CB15]
 gi|221235027|ref|YP_002517463.1| exodeoxyribonuclease III [Caulobacter crescentus NA1000]
 gi|13423482|gb|AAK23986.1| exodeoxyribonuclease III [Caulobacter crescentus CB15]
 gi|220964199|gb|ACL95555.1| exodeoxyribonuclease III [Caulobacter crescentus NA1000]
          Length = 262

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 147/262 (56%), Gaps = 2/262 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  + AW +   PD+  LQE K  D+ FP E  + L Y++   GQK
Sbjct: 1   MRIATWNVNSINARLEGVLAWFESEAPDVAVLQEIKCVDEKFPTEAFERLGYNVAVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN--TQTLRIGNLYLPHGNPITS 121
           +YNGVA+LSK+   ++   LP    D           +       R+  +YLP+GNPI +
Sbjct: 61  TYNGVALLSKHPIEDVRKGLPFLSEDEVDEQARYIEAVIAAPTPFRVVGIYLPNGNPIGT 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            K+  K+SW++R    A   L  EEPL+ AGDYN+IP+  D  NP  W  DA F  E R 
Sbjct: 121 EKFAYKLSWMRRLHAHAQGLLAFEEPLVIAGDYNVIPEVEDVANPQAWLGDALFQPESRA 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +F+ L+N+GF DA          Y+FWDY A +W +N GIRIDH++LSP+A   L    I
Sbjct: 181 AFRALKNLGFADAYMQADGAPGGYTFWDYQAGAWQRNLGIRIDHLLLSPQAADRLTGLVI 240

Query: 242 DTKPRGWTKPSDHTPVIVSLDI 263
               R   KPSDH PV+    I
Sbjct: 241 HRDERDKEKPSDHVPVVGRFRI 262


>gi|254475570|ref|ZP_05088956.1| exodeoxyribonuclease III [Ruegeria sp. R11]
 gi|214029813|gb|EEB70648.1| exodeoxyribonuclease III [Ruegeria sp. R11]
          Length = 268

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 128/269 (47%), Positives = 168/269 (62%), Gaps = 10/269 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI+ L  W+ +  PD++ LQE K+ D+ FP E  +   Y++ET GQK
Sbjct: 1   MKIATFNINGIKARINALPEWLDDAQPDVVVLQEIKSVDEAFPRELFEDRGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           S+NGVAILSK    ++   LPGDD D QAR+IEAT  +  Q +RI  LYLP+GNP+    
Sbjct: 61  SFNGVAILSKLPLEDVRRGLPGDDSDEQARWIEAT-VVGKQAIRICGLYLPNGNPVELNA 119

Query: 123 --------KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDAC 174
                   KY  K++W++R    A   L+ E P + AGDYNIIPQ  D   P  W  DA 
Sbjct: 120 DGTPVEGGKYAYKLAWMERMRARAQALLDEEMPALMAGDYNIIPQAEDAKKPEAWLEDAL 179

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
              E R +FQ++ N+GFT+A RA H     YSFWDY A +W +N GIRIDH +LSP+A  
Sbjct: 180 HRTESRAAFQRIVNLGFTEAFRARHQGPGHYSFWDYQAGAWQRNNGIRIDHFLLSPQAAD 239

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           L+   +ID   RG  KPSDH PV V LDI
Sbjct: 240 LMLDCQIDKDVRGRDKPSDHVPVWVELDI 268


>gi|295688833|ref|YP_003592526.1| exodeoxyribonuclease III Xth [Caulobacter segnis ATCC 21756]
 gi|295430736|gb|ADG09908.1| exodeoxyribonuclease III Xth [Caulobacter segnis ATCC 21756]
          Length = 262

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 106/257 (41%), Positives = 147/257 (57%), Gaps = 2/257 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+ AR+  +  W +   PD+  LQE K  D+ FP E  + L Y++   GQK
Sbjct: 1   MRIATWNVNSVNARLERVLGWFEAEAPDVAVLQEIKCVDEKFPAEAFERLGYNVVVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT--QTLRIGNLYLPHGNPITS 121
           +YNGVA+LSK+   ++   LP    D           +       R+  +YLP+GNPI +
Sbjct: 61  TYNGVALLSKHPVEDVRKGLPFLSEDEVDEQARYVEAVIGAQTPFRVVGIYLPNGNPIGT 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            K+D K++W++R    A   L  EE L+ AGDYN+IP+  D  NP  W  DA F  E R 
Sbjct: 121 EKFDYKLAWMRRLHAHAQNLLAFEENLVIAGDYNVIPEAQDVANPEAWLGDALFRPESRA 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +F+ L+N+G TDA   T      Y+FWDY A +W +N GIRIDH++LSP+A   L +  I
Sbjct: 181 AFRALKNLGLTDAYMQTDGAPGGYTFWDYQAGAWQRNLGIRIDHLLLSPQAADRLENVVI 240

Query: 242 DTKPRGWTKPSDHTPVI 258
               R   KPSDH PV+
Sbjct: 241 HRDERDKEKPSDHVPVV 257


>gi|260426641|ref|ZP_05780620.1| exodeoxyribonuclease III [Citreicella sp. SE45]
 gi|260421133|gb|EEX14384.1| exodeoxyribonuclease III [Citreicella sp. SE45]
          Length = 260

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 120/257 (46%), Positives = 160/257 (62%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR   L  W+ E  PD+  LQE K+ D+ FP E  +   Y++ET GQK
Sbjct: 1   MKIATFNINGIKARHAALLDWLDEAQPDVALLQEIKSVDEGFPREPFEERGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    ++   LPGDD D QAR+IEAT    T  L++  LYLP+GNP    K
Sbjct: 61  GFNGVAILSKLPLEDVTRGLPGDDEDEQARWIEATVVGETHALQLCGLYLPNGNPAPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W++R    A   L  E P + AGDYN+IPQ  D   P  W  DA +  + R +F
Sbjct: 121 YDYKLAWMERLEARARALLADEMPAMMAGDYNVIPQAEDAAKPESWTEDALYLPQTRAAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFT+A R  H     YSFWDY A +W +N GIRIDHI+L+P+A  L+   +ID 
Sbjct: 181 RRILNLGFTEAFRTRHPEPGHYSFWDYQAGAWQRNNGIRIDHILLTPQAADLMRDVQIDR 240

Query: 244 KPRGWTKPSDHTPVIVS 260
             RG  KPSDH PV V 
Sbjct: 241 DIRGRDKPSDHVPVWVD 257


>gi|82703533|ref|YP_413099.1| exodeoxyribonuclease III [Nitrosospira multiformis ATCC 25196]
 gi|82411598|gb|ABB75707.1| Exodeoxyribonuclease III [Nitrosospira multiformis ATCC 25196]
          Length = 277

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 86/258 (33%), Positives = 141/258 (54%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+  N PD++CLQETK +D++FP   + +  Y     GQK
Sbjct: 1   MKIATWNVNSLKVRLPQVLEWLTLNQPDVLCLQETKLQDEHFPVSEIAAAGYQTIYSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LS+    E+ T +PG +   +         +    + +     P+G  +TS K
Sbjct: 61  TYNGVALLSRQPVSEVFTGMPGFEDPQKRLLGGVHDDVCVVCIYV-----PNGEHVTSEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+     +  + L     L+  GD+NI P+  D ++  +WE    F+   R +F
Sbjct: 116 YQYKLRWLAALREWLREMLSRHRKLVVLGDFNIAPEDCDVHDSKLWEGKVLFSELERAAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ ++GF D+ R        +++WDY   ++ +N G+RIDHI+LS E   +  +  ID 
Sbjct: 176 REVLDLGFIDSFRLFDQPEKSFTWWDYRMMAFRRNMGLRIDHILLSRELAGMCTACVIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R   +PSDH PVIV L
Sbjct: 236 ATRRLERPSDHAPVIVEL 253


>gi|56476029|ref|YP_157618.1| exodeoxyribonuclease III [Aromatoleum aromaticum EbN1]
 gi|56312072|emb|CAI06717.1| Exodeoxyribonuclease III [Aromatoleum aromaticum EbN1]
          Length = 253

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 89/260 (34%), Positives = 141/260 (54%), Gaps = 7/260 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+ ++  W+  N PD++CLQE K EDK+FP   +++  YH    GQK
Sbjct: 1   MKIATWNVNSLKVRLPHVLDWLAANRPDVLCLQELKLEDKSFPSAEIEAAGYHAAFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+     I   +PG D + +              +R+   Y P+G  + S K
Sbjct: 61  TYNGVAILSRSALAGIGHGIPGFDDEQKRVLAATVNG-----VRVICGYFPNGQAVGSEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +  + L+  + L+  GD+NI P+  D +    W+++   +   R +F
Sbjct: 116 FAYKLRWLAALTEWLREELKAHQRLVLTGDFNIAPEDRDAHPD--WKDEIHVSPAERAAF 173

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L  +G  DA R        +S+WDY   ++ +N G+RIDHI+LSP    +  +  ID 
Sbjct: 174 AALTGLGLADAYRLFPQDDKSFSWWDYRMGAFRRNFGLRIDHILLSPALRDVCCACTIDK 233

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
            PR   +PSDH PVI  L++
Sbjct: 234 APRKLERPSDHAPVIAELEL 253


>gi|310823161|ref|YP_003955519.1| exodeoxyribonuclease III [Stigmatella aurantiaca DW4/3-1]
 gi|309396233|gb|ADO73692.1| Exodeoxyribonuclease III [Stigmatella aurantiaca DW4/3-1]
          Length = 257

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 103/259 (39%), Positives = 146/259 (56%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+RAR   L  W+K + PD++CLQE K  D +FP E ++   YH  T GQK
Sbjct: 1   MKIASWNVNSVRARQERLLNWLKAHQPDVLCLQELKCVDADFPTEAVREAGYHAVTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILSK +P ++V  L     D  AR I AT +     +R+ + Y+P+G  + S  
Sbjct: 61  TYNGVAILSKAEPSDVVLGLSDGVEDSHARLIAATVSG----VRVVSAYVPNGQAVDSPA 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W  R  R+   R   ++PL+  GD+N+ P+P D Y+P +WE    FTL+ R + 
Sbjct: 117 YVYKLEWYSRLRRYLEARHTPDQPLVLCGDWNVAPEPIDVYDPAVWEGQTLFTLKERDAL 176

Query: 184 QKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           Q++   G  D  R  H      +S+WDY   S+ KN G+RIDHI  +      L  A ID
Sbjct: 177 QQVCAFGLADTFRKLHPGVEKKFSWWDYRGLSFPKNLGVRIDHIFATAPLVQRLVKAEID 236

Query: 243 TKPRGWTKPSDHTPVIVSL 261
            + R   +PSDH PV    
Sbjct: 237 REERKGKQPSDHAPVWAEF 255


>gi|146277242|ref|YP_001167401.1| exodeoxyribonuclease III Xth [Rhodobacter sphaeroides ATCC 17025]
 gi|145555483|gb|ABP70096.1| Exodeoxyribonuclease III [Rhodobacter sphaeroides ATCC 17025]
          Length = 259

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 123/258 (47%), Positives = 170/258 (65%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI  + AW++  +PD++ LQE K+ D+ FP    +   +H+ET GQK
Sbjct: 1   MKIATYNINGIKARIEAVLAWLEAASPDVVLLQEIKSVDETFPRAVFEDRGWHLETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILS+    ++V  LPGD  DVQAR+IEAT     + +R+  LYLP+GNP    K
Sbjct: 61  GFNGVAILSRLPLEDVVRGLPGDAEDVQARWIEATVVGQ-RAVRVCGLYLPNGNPAPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++WI R  + A++ LE E+P++ AGDYN+IPQ  D   P  W  DA F  E R +F
Sbjct: 120 YDYKLAWIARMKQRAAELLETEDPVVLAGDYNVIPQAEDAARPEAWVTDALFLPESRAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+G+T+A RA       YSFWDY A +W KN GIRIDH++LSP+A  L+   RID 
Sbjct: 180 RRILNLGYTEAFRARSFGPGHYSFWDYQAGAWEKNNGIRIDHLLLSPQAADLMTDVRIDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + R   KPSDH PV V L
Sbjct: 240 EVRAGEKPSDHVPVWVEL 257


>gi|72160662|ref|YP_288319.1| exodeoxyribonuclease III [Thermobifida fusca YX]
 gi|71914394|gb|AAZ54296.1| Exodeoxyribonuclease III [Thermobifida fusca YX]
          Length = 264

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 84/264 (31%), Positives = 127/264 (48%), Gaps = 3/264 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   +AAW++ ++ D++ LQETK  D  FP      L Y +   G  
Sbjct: 1   MRLATWNVNSVRARSERIAAWLRRSDVDVVALQETKCRDDQFPTAVFTELGYEVAHHGLS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEAT-FTINTQTLRIGNLYLPHGNPITST 122
            +NGVAI S+    ++    PG     +    EA   +     +R+ +LY+P+G  I   
Sbjct: 61  QWNGVAIASRVGLSDVQIGFPGQPGWGEPEEAEARAISAVCGGVRVWSLYVPNGREIDHP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIF--AGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
            Y  K+ W+ R        L  +        GD+NI P   D ++   +E     T   R
Sbjct: 121 HYTYKLQWLARLREAGEAWLSEDPKAQIALCGDWNIAPYDEDVWDMAEFEGRTHVTKPER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +F  + + GFTD +R       +Y++WDY   ++ K KG+RID I+ SP        A+
Sbjct: 181 DAFHAVVDAGFTDVVRPHAPGPGVYTYWDYKGLAFPKRKGMRIDFILASPALAERATDAK 240

Query: 241 IDTKPRGWTKPSDHTPVIVSLDIP 264
           ID + R     SDH PVI    + 
Sbjct: 241 IDREERKGKGASDHAPVIADFQLD 264


>gi|114766201|ref|ZP_01445201.1| Exodeoxyribonuclease III [Pelagibaca bermudensis HTCC2601]
 gi|114541572|gb|EAU44615.1| Exodeoxyribonuclease III [Roseovarius sp. HTCC2601]
          Length = 260

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 121/258 (46%), Positives = 164/258 (63%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI  L  W+ E  PD+  LQE K+ D+ FP E  +   + +ET GQK
Sbjct: 1   MKIATFNINGIKARIGALTDWLDEAQPDVALLQEIKSVDEAFPREHFEERGWQVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGDD D QAR+IEAT    +  +R+  LYLP+GNP+   K
Sbjct: 61  SFNGVAILSKLPLEDVTRGLPGDDEDEQARWIEATVIGESHAVRLCGLYLPNGNPVPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W+KR    A + L  E P + AGDYN+IPQ  D   P  W  DA +  E R +F
Sbjct: 121 YDYKLAWMKRLEARARELLASEMPAVMAGDYNVIPQAEDAAKPQAWIEDALYLPETRAAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFT+A RA       YSFWDY A +W +N GIRIDH++L+P+A  L+   +ID 
Sbjct: 181 RRILNLGFTEAFRARTQGPGHYSFWDYQAGAWQRNNGIRIDHLLLTPQAADLMTDVQIDR 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RG  KPSDH PV + L
Sbjct: 241 DIRGRDKPSDHVPVWIDL 258


>gi|329890230|ref|ZP_08268573.1| exodeoxyribonuclease III [Brevundimonas diminuta ATCC 11568]
 gi|328845531|gb|EGF95095.1| exodeoxyribonuclease III [Brevundimonas diminuta ATCC 11568]
          Length = 261

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 114/260 (43%), Positives = 161/260 (61%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+ AR+  +  WI+  NPD+ C QE K  D+ FP E  + L Y++ET GQK
Sbjct: 1   MRIATWNVNSVNARLPTVLEWIQAANPDVACFQEIKCVDEKFPREAFEDLGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVA+LSKY   ++   LPGDD D QAR++EA      + +R+ ++YLP+GNP+ + K
Sbjct: 61  SYNGVALLSKYPLSDVRRGLPGDDGDEQARYLEALIEAP-RPIRVASIYLPNGNPLGTEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W +R    A + L LEEPL   GDYN+IP+  D  NP  W  DA F  E R++F
Sbjct: 120 FAYKLAWFQRLQNHARELLALEEPLALCGDYNVIPEAEDAKNPAAWAEDALFQPESREAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L+ +G  D+     +    ++FWDY A +W +N GIRID  +LSP A     +     
Sbjct: 180 RALKWLGLADSHELGREPAGTFTFWDYQAGAWQRNHGIRIDFALLSPHAADRFRAIETHR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   KPSDH PV+V LD+
Sbjct: 240 EARDMEKPSDHVPVVVDLDL 259


>gi|126739465|ref|ZP_01755158.1| exodeoxyribonuclease III [Roseobacter sp. SK209-2-6]
 gi|126719565|gb|EBA16274.1| exodeoxyribonuclease III [Roseobacter sp. SK209-2-6]
          Length = 268

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 126/269 (46%), Positives = 168/269 (62%), Gaps = 10/269 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I+AR   L  W+ E  PD++ LQE K+ D+ FP E  +   Y++ET GQK
Sbjct: 1   MKIASFNINGIKARAAALPQWLDEAQPDVVLLQEIKSVDEAFPRELFEERGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           S+NGVAILSK    +I   LPGDD D QAR+IEAT  +  Q LRI  LYLP+GNP+    
Sbjct: 61  SFNGVAILSKLPLEDIRRGLPGDDSDEQARWIEAT-VVGKQALRICGLYLPNGNPVELEV 119

Query: 123 --------KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDAC 174
                   KY  K++W++R  + A   L  E P + AGDYNIIPQ  D   P  W  DA 
Sbjct: 120 DGSPVAGGKYAYKLAWMERLHKRAQDLLAEETPALMAGDYNIIPQAEDAKRPEAWREDAL 179

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
              E R ++Q++ N+GFT+A RA H     YSFWDY A +W+++ GIRIDH +LSP+A  
Sbjct: 180 HRPESRAAYQQIVNLGFTEAFRARHQGPGHYSFWDYQAGAWNRDDGIRIDHFLLSPQAAD 239

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           LL   +ID + RG  KPSDH P+ V LD+
Sbjct: 240 LLRDCQIDKEIRGREKPSDHVPIWVDLDL 268


>gi|315498514|ref|YP_004087318.1| exodeoxyribonuclease iii xth [Asticcacaulis excentricus CB 48]
 gi|315416526|gb|ADU13167.1| exodeoxyribonuclease III Xth [Asticcacaulis excentricus CB 48]
          Length = 263

 Score =  220 bits (559), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 113/264 (42%), Positives = 159/264 (60%), Gaps = 5/264 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + T+NVNS+ AR+  +  W +E  PD+  LQE K  D+ FP+E  + L Y+    GQK
Sbjct: 1   MKIFTYNVNSVNARLPLILEWFEETQPDVCALQELKCLDEKFPYEPFERLGYNAAVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVA+LSK   I++V  LPG+  D Q+R+IEA     +  +R+ ++YLP+GNPI + K
Sbjct: 61  TWNGVALLSKQPLIDVVRGLPGEPEDEQSRYIEAVVDG-SVPVRVTSIYLPNGNPIGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K  W KR    A + L  EE  + +GD+N IP   D Y    W +DA +  E R ++
Sbjct: 120 YPYKHRWYKRLQARAKEILAFEEISVLSGDFNTIPTKSDLYRESAWLDDALYQPETRAAY 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L+N+G++DA        + Y+FWDY A +W KN+GIRIDH +LSP+A   L S  I  
Sbjct: 180 QSLKNLGYSDACDLMPPEGNRYTFWDYQAGAWQKNEGIRIDHHLLSPQAADRLKSFEIHK 239

Query: 244 KPRGWT----KPSDHTPVIVSLDI 263
             RG T    KPSDH PV V LD+
Sbjct: 240 DARGRTHDDAKPSDHVPVGVELDV 263


>gi|255262040|ref|ZP_05341382.1| exodeoxyribonuclease III [Thalassiobium sp. R2A62]
 gi|255104375|gb|EET47049.1| exodeoxyribonuclease III [Thalassiobium sp. R2A62]
          Length = 259

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 122/258 (47%), Positives = 169/258 (65%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI+ L  W+ E  PD+  LQE K+ D+NFP E  +   Y++E+ GQK
Sbjct: 1   MKIATFNINGIKARINALPDWLDEAQPDVAILQEIKSVDENFPRELFEERGYNVESHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVA+LSK    ++   LPGDD D QAR+IEAT  +  Q +R+  LYLP+GNP+   K
Sbjct: 61  SFNGVAMLSKLPLEDVQRGLPGDDEDEQARWIEAT-VVGEQAVRLCGLYLPNGNPVPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y+ K+SW++R L  A   L  E+  +  GD+NIIPQ  D  NP +W  DA F  E R ++
Sbjct: 120 YEYKLSWMERLLTRAKDLLAEEQLALITGDFNIIPQAEDAANPQVWREDALFRPESRAAW 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+G+T+A RA       YSFWDY A +W+KN GIRIDH +L+P+   LL   +ID 
Sbjct: 180 RRIVNLGYTEAFRARTHGPGHYSFWDYQAGAWNKNDGIRIDHFLLTPQCADLLRECKIDA 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + RG  KPSDH PV V L
Sbjct: 240 EIRGREKPSDHVPVWVEL 257


>gi|239814644|ref|YP_002943554.1| exodeoxyribonuclease III Xth [Variovorax paradoxus S110]
 gi|239801221|gb|ACS18288.1| exodeoxyribonuclease III Xth [Variovorax paradoxus S110]
          Length = 261

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 90/259 (34%), Positives = 135/259 (52%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+ AR+ ++  W+  N  D++CLQE K  D  FP + L+S  Y     GQK
Sbjct: 1   MKIATWNVNSLTARLQHVLDWLIANPVDVLCLQELKMSDDKFPLDVLKSAGYEAAVFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS     ++  ++ G   D       AT       LRI N Y  +G    + K
Sbjct: 61  TYNGVAILSLAPMRDVARNIGGFTDDQSRVI-AATVETPAGPLRIVNGYFVNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           ++ K+ W++    +    +     L+  GD+NI P+  D ++P+        T E R+ F
Sbjct: 120 FEYKMGWLRALREWLRAEMAAHPNLVLLGDFNIAPEDRDSFDPVGLAETIHHTTEEREHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L  +G  D+ R        +S+WDY    + KN+G+RIDHI++S      +    ID 
Sbjct: 180 KALLQLGLVDSFRLFEQPEKSFSWWDYRMLGYQKNRGLRIDHILVSEPLVPRVKGCIIDR 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR W KPSDH PV++ LD
Sbjct: 240 VPRKWEKPSDHAPVVLDLD 258


>gi|255035926|ref|YP_003086547.1| exodeoxyribonuclease III Xth [Dyadobacter fermentans DSM 18053]
 gi|254948682|gb|ACT93382.1| exodeoxyribonuclease III Xth [Dyadobacter fermentans DSM 18053]
          Length = 260

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 98/262 (37%), Positives = 143/262 (54%), Gaps = 3/262 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M+ + +AT+NVN +  R+  L  W+ E  PD++CLQE K   + FP + +    Y     
Sbjct: 1   MNAMRIATYNVNGVNGRLPVLLRWLTETTPDVVCLQELKAPQEKFPEQAILEAGYKAIWH 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQKS+NGVAILS+     I   +                      L +G LYLP+GNP  
Sbjct: 61  GQKSWNGVAILSRGD---IPAEIRRVLPGDPEDAHSRYIEAEIGGLTVGGLYLPNGNPAP 117

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             K+D K+ W  R +  A   L   +P++  GD+N++P   D Y P  W +DA F  E R
Sbjct: 118 GPKFDYKLRWFDRLITHAQGLLAAGKPVLLTGDFNVMPTELDVYKPESWVDDALFRPETR 177

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +F KL + G+TDAIR  +    +Y+FWDY+ +++++N G+RIDH +LSP     L +A 
Sbjct: 178 AAFAKLMDQGWTDAIRTLYPDEKIYTFWDYFRNAFARNAGLRIDHFLLSPNLAPRLIAAG 237

Query: 241 IDTKPRGWTKPSDHTPVIVSLD 262
           +D + RGW K SDH PV + L 
Sbjct: 238 VDKQVRGWEKTSDHAPVWIELK 259


>gi|317969204|ref|ZP_07970594.1| exodeoxyribonuclease III [Synechococcus sp. CB0205]
          Length = 273

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 89/271 (32%), Positives = 140/271 (51%), Gaps = 1/271 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+R R+  + AW++ + PD++CLQETK  D  FP +  + + YH    GQK
Sbjct: 1   MRIASWNVNSVRTRLDQVLAWLQTHEPDVLCLQETKVSDDLFPLQAFEQIGYHCAISGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQA-RFIEATFTINTQTLRIGNLYLPHGNPITST 122
           +YNGVA++S+    ++         D       +   +     +RI NLY+P+G+ + S 
Sbjct: 61  AYNGVALISREPLEDVQVGFDALLPDAGPLSEQKRVISGMLDGVRILNLYVPNGSSLKSE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K+ W+    R+ + + E  +PL   GD+NI  +  D  +P         +   R +
Sbjct: 121 KYHYKLEWLACLQRYLAVQEEQGDPLCMVGDFNIGLEDRDLPDPQRLSGTIMASDPERSA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
            +       TD  R        +S+WDY + +W ++ G RIDHI LS E         ID
Sbjct: 181 LRAALADRLTDVFRVFEPGSGHWSWWDYRSGAWDRDLGWRIDHIYLSEELLGCATGCVID 240

Query: 243 TKPRGWTKPSDHTPVIVSLDIPEPRKKQQDS 273
            +PRG  +PSDH PV+V+L  P    + +DS
Sbjct: 241 KQPRGNVQPSDHAPVVVNLAWPPEEDEDEDS 271


>gi|119383680|ref|YP_914736.1| exodeoxyribonuclease III Xth [Paracoccus denitrificans PD1222]
 gi|119373447|gb|ABL69040.1| Exodeoxyribonuclease III [Paracoccus denitrificans PD1222]
          Length = 261

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 118/261 (45%), Positives = 162/261 (62%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N +RARI  L  W+ E  PD++ LQE K +D+ FP E +  L Y+IET GQK
Sbjct: 1   MKIATFNINGVRARIETLTGWLSEAQPDVVVLQEIKAQDEGFPREPIADLGYNIETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    ++   LPGD+ D QAR+IEAT  +  + +RI  LYLP+GNP    K
Sbjct: 61  GFNGVAILSKLPLEDVSRGLPGDETDEQARYIEAT-VVGHRAVRIAGLYLPNGNPQPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W++R    A   L  E P+   GDYN+IP+  D   P  W +DA F  E R + 
Sbjct: 120 FDYKLAWMERLRARAKALLATEMPVAMMGDYNVIPESRDAAFPEKWLDDALFQPESRAAL 179

Query: 184 QKLQNMGFTDAIRATHD--THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +++   G+ DA+R  H   T   ++FWDY A +W ++ GIRIDH++LSP+A  LL    I
Sbjct: 180 RRILFDGWADAVRLRHPGSTRGPFTFWDYQAGAWQRDNGIRIDHVLLSPQAADLLIDVGI 239

Query: 242 DTKPRGWTKPSDHTPVIVSLD 262
           D   R   KPSDH PV V LD
Sbjct: 240 DRDERAKDKPSDHVPVWVDLD 260


>gi|84684871|ref|ZP_01012771.1| exodeoxyribonuclease III [Maritimibacter alkaliphilus HTCC2654]
 gi|84667206|gb|EAQ13676.1| exodeoxyribonuclease III [Rhodobacterales bacterium HTCC2654]
          Length = 267

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 115/265 (43%), Positives = 167/265 (63%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I+AR+  +  W+ E  PD++  QE K+ D+NFP E  + + Y++ET GQK
Sbjct: 1   MKIASYNINGIKARLPAVTDWLTEAQPDVVIFQEIKSVDENFPREHFEDMGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDD-------LDVQARFIEATFTINTQTLRIGNLYLPHG 116
           S+NGVAILSK    ++   LPG +        D QAR+IEAT   +   +RI  LYLP+G
Sbjct: 61  SFNGVAILSKRPLEDVTRGLPGAEGTGRDGEDDEQARYIEATVLGDRNAVRICGLYLPNG 120

Query: 117 NPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           NP+   K+  K+ W++R  + A + L LE+P + AGDYN+IPQ  D  +P  W +DA F 
Sbjct: 121 NPVGDEKFAYKLRWMERLEKRAKELLALEQPFLMAGDYNVIPQGIDALHPENWRDDALFQ 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
            E R +F +LQN+G T+A RA +     ++FWD+   +W +N GIRIDH +LSP+   LL
Sbjct: 181 PESRGAFWRLQNLGLTEAFRARNQAAEQFTFWDFQRGAWQRNDGIRIDHFLLSPQCADLL 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
              +ID + RG  KPSDH P+ V L
Sbjct: 241 EDCQIDKEVRGRDKPSDHVPIWVEL 265


>gi|222148978|ref|YP_002549935.1| exonuclease III [Agrobacterium vitis S4]
 gi|221735964|gb|ACM36927.1| exonuclease III [Agrobacterium vitis S4]
          Length = 264

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 139/256 (54%), Positives = 183/256 (71%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++AR+ NL  W++ ++PDI+CLQE K+ D+ FP   +++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARLANLCQWLESSSPDIVCLQEIKSVDEGFPRAEIEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNP-ITST 122
            +NGVA+LSK +P E+   LPGD+ D QARFIE  F++    LR+ +LYLP+GNP     
Sbjct: 61  GFNGVALLSKIRPDEVNRGLPGDEADEQARFIEGVFSVADGVLRVCSLYLPNGNPSDDPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W+ R  RFA+ RL LEEPLI AGDYN+IP PHDC++P +W  DA F  + R +
Sbjct: 121 KYPYKLAWMARLQRFAADRLALEEPLILAGDYNVIPHPHDCFDPAVWATDALFLPQTRAA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           FQ L+N+G TDA+RAT D   LYSFWDY A +W KN GIRIDH++LS EAT  L S  I+
Sbjct: 181 FQALENLGLTDAVRATTDATKLYSFWDYQAGAWQKNNGIRIDHLLLSAEATDRLVSTEIE 240

Query: 243 TKPRGWTKPSDHTPVI 258
              R W KPSDH PVI
Sbjct: 241 KHVRSWEKPSDHVPVI 256


>gi|257092446|ref|YP_003166087.1| exodeoxyribonuclease III Xth [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257044970|gb|ACV34158.1| exodeoxyribonuclease III Xth [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 255

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 91/258 (35%), Positives = 137/258 (53%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS++ R+  L  W+    PDI+CLQETK ED  FP + +++  YH+   GQK
Sbjct: 1   MKIASWNVNSLKVRLPQLLDWLAAEQPDIVCLQETKLEDHAFPQQEVEAAGYHVAFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+L++  P ++V   P      +         I      +   Y+P+G  + S K
Sbjct: 61  TYNGVALLARESPSDVVCGNPLHADQQKRLVAATIGGIC-----VVCAYVPNGQAVGSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+    R+   RL     L+ AGD+NI P+  D YNP  W      +   R +F
Sbjct: 116 YAYKLAWLDALTRWLKGRLAANPRLVVAGDFNIAPEDRDVYNPAAWAGQILCSAPERAAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q+L ++G  D+ R        +S+WDY    + KN+G+RIDHI+LS     +   A I+ 
Sbjct: 176 QRLLDLGLKDSFRLFEQPEKSFSWWDYRMLGFQKNQGLRIDHILLSEPLAGICTVAGINR 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R   +PSDH PV   L
Sbjct: 236 HMRKLERPSDHAPVTAEL 253


>gi|108759762|ref|YP_633331.1| exodeoxyribonuclease III [Myxococcus xanthus DK 1622]
 gi|108463642|gb|ABF88827.1| exodeoxyribonuclease III [Myxococcus xanthus DK 1622]
          Length = 256

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 102/258 (39%), Positives = 149/258 (57%), Gaps = 4/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   L AW+K+  PD++CLQE K  D +FP E ++ L YH    GQK
Sbjct: 1   MKIATWNVNSVRARQERLLAWLKKAQPDVLCLQELKCVDDDFPMEAVRELGYHAAVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL+K +P ++V  L     D  AR I AT       +R+ + Y P+G  + S +
Sbjct: 61  TYNGVAILAKEEPKDVVKGLSDGVDDSHARLIAATVGG----IRVVSAYAPNGQSVDSPQ 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W  R  R+   R + +EPL+  GD+N+ P+  D Y+P +WE    FTL+ R + 
Sbjct: 117 YQYKLEWYGRLRRYLDTRHKPDEPLVLGGDWNVAPEDIDTYDPKLWEGQTLFTLKERDAL 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q+L   G +DA R  H     +++WDY    + KN G+RIDH+ ++      L    +D 
Sbjct: 177 QRLGAFGLSDAFRRLHPGVQKFTWWDYRMLGFPKNLGLRIDHLYVTAPVAERLTVVDVDR 236

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + R   +PSDH PV + L
Sbjct: 237 EERKGKQPSDHAPVWLEL 254


>gi|292490590|ref|YP_003526029.1| exodeoxyribonuclease III Xth [Nitrosococcus halophilus Nc4]
 gi|291579185|gb|ADE13642.1| exodeoxyribonuclease III Xth [Nitrosococcus halophilus Nc4]
          Length = 257

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 92/261 (35%), Positives = 142/261 (54%), Gaps = 5/261 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  + +ATWNVNS+R R+  +  W++ + PDI+ LQETK  D  FP E    + Y     
Sbjct: 1   MPKLKIATWNVNSLRVRLPQVMDWLEAHQPDILALQETKLSDGEFPQEAFGDMGYRAAYS 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQK+YNGVAIL + +P +I+T LP  +   +         I+   +R+ NLY+P+G+ + 
Sbjct: 61  GQKTYNGVAILCRQEPQDIMTDLPNLEDPQRRIL-----GISLGDIRLLNLYVPNGSEVG 115

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           S KY  K+ W+ R   +  + L     LI  GD+N+ P   D +NP IW      +   R
Sbjct: 116 SEKYAYKLDWLARVKDYLQEALAEYPKLIVLGDFNVAPGDGDVHNPEIWHETILCSTPER 175

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           ++  ++ ++GF D+ R        +S+WDY   ++ +N G+RID I++S E         
Sbjct: 176 EALGEILDLGFQDSFRLFEQEGQSFSWWDYRGGAFRRNWGLRIDLILISKELVPKCTECV 235

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           ID +PR   +PSDH PVI + 
Sbjct: 236 IDKEPRRLKRPSDHAPVIATF 256


>gi|220923190|ref|YP_002498492.1| exodeoxyribonuclease III Xth [Methylobacterium nodulans ORS 2060]
 gi|219947797|gb|ACL58189.1| exodeoxyribonuclease III Xth [Methylobacterium nodulans ORS 2060]
          Length = 263

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 126/262 (48%), Positives = 174/262 (66%), Gaps = 2/262 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS++ R+ +L A++KE +PD++CLQE K  D+ FP   ++   Y + T GQK
Sbjct: 1   MRITTWNVNSVKQRLGHLLAFLKEASPDVVCLQELKCVDEAFPRTEIEEAGYVVATHGQK 60

Query: 64  SYNGVAILSKYQP--IEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           ++NGVA+L++      ++   LPGD  D QAR+IEA     T TLR+ ++YLP+GNPI +
Sbjct: 61  AFNGVALLTRQPLPLRDVRRGLPGDPEDGQARYIEAVIPTATATLRVASIYLPNGNPIGT 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KYD K+++++R L  A    E EE L+ AGDYN+IP+P D  NP  W  DA F  E R 
Sbjct: 121 PKYDYKLAFLRRLLLHARALREKEEVLVLAGDYNVIPEPIDVANPEAWTGDALFLPESRA 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +F+ L N GFTDA+RA  +   LY+FWDY A +WS+N GIRIDH++LSP+A   L SA +
Sbjct: 181 AFRMLLNEGFTDALRACDERPGLYTFWDYQAGAWSRNLGIRIDHLLLSPQALDRLVSASV 240

Query: 242 DTKPRGWTKPSDHTPVIVSLDI 263
               RG  KPSDH PV V LD+
Sbjct: 241 QKHLRGLDKPSDHVPVTVELDL 262


>gi|123968077|ref|YP_001008935.1| exodeoxyribonuclease III [Prochlorococcus marinus str. AS9601]
 gi|123198187|gb|ABM69828.1| exodeoxyribonuclease III [Prochlorococcus marinus str. AS9601]
          Length = 281

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 97/266 (36%), Positives = 148/266 (55%), Gaps = 4/266 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  +  WI ++NPDI+CLQETK  D NFP E  + L Y +E  GQK
Sbjct: 1   MLIATWNVNSIRTRLSQILDWINKSNPDILCLQETKVVDDNFPIEAFEKLGYSVEIYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT----INTQTLRIGNLYLPHGNPI 119
           SYNGVAI+SK +P  +     G +   Q   I          +   ++I N+Y+P+G+ +
Sbjct: 61  SYNGVAIISKIKPENVKKGFYGCNDTNQNIEIFLDQKRLISADINGIKIINVYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S+K++ KI+W+     F   + +    +   GD+N+ P   D ++P  +E     +   
Sbjct: 121 DSSKFEYKINWLNCLASFLDDQEKKGALICLMGDFNVAPSNLDIHDPKKYEGGIMASEIE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R +   +      D+ R        +S+WDY  +++  NKG RIDHI +S E +S L S 
Sbjct: 181 RSALNNVLKKRLIDSFRIYEQNTGHWSWWDYRNNAFELNKGWRIDHIYISKELSSKLKSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPE 265
            ID+ PRG  +PSDH PV++ L++ E
Sbjct: 241 VIDSCPRGNLRPSDHAPVMIDLNLNE 266


>gi|114771793|ref|ZP_01449186.1| exodeoxyribonuclease III [alpha proteobacterium HTCC2255]
 gi|114547609|gb|EAU50500.1| exodeoxyribonuclease III [alpha proteobacterium HTCC2255]
          Length = 260

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 122/260 (46%), Positives = 168/260 (64%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR+  L  W+ E  PDI  LQE K+ D+ FP E +++L Y I + G K
Sbjct: 1   MKIATFNINGIKARLPALLDWLSETMPDIAMLQEIKSVDELFPREEIEALGYQIHSHGMK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSKY   +I+  LPGD  D+Q R+IEAT   N   LR+ NLYLP+GNP    K
Sbjct: 61  GFNGVAILSKYPLEDIMRGLPGDSDDIQTRYIEATVITNKGPLRLCNLYLPNGNPTPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K+ W+KR        ++LEEP + AGD+NIIPQ  DC++  +WE+DA +  E R ++
Sbjct: 121 FDYKLKWMKRLYERTCALIKLEEPFLLAGDFNIIPQAEDCWDTKVWESDAAYLPESRAAY 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +K+ N+G TDA R  + +   Y+FWDY A +W+KN GIRIDH +LS     +L   + D 
Sbjct: 181 RKILNLGLTDAFRVKNKSAMNYTFWDYQAGAWNKNNGIRIDHFLLSSSCADILIDCQSDR 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   KPSDH PV V LDI
Sbjct: 241 ECRARDKPSDHVPVWVELDI 260


>gi|302383762|ref|YP_003819585.1| exodeoxyribonuclease III Xth [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194390|gb|ADL01962.1| exodeoxyribonuclease III Xth [Brevundimonas subvibrioides ATCC
           15264]
          Length = 264

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 107/262 (40%), Positives = 148/262 (56%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+ AR+  +  W++   PD++C QE KT D  FP E  +SL Y++E  GQK
Sbjct: 1   MRIATWNVNSVNARLPTVLQWLEAAVPDVVCFQEIKTVDDKFPREAFESLGYNVEVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN----TQTLRIGNLYLPHGNPI 119
           SYNGVA+LSKY   ++   LPG DL  +    +A +        + +R+G LYLP+GNPI
Sbjct: 61  SYNGVALLSKYPVSDVRRGLPGSDLLAEGEDDQARYIEALIEAPRPIRVGGLYLPNGNPI 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            + K+D K+ W+ R    A   L  EE     GDYN+IP P D   P  W  DA F  E 
Sbjct: 121 GTGKFDYKLRWMGRLNAHARDLLANEEAFTLCGDYNVIPTPDDAKTPSAWVTDALFQPES 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R +F+ L+ +G  +A    +     Y+FWDY A +W ++ GIRID  +LSP+A       
Sbjct: 181 RAAFRALKGLGLYEAGELGNQPPGTYTFWDYQAGAWQRDHGIRIDFHLLSPQAADRFVGV 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
                 R   KPSDH PV++ L
Sbjct: 241 ETHRDARDMDKPSDHVPVVIEL 262


>gi|89068210|ref|ZP_01155620.1| exodeoxyribonuclease III [Oceanicola granulosus HTCC2516]
 gi|89046127|gb|EAR52185.1| exodeoxyribonuclease III [Oceanicola granulosus HTCC2516]
          Length = 264

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 123/260 (47%), Positives = 170/260 (65%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
             + +AT+N+N I+AR  +L AW+ E +PD++ LQE K+ D+NFP E  +   Y++ T G
Sbjct: 3   RSMKIATFNINGIKARHQSLLAWLDEADPDVVLLQEIKSIDENFPSELFEEKGYNVATHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK +NGVAILSK    ++   LPGDD D  AR+IEAT       +R+  LYLP+GNP   
Sbjct: 63  QKGFNGVAILSKLPLEDVSRGLPGDDTDEHARWIEATVVGEHAAIRLCGLYLPNGNPAPG 122

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KYD K++W++R    A++ +E EEP I AGDYN+IPQP D   P  W  DA F  + R+
Sbjct: 123 PKYDYKLAWMERLHARAAELMEAEEPAIMAGDYNVIPQPEDAARPKAWVKDALFLPQTRR 182

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           ++++L N+GFT+A RA       YSFWDY A +W KN GIRIDH++++P+A  L+    I
Sbjct: 183 AWRRLLNLGFTEAFRAKTLAAGHYSFWDYQAGAWQKNDGIRIDHVLMTPQAADLMRDVWI 242

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D+  RG  KPSDH PV+V L
Sbjct: 243 DSAVRGRDKPSDHVPVVVDL 262


>gi|29828508|ref|NP_823142.1| exonuclease [Streptomyces avermitilis MA-4680]
 gi|29605612|dbj|BAC69677.1| putative exonuclease [Streptomyces avermitilis MA-4680]
          Length = 262

 Score =  218 bits (555), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 78/262 (29%), Positives = 128/262 (48%), Gaps = 1/262 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++C+QETKT  + FP + L+ L Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCIQETKTTAEQFPADALRELGYESAVHATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA++S+    ++V  LPGD      +   A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVISRVGLEDVVRGLPGDPGFDGVQEPRALSATCGP-VRVWSVYVPNGREVEHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +      +       P    GD+N+ P   D Y+   +E     T   R + 
Sbjct: 120 YAYKLQWFEALKAAVAGDAAGSRPFAVMGDFNVAPTDDDVYDVAAFEGLTHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +       H Y++WDY    + KN+G+RID +  +      +  A +D 
Sbjct: 180 ATLREAGLSDVVPRPLKYEHPYTYWDYRQLCFPKNRGMRIDLVYGNEPFAKAVKDAYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDIPE 265
           + R     SDH PV+V LD+ +
Sbjct: 240 EERKGKGASDHAPVVVDLDVQD 261


>gi|296135895|ref|YP_003643137.1| exodeoxyribonuclease III Xth [Thiomonas intermedia K12]
 gi|295796017|gb|ADG30807.1| exodeoxyribonuclease III Xth [Thiomonas intermedia K12]
          Length = 253

 Score =  218 bits (555), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 88/256 (34%), Positives = 132/256 (51%), Gaps = 5/256 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W++  +PD++ LQETK  D+ FP   L +  YH    GQ 
Sbjct: 1   MKIATWNVNSLSVRLPQVLDWLQAQSPDVLALQETKLTDERFPHAELLNAGYHSVCLGQP 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LS+ +  E+   +PG +                  LR+   Y P+G    S K
Sbjct: 61  TYNGVALLSRREAAEVQRGIPGFEDAQARVIAATFGD-----LRVIGAYFPNGQAPDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     + +  L+    +   GD+NI P+  D ++P+ W      T E R  F
Sbjct: 116 FAYKMRWLDALQAWVATELQRHAKVALMGDFNIAPEDRDVFDPVAWAGQIHCTPEERGHF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L  +G  DA RA       +S+WDY   ++ KN+G+RIDHI++S      L S  ID 
Sbjct: 176 KALLGLGLIDAFRAFDQPPKSWSWWDYRNLAFRKNQGLRIDHILVSEGLRGSLQSCVIDK 235

Query: 244 KPRGWTKPSDHTPVIV 259
            PR   +PSDH PVI 
Sbjct: 236 APRKNERPSDHAPVIA 251


>gi|148550719|ref|YP_001260158.1| exodeoxyribonuclease III Xth [Sphingomonas wittichii RW1]
 gi|148503138|gb|ABQ71391.1| exodeoxyribonuclease III Xth [Sphingomonas wittichii RW1]
          Length = 269

 Score =  218 bits (555), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 99/271 (36%), Positives = 150/271 (55%), Gaps = 4/271 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN +  R+  L  W++E  PD++ LQE K   + FP   ++ L Y +   GQK
Sbjct: 1   MKIATYNVNGVNGRLPVLLRWLEEAQPDVVVLQELKAPQEKFPESAIRDLGYDVIWHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVA+LS+   I                            + IG LYLP+GNP    K
Sbjct: 61  SWNGVALLSRVGEIHETRRGL---PGDPDPGQSRYIEAAVNGILIGGLYLPNGNPRPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K+ W  R +  A+  LE   P++ AGD+N++P   D Y P  W +DA F  EVR ++
Sbjct: 118 FDYKLRWFDRLIEHAAGLLESGLPVMLAGDFNVMPTDLDVYKPERWLDDALFAPEVRAAY 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L + G+TDA+R  H    +Y+FWDY+ +++ +N G+RIDH++LSP     L  A++D 
Sbjct: 178 FRLLDQGWTDALRTLHPGEVIYTFWDYFRNAYGRNAGLRIDHLLLSPALADRLLDAQVDR 237

Query: 244 KPRGWTKPSDHTPVIVSLDIPEPRKKQQDST 274
             RGW K SDH PV + L   +P++K+    
Sbjct: 238 HVRGWEKTSDHAPVWIELA-DKPKRKRAPKA 267


>gi|86138642|ref|ZP_01057215.1| exodeoxyribonuclease III [Roseobacter sp. MED193]
 gi|85824702|gb|EAQ44904.1| exodeoxyribonuclease III [Roseobacter sp. MED193]
          Length = 268

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 125/269 (46%), Positives = 168/269 (62%), Gaps = 10/269 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I+AR   L  W+ E  PD++ LQE K+ D+ FP E  +   Y++ET GQK
Sbjct: 1   MKIASFNINGIKARAAALPQWLDEAKPDVVVLQEIKSIDEAFPRELFEERGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI---- 119
            +NGVAILSK    ++   LPGD+ D+QAR+IEAT  I  Q LRI  LYLP+GNP+    
Sbjct: 61  GFNGVAILSKLPLEDVSRGLPGDEDDLQARWIEAT-VIGKQALRICGLYLPNGNPVELTD 119

Query: 120 -----TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDAC 174
                   KY  K++W++R    A   LE E P + AGDYNIIPQ  D   P  W  DA 
Sbjct: 120 EGSPVPGGKYAYKLAWMERLHARAQDLLESEMPALMAGDYNIIPQAEDAKRPEAWREDAL 179

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
              E R ++Q++ N+GFT+A RA H     YSFWDY A +W+++ GIRIDH +LSP+A  
Sbjct: 180 HRPESRAAYQRIVNLGFTEAFRARHQGPGHYSFWDYQAGAWNRDDGIRIDHFLLSPQAAD 239

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           LL   +ID + RG  KPSDH P+ V LD+
Sbjct: 240 LLQDCQIDKEIRGRDKPSDHVPIWVDLDL 268


>gi|99080738|ref|YP_612892.1| exodeoxyribonuclease III [Ruegeria sp. TM1040]
 gi|99037018|gb|ABF63630.1| Exodeoxyribonuclease III [Ruegeria sp. TM1040]
          Length = 268

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 119/269 (44%), Positives = 165/269 (61%), Gaps = 10/269 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I+AR++ L  W+ E  PD+  LQE K+ D+ FP E  +   Y++ET GQK
Sbjct: 1   MKIASFNINGIKARVNALTDWLDEAQPDVAVLQEIKSVDEAFPRELFEERGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGD+ D QAR+IEAT  +  Q LRI  LYLP+GNP+    
Sbjct: 61  SFNGVAILSKLPLEDVRRGLPGDESDEQARWIEAT-VVGKQALRICGLYLPNGNPVELND 119

Query: 124 ---------YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDAC 174
                    Y  K+ W++R    A++ +  E P + AGDYNIIPQ  D   P  W  DA 
Sbjct: 120 DGTPVEGGKYAYKLGWMERLKARAAELMAEEMPALMAGDYNIIPQAEDAKRPEAWREDAL 179

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
              E R +FQ++ N+GFT+A R        Y+FWDY A +W+++ GIRIDH +L+P+A  
Sbjct: 180 HRPESRAAFQRIVNLGFTEAFRTRTRGPGHYTFWDYQAGAWNRDDGIRIDHFLLTPQAAD 239

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           LL   +ID   RG  KPSDH P+ V LD+
Sbjct: 240 LLRDCQIDKDIRGREKPSDHVPIWVDLDL 268


>gi|294340117|emb|CAZ88488.1| putative exodeoxyribonuclease III [Thiomonas sp. 3As]
          Length = 253

 Score =  218 bits (554), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 88/256 (34%), Positives = 131/256 (51%), Gaps = 5/256 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W++  +PD++ LQETK  D  FP   L +  YH    GQ 
Sbjct: 1   MKIATWNVNSLSVRLPQVLDWLQAQSPDVLALQETKLTDDRFPHAELLNAGYHSVCLGQP 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LS+ +  E+   +PG +                  LR+   Y P+G    S K
Sbjct: 61  TYNGVALLSRREAAEVQRGIPGFEDAQARVIAATFGD-----LRVIGAYFPNGQAPDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     + +  L+    +   GD+NI P+  D ++P+ W      T E R  F
Sbjct: 116 FAYKMRWLDALQAWVAAELQRYAKVALMGDFNIAPEDRDVFDPVAWAGQIHCTPEERGHF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L  +G  DA RA       +S+WDY   ++ KN+G+RIDHI++S      L S  ID 
Sbjct: 176 KALLGLGLIDAFRAFDQPPKSWSWWDYRNLAFRKNQGLRIDHILVSEGLRDSLQSCVIDK 235

Query: 244 KPRGWTKPSDHTPVIV 259
            PR   +PSDH PVI 
Sbjct: 236 APRKNERPSDHAPVIA 251


>gi|300022777|ref|YP_003755388.1| exodeoxyribonuclease III [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524598|gb|ADJ23067.1| exodeoxyribonuclease III [Hyphomicrobium denitrificans ATCC 51888]
          Length = 260

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 117/258 (45%), Positives = 167/258 (64%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++AR+ +   ++++ +PD+IC QE K+ D  FP    Q + Y++ T GQK
Sbjct: 1   MILATWNINGVKARLESALTYLRQQSPDVICFQEIKSVDDGFPTSAFQDIGYNVATNGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    ++V  LPGDD D  AR+IEA+  +  + +R+ +LYLP+GNPI + K
Sbjct: 61  GFNGVAILSKSPLEDVVRGLPGDDADQHARWIEASVPLGDRMVRVVSLYLPNGNPIGTEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W+ R    A Q  + E PL+ AGD+N+IP+  D   P  W NDA F  E R ++
Sbjct: 121 FSYKLAWMARMRLRAKQLQQDEMPLVLAGDFNVIPESVDAKRPAAWVNDALFQPESRAAW 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L N GFTDA RA H    +Y+FWDY A ++ K+ GIRIDHI+LS +A  LL ++ ID 
Sbjct: 181 RTLVNEGFTDATRACHPGPGVYTFWDYQAGAFQKDDGIRIDHILLSSQAADLLVASGIDR 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R   KPSDH PV V L
Sbjct: 241 ATRAQEKPSDHVPVWVKL 258


>gi|296446338|ref|ZP_06888283.1| exodeoxyribonuclease III Xth [Methylosinus trichosporium OB3b]
 gi|296256111|gb|EFH03193.1| exodeoxyribonuclease III Xth [Methylosinus trichosporium OB3b]
          Length = 258

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 124/259 (47%), Positives = 174/259 (67%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+  L A+++E  PD++CLQE K ED  FP   ++ L Y++ET GQK
Sbjct: 1   MRIATWNVNSVRQRLEQLTAYLREVAPDVLCLQEIKCEDAAFPRLEIEELGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVAILSK   IE+V  LP  + D QAR+IEA  + +   LR+ ++YLP+GNP  + K
Sbjct: 61  TFNGVAILSKTP-IEVVRGLPKFEHDPQARYIEAVVSTDRGALRVASIYLPNGNPPETEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++++   +  A+  L LEEP++ AGDYN+IP   D ++P  W  DA F  + R  F
Sbjct: 120 YAYKLAFMDCLIAHAASLLALEEPVVLAGDYNVIPAARDVHDPAAWAGDALFLPQTRAKF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q+L N+G+T+A+RAT D   LY+FWDY A +W +NKGIRIDH++LSP+A   L S  ID 
Sbjct: 180 QELTNLGYTEALRATTDAAGLYTFWDYQAGAWQRNKGIRIDHLLLSPQAADRLQSVTIDK 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             R   KPSDH P+   L+
Sbjct: 240 NLRAGAKPSDHVPIRCELE 258


>gi|319948313|ref|ZP_08022460.1| exodeoxyribonuclease III [Dietzia cinnamea P4]
 gi|319438033|gb|EFV93006.1| exodeoxyribonuclease III [Dietzia cinnamea P4]
          Length = 266

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 77/266 (28%), Positives = 128/266 (48%), Gaps = 7/266 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIRAR   + AW+  ++ D++ +QETK +D+ FP E  + L Y +   G  
Sbjct: 1   MRLATWNVNSIRARKDRVLAWLDRSDVDVLAMQETKCKDEQFPEEDFRELGYEVAHHGLS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPHGNP 118
            +NGVA+ S+    ++     G     +                   +R+ +LY+P+G  
Sbjct: 61  QWNGVAVASRVGLEDVRLGFDGMPGFHKDPEQSQDPEARAISAVCDGVRVYSLYVPNGRE 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRL--ELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           ++   Y  K+ W+ R    A+  L  + +  +   GD+N+ P   D ++  ++E     +
Sbjct: 121 LSDPHYTYKLEWLARLRDHAAAELVADPDAQVALVGDWNVAPLDEDVWDMEVFEGKTHVS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R +       GF +  R       +Y++WDY   S+ K KG+RID  + SP   + +
Sbjct: 181 GPERLAVAAFDGAGFREVTREYTPGPGVYTYWDYTGLSFPKRKGMRIDFQLHSPALAARV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSLD 262
             A ID + R     SDH PV+V LD
Sbjct: 241 TGAFIDREERKGKGASDHAPVVVELD 266


>gi|238063778|ref|ZP_04608487.1| exodeoxyribonuclease III Xth [Micromonospora sp. ATCC 39149]
 gi|237885589|gb|EEP74417.1| exodeoxyribonuclease III Xth [Micromonospora sp. ATCC 39149]
          Length = 271

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 80/260 (30%), Positives = 129/260 (49%), Gaps = 2/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++AR+  L  W+    PD++CLQETK  D  FP   +  L Y + +    
Sbjct: 7   MRLATWNVNSVKARLPRLLDWLATTGPDVVCLQETKCPDGAFPVAEVGELGYTVASHSDG 66

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILS+    ++    PG+    +      + T     LR+ ++Y+P+G       
Sbjct: 67  RWNGVAILSRAGLADVTVGFPGEPGFPEPEARAISATCAG--LRVWSVYVPNGRAPGDPH 124

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W         Q L    PL   GD+N+ P   D ++P ++      T   R + 
Sbjct: 125 YAYKLAWFAALRDALEQELTGGLPLAVCGDFNVAPTDADVWDPALFATSTHVTPAERDAL 184

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+++  +D +       H Y++WDY A  + +NKG+RID +  S      + +A +D 
Sbjct: 185 AALRDLELSDVVPTPMKGPHPYTYWDYRAGMFHQNKGMRIDLVYASAPFARAVRAAYVDR 244

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R    PSDH PV+V  D+
Sbjct: 245 EARKGKAPSDHAPVVVDADL 264


>gi|115375620|ref|ZP_01462877.1| exodeoxyribonuclease III [Stigmatella aurantiaca DW4/3-1]
 gi|115367396|gb|EAU66374.1| exodeoxyribonuclease III [Stigmatella aurantiaca DW4/3-1]
          Length = 263

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 103/259 (39%), Positives = 146/259 (56%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+RAR   L  W+K + PD++CLQE K  D +FP E ++   YH  T GQK
Sbjct: 7   MKIASWNVNSVRARQERLLNWLKAHQPDVLCLQELKCVDADFPTEAVREAGYHAVTHGQK 66

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILSK +P ++V  L     D  AR I AT +     +R+ + Y+P+G  + S  
Sbjct: 67  TYNGVAILSKAEPSDVVLGLSDGVEDSHARLIAATVSG----VRVVSAYVPNGQAVDSPA 122

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W  R  R+   R   ++PL+  GD+N+ P+P D Y+P +WE    FTL+ R + 
Sbjct: 123 YVYKLEWYSRLRRYLEARHTPDQPLVLCGDWNVAPEPIDVYDPAVWEGQTLFTLKERDAL 182

Query: 184 QKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           Q++   G  D  R  H      +S+WDY   S+ KN G+RIDHI  +      L  A ID
Sbjct: 183 QQVCAFGLADTFRKLHPGVEKKFSWWDYRGLSFPKNLGVRIDHIFATAPLVQRLVKAEID 242

Query: 243 TKPRGWTKPSDHTPVIVSL 261
            + R   +PSDH PV    
Sbjct: 243 REERKGKQPSDHAPVWAEF 261


>gi|325293099|ref|YP_004278963.1| exodeoxyribonuclease III [Agrobacterium sp. H13-3]
 gi|325060952|gb|ADY64643.1| exodeoxyribonuclease III [Agrobacterium sp. H13-3]
          Length = 265

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 141/255 (55%), Positives = 184/255 (72%), Gaps = 1/255 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+K+++PDI+CLQE K+ D+ FP   L++L YH+ET GQK
Sbjct: 1   MKIATWNINGVKARIENLCQWLKDSSPDIVCLQEIKSVDEGFPRLELEALGYHVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            +NGVA+LSK +P EI   LPGDD D QARFIE  F+++   +R+ +LYLP+GNP     
Sbjct: 61  GFNGVALLSKMKPDEINHGLPGDDADEQARFIEGVFSVDGGAIRVCSLYLPNGNPPDDPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R  RFA  RL LEEPLI AGDYN+IP+P DC++P +W  DA F  + R +
Sbjct: 121 KYPYKLAWMERLRRFAEDRLALEEPLILAGDYNVIPEPFDCHDPRVWAGDALFLPKTRSA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L+N+GFTDA RAT D   LYSFWDY A +W KN GIRIDH+MLS EA   L S  I+
Sbjct: 181 FRRLENLGFTDAARATTDEPGLYSFWDYQAGAWPKNNGIRIDHLMLSAEAADRLESVSIE 240

Query: 243 TKPRGWTKPSDHTPV 257
              R W KPSDH PV
Sbjct: 241 KHVRAWEKPSDHVPV 255


>gi|326386341|ref|ZP_08207964.1| exodeoxyribonuclease III [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209002|gb|EGD59796.1| exodeoxyribonuclease III [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 267

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 102/261 (39%), Positives = 156/261 (59%), Gaps = 5/261 (1%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           S + VA++N+N I+AR+  L  W++E  PDI CLQE KT+D+ FP     ++ Y     G
Sbjct: 7   SSIKVASFNINGIKARLPRLIEWLEETQPDIACLQEIKTQDEGFPAADFAAIGYEAIWHG 66

Query: 62  QKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           QK +NGVAIL++  +P+E+   L G+  D  +R++EA        LR+  +YLP+GNP  
Sbjct: 67  QKGFNGVAILARGERPVEVQRGLAGEPEDEHSRYLEADV----MGLRVVCIYLPNGNPQP 122

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             K+D K+ W++R     +Q    E P +  GDYN+IP+ +D ++     +DA    E R
Sbjct: 123 GPKFDYKLRWMERLKTRMAQIAAEEVPALVIGDYNVIPRDNDIWSTRAMADDALMQPESR 182

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            ++++L + G+TDA+   +    +Y+FWDY A +W ++ G RIDH +LSPE    L +A 
Sbjct: 183 AAYRRLLHAGWTDALGLLNPRGGVYTFWDYQAGAWQRDHGFRIDHALLSPELADRLVAAG 242

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           +D   RG  K SDH PV VS+
Sbjct: 243 VDKTYRGREKASDHAPVWVSI 263


>gi|254460874|ref|ZP_05074290.1| exodeoxyribonuclease III [Rhodobacterales bacterium HTCC2083]
 gi|206677463|gb|EDZ41950.1| exodeoxyribonuclease III [Rhodobacteraceae bacterium HTCC2083]
          Length = 259

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 122/258 (47%), Positives = 163/258 (63%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI  L  W+K+  PD+  LQE K+ D+ FP E  + + Y++ET GQK
Sbjct: 1   MKIATFNINGIKARIAALPEWLKDAQPDVALLQEIKSVDEGFPRELFEDMGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGDD D QAR+IEAT  +  Q +R+  LYLP+GNP    K
Sbjct: 61  SFNGVAILSKLPLEDVRRGLPGDDSDEQARWIEAT-VVGKQAIRVCGLYLPNGNPAPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W+ R    A   L  E P + AGDYNIIPQ  D  +P +W+ DA    E R ++
Sbjct: 120 YDYKLAWMARLQARAEALLAEETPFLMAGDYNIIPQDEDARHPEVWQEDALARPESRAAY 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L N+G T+A RA       YSFWDY A +W+K+ GIRIDH +LSP    +L   +ID 
Sbjct: 180 RRLVNLGLTEAFRARVHGPEHYSFWDYQAGAWNKDDGIRIDHFLLSPAVADILVDCQIDM 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R   KPSDH PV V L
Sbjct: 240 HVRAGEKPSDHVPVWVEL 257


>gi|159044435|ref|YP_001533229.1| putative Exodeoxyribonuclease III [Dinoroseobacter shibae DFL 12]
 gi|157912195|gb|ABV93628.1| putative Exodeoxyribonuclease III [Dinoroseobacter shibae DFL 12]
          Length = 259

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 122/258 (47%), Positives = 163/258 (63%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI+ L  W++E +PD++ LQE K+ D  FP E  + + Y +ET GQK
Sbjct: 1   MQIATFNINGIKARINALPDWLREASPDVVVLQEIKSVDAAFPRELFEDMGYTVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGDD D QAR+IEAT       +R+  LYLP+GNP    K
Sbjct: 61  SFNGVAILSKLPLEDVTRGLPGDDGDEQARWIEATVMG-DVPVRVCGLYLPNGNPAPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W+ R    A++ L  EEP + AGDYNIIP   D   P  W  DA      R +F
Sbjct: 120 YDYKLAWMARLKTRAAELLAAEEPALMAGDYNIIPLDEDAARPEAWRKDALALPASRAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFTDA R        YSFWDY A +W +N GIRIDHI+++P+   L+   RID 
Sbjct: 180 REILNLGFTDAFRTRVPGPGHYSFWDYQAGAWQRNDGIRIDHILMTPDCADLMRDCRIDA 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RG  KPSDH PV+V L
Sbjct: 240 AVRGGEKPSDHVPVVVDL 257


>gi|209964343|ref|YP_002297258.1| exodeoxyribonuclease III [Rhodospirillum centenum SW]
 gi|209957809|gb|ACI98445.1| exodeoxyribonuclease III [Rhodospirillum centenum SW]
          Length = 257

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 118/259 (45%), Positives = 163/259 (62%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++AR+ N+ +W+    PD++ LQE K E  +FP    + L Y +   GQK
Sbjct: 1   MKIATWNVNSVKARLPNVLSWLNAAAPDVVLLQEIKCETASFPALEFEPLGYRVHAVGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAILS+    +++  LPG+  DVQAR++E T       LRI +LYLP+GNP+ S K
Sbjct: 61  SYNGVAILSRLPVEDLIERLPGEPEDVQARYVEGTIGG----LRIASLYLPNGNPVGSEK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++R      + L  E P +  GDYN+IP P D Y+P  W  DA F  E R+ F
Sbjct: 117 YPYKLRWMERLKAHVGELLAREVPFVLGGDYNVIPAPEDVYDPEGWSGDALFRRETREKF 176

Query: 184 QKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           +++ N+G T+A RA H    H Y+FWDY A +W ++ G+RIDH +LSP+A   L    ID
Sbjct: 177 REILNLGLTEAFRALHPAARHAYTFWDYQAGAWPRDLGLRIDHFLLSPQAADRLAGCTID 236

Query: 243 TKPRGWTKPSDHTPVIVSL 261
             PRG  K SDHTPV++ L
Sbjct: 237 RSPRGQEKASDHTPVLLDL 255


>gi|46201885|ref|ZP_00208288.1| COG0708: Exonuclease III [Magnetospirillum magnetotacticum MS-1]
          Length = 258

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 116/259 (44%), Positives = 159/259 (61%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR+ N+  W+    PD++ LQE K +D +FP   +++  Y     GQK
Sbjct: 3   LRIATWNVNSVRARLGNVLDWLGSFAPDVVLLQEIKCQDHDFPRLEIEAAGYQTAVHGQK 62

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAILS++   +I   LPGD+ D QAR+IEAT        R+ +LYLP+GNP    K
Sbjct: 63  SYNGVAILSRHAMSDISLRLPGDESDEQARYIEATIEGW----RLASLYLPNGNPAPGDK 118

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W+ R    A   L  + P +  GD+NI P   D Y+P  W+NDA    + R +F
Sbjct: 119 YDYKLAWMARLRAHAQSLLTQDIPFVLGGDFNICPTDDDVYDPPNWQNDALCRPDSRAAF 178

Query: 184 QKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           + + N+G T+A RA H      YSFWDY A +W +++G+RIDH +LSP A   L +  ID
Sbjct: 179 RAIVNLGLTEAFRALHPEEKGRYSFWDYQAGAWQRDEGLRIDHFLLSPRAADHLQACDID 238

Query: 243 TKPRGWTKPSDHTPVIVSL 261
             PRG  K SDHTPV + L
Sbjct: 239 RAPRGKEKASDHTPVWIEL 257


>gi|317404954|gb|EFV85317.1| exodeoxyribonuclease III [Achromobacter xylosoxidans C54]
          Length = 260

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 89/258 (34%), Positives = 134/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+  N  D++C+QE K  D  FP    +   YH    GQK
Sbjct: 1   MKLATWNVNSLNVRLPQVLDWLAANPVDVLCIQELKLTDDKFPEAAFKEAGYHAVWAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+     +V +LP    D Q R +  TF      +R+   Y P+G  + S K
Sbjct: 61  TYNGVAIVSRVPGTSMVRNLP-TYEDPQQRVLALTFPSADGDVRVVCAYCPNGQSVGSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W      + +  ++    L   GDYN+ P   D +NP  WE     +   RQ+ 
Sbjct: 120 YAYKLEWFAAMRAWLADEIKQYPRLAVLGDYNVAPADEDVHNPEKWEGQVLVSEPERQAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G  D+ R        +S+WDY   ++ +N G+RIDHI+LSP       +  ID 
Sbjct: 180 RDLIDLGLADSFRLFEQPEKSFSWWDYRQFAFRRNAGLRIDHILLSPPLVKRCTACVIDK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PR   +PSDH PV+ +L
Sbjct: 240 EPRRNEQPSDHAPVVATL 257


>gi|15889021|ref|NP_354702.1| exonuclease III [Agrobacterium tumefaciens str. C58]
 gi|15156812|gb|AAK87487.1| exonuclease III [Agrobacterium tumefaciens str. C58]
          Length = 265

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 141/255 (55%), Positives = 184/255 (72%), Gaps = 1/255 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+N ++ARI NL  W+K+++PDI+CLQE K+ D+ FP   +++L YHIET GQK
Sbjct: 1   MKIATWNINGVKARIENLCQWLKDSSPDIVCLQEIKSVDEGFPRLEIEALGYHIETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            +NGVA+LSK +P E+   LPGDD D QARFIE  F++    +R+ +LYLP+GNP     
Sbjct: 61  GFNGVALLSKVKPDEVNRGLPGDDADEQARFIEGVFSVEGGAIRVCSLYLPNGNPPDDPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K++W++R  RFA  RL +EEPLI AGDYN+IP+P DC++P +WE DA F  + R +
Sbjct: 121 KYPYKLAWMERLRRFAEDRLAMEEPLILAGDYNVIPEPFDCHDPRVWEGDALFLPKTRAA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F+KL+N+GFTDA RAT D   LYSFWDY A +W KN GIRIDH+MLS EA   L S  I+
Sbjct: 181 FRKLENLGFTDAARATTDAAGLYSFWDYQAGAWPKNNGIRIDHLMLSAEAADRLQSVEIE 240

Query: 243 TKPRGWTKPSDHTPV 257
              R W KPSDH PV
Sbjct: 241 KHVRAWEKPSDHVPV 255


>gi|254437353|ref|ZP_05050847.1| exodeoxyribonuclease III [Octadecabacter antarcticus 307]
 gi|198252799|gb|EDY77113.1| exodeoxyribonuclease III [Octadecabacter antarcticus 307]
          Length = 266

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 119/265 (44%), Positives = 158/265 (59%), Gaps = 6/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N ++ARI  L  W++ + PD+  LQE K+ D+ FP E  ++L Y +ET GQK
Sbjct: 1   MKIATFNINGVKARIGALTDWLEASKPDVALLQEIKSVDEGFPREHFENLGYRVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEAT------FTINTQTLRIGNLYLPHGN 117
            +NGVAILSK    +I   LP      +    +          I  + +RI  LYLP+GN
Sbjct: 61  GFNGVAILSKLPLEDISRGLPDAAGAGREGVDDIEARYIEATVIGEKAIRICGLYLPNGN 120

Query: 118 PITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTL 177
           P    KYD K+ W+ R    A Q + LEEP + AGDYNIIPQP D   P +W +DA F  
Sbjct: 121 PAPGPKYDYKLRWMDRLKTRAQQLMALEEPFLMAGDYNIIPQPEDAARPNVWTDDALFRP 180

Query: 178 EVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLH 237
           + R +F++L N+G T+A RA H     YSFWDY A +W KN GIRIDH +LS +   LL 
Sbjct: 181 DSRAAFRRLLNLGLTEAFRACHQGSGHYSFWDYQAGAWDKNDGIRIDHFLLSNQCADLLK 240

Query: 238 SARIDTKPRGWTKPSDHTPVIVSLD 262
            A I++  RG  KPSDH PV V LD
Sbjct: 241 DAWIESGVRGREKPSDHVPVWVELD 265


>gi|296284849|ref|ZP_06862847.1| hypothetical protein CbatJ_14571 [Citromicrobium bathyomarinum
           JL354]
          Length = 257

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 92/258 (35%), Positives = 142/258 (55%), Gaps = 2/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR+  L  W++E  PD+ CLQE K++D  FP    +++ Y     GQK
Sbjct: 1   MRIATFNINGIKARLPRLLEWLEETQPDVACLQEIKSQDDGFPASEFEAIGYQALWHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVA+L+K               +   +       ++   + I NLYLP+GNP    K
Sbjct: 61  SFNGVAVLAKQGLTMEERQRGLPGDESDDQARYLEVEVDG--VVIANLYLPNGNPHPGPK 118

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W++R     +     E+P I  GD+N+IPQ  D ++P    +DA    E R ++
Sbjct: 119 FDYKLAWMERLRARMAALWAQEKPTIVLGDFNVIPQDKDVWSPPAMADDALMQPESRDAY 178

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L   G+TDAI   +    +++FWDY   +W ++ G RIDH +LSPE    L +A +D 
Sbjct: 179 ARLLADGWTDAIDTLNPRGGVWTFWDYQRGAWQRDHGFRIDHCLLSPELADRLQAAGVDK 238

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RG  K SDH PV V +
Sbjct: 239 HARGREKASDHAPVWVEI 256


>gi|84497619|ref|ZP_00996441.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth [Janibacter
           sp. HTCC2649]
 gi|84382507|gb|EAP98389.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth [Janibacter
           sp. HTCC2649]
          Length = 262

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 75/261 (28%), Positives = 135/261 (51%), Gaps = 1/261 (0%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           +V +ATWNVNSIR+RI  + AW++  + D++ +QETK  ++ FPF+  ++L Y +   G 
Sbjct: 1   MVRIATWNVNSIRSRIDRVEAWLERTDVDVLAIQETKCREEQFPFDRFEALGYAVAHHGL 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT-LRIGNLYLPHGNPITS 121
             +NGVAI S+    ++    P      +    EA     T   +R+ +LY+P+G  +  
Sbjct: 61  SQWNGVAIASRVGLDDVSRGFPDVPHWGEPAVAEARAIGATCNGIRLWSLYVPNGRALED 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
                K++W+++     +      +P    GD+NI PQ  D ++   + + +  +   R 
Sbjct: 121 PHMHYKLAWLEQLRVQTAAWAAEGQPFALMGDWNIAPQDEDVWSMDYYLDKSHVSPPERA 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +FQ + + G +D +R        +++WDY   ++ K +G+RID I+ S      +  A I
Sbjct: 181 AFQAVLDAGVSDVVRPHTPEPGTFTYWDYQRLAFQKRRGMRIDFILASDPLAQRVRGAAI 240

Query: 242 DTKPRGWTKPSDHTPVIVSLD 262
           D + R     SDH PV++ ++
Sbjct: 241 DREERKGKGASDHAPVVIEVE 261


>gi|209523548|ref|ZP_03272102.1| exodeoxyribonuclease III [Arthrospira maxima CS-328]
 gi|209495953|gb|EDZ96254.1| exodeoxyribonuclease III [Arthrospira maxima CS-328]
          Length = 263

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 94/261 (36%), Positives = 140/261 (53%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R   + +W++  + D++CLQETK  D++FP    + L YH+   GQK
Sbjct: 1   MKIATWNVNSIRTRQDQVLSWLQGQDIDVLCLQETKVIDQDFPRSPFEELGYHVYIYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP---GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           +YNGVAI S+     ++       G D   +    +         + I N+Y+P+G+ + 
Sbjct: 61  AYNGVAIFSRLNIESVIMGFTPILGADQVGELDDQKRVIAGVIDDICIVNVYIPNGSSVG 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           S KY+ K+ W+ R   +  Q L     L   GD+NI P+  D YNP   EN    +   R
Sbjct: 121 SDKYEYKLQWLNRLGDYLQQMLIKYPHLCICGDFNIAPEDRDIYNPQNRENHIMASAAER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           Q+   + N+G  D  R        +++WDY A S+++N+G RIDH  LSP       +  
Sbjct: 181 QALDAIANLGLADGFRKFTQDGGHFTWWDYRAASFTRNRGWRIDHHYLSPGLYQNAIACY 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           IDT+PR   KPSDH PVI+ +
Sbjct: 241 IDTEPRTQPKPSDHAPVILEI 261


>gi|83858693|ref|ZP_00952215.1| hypothetical protein OA2633_04301 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853516|gb|EAP91368.1| hypothetical protein OA2633_04301 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 263

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 122/262 (46%), Positives = 169/262 (64%), Gaps = 1/262 (0%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
            ++VA+WNVNSI+AR+ N+  W+KE +PD+ CLQE KT D+ FP   ++ L Y++ET GQ
Sbjct: 2   TLSVASWNVNSIKARLPNVLDWLKEASPDVACLQEIKTVDEGFPRLEIEELGYNVETVGQ 61

Query: 63  KSYNGVAILSKYQPIEI-VTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           K+YNGVA+LSK    EI    LPGDD D QAR+IEA  + ++  +R+ ++YLP+GNP   
Sbjct: 62  KTYNGVALLSKRPIEEISQRALPGDDEDDQARYIEAVISADSGPVRVASIYLPNGNPAPG 121

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KYD K++W+KR    A   L  EEP+I AGDYN+IP+  D ++   WE DA    E R 
Sbjct: 122 PKYDYKLAWMKRLKAHARSLLAFEEPVILAGDYNLIPRDSDVHDAAAWEGDALIRPESRD 181

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +F K+  +G+++A        H Y+FWDY A +W KN GIRIDH++LSP+A   L +  I
Sbjct: 182 AFAKILWLGYSEAFMQADGRAHQYTFWDYQAGAWQKNNGIRIDHLLLSPQAADRLKAVEI 241

Query: 242 DTKPRGWTKPSDHTPVIVSLDI 263
               RG  K SDH P +   D+
Sbjct: 242 AKDVRGKEKASDHVPFVGVFDL 263


>gi|318042025|ref|ZP_07973981.1| exodeoxyribonuclease III [Synechococcus sp. CB0101]
          Length = 276

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 91/273 (33%), Positives = 143/273 (52%), Gaps = 4/273 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+R R+  + AW++   PD++CLQETK  D+ FP    + + YH    GQK
Sbjct: 1   MRIASWNVNSVRTRLDQVLAWLETEQPDVLCLQETKVADQLFPSAAFEQMGYHCAISGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHL----PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           +YNGVA++S+    ++        P D    +    +   +     +R+ NLY+P+G+ +
Sbjct: 61  AYNGVALISRLPLDDVQIGFSALLPDDPDAPELSEQKRVISALVDGVRVLNLYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           +S KY  K++W+    R+ + + +  +PL   GD+NI P+  D ++P         T   
Sbjct: 121 SSDKYTYKLAWLACLKRYLAVQHDQGDPLCMVGDFNIGPEARDLHDPDRLSGGIMATDAE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           RQ+         TD  R        +S+WDY + +W +++G RIDHI LS E        
Sbjct: 181 RQALSDALAGRLTDVFRVFEPGSGHWSWWDYRSGAWDRDQGWRIDHIYLSEELLDCATGC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQD 272
            ID  PRG T+PSDH PV+V+L   E      D
Sbjct: 241 VIDKTPRGNTQPSDHAPVVVNLAWDEETDASDD 273


>gi|289207194|ref|YP_003459260.1| exodeoxyribonuclease III Xth [Thioalkalivibrio sp. K90mix]
 gi|288942825|gb|ADC70524.1| exodeoxyribonuclease III Xth [Thioalkalivibrio sp. K90mix]
          Length = 255

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 88/258 (34%), Positives = 137/258 (53%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS++ R+  +  W+  +  DI+ LQETK  D+NFP   +    Y +   GQK
Sbjct: 1   MKIASWNVNSLKVRLPQVLDWLGSSRTDILALQETKLTDENFPVSAIHEAGYEVVYSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+ Q  ++VT  PG                    +R+ NLY+ +G  + + K
Sbjct: 61  TYNGVAILSRTQATDVVTDPPG-----LEDAQRRILAATIGDIRVVNLYVVNGENVGTEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+ R   + +  +E    L+  GD+NI P+  D ++P  W      +   R++ 
Sbjct: 116 YAYKLDWLARMRSWLAAEIEAHPKLVVLGDFNIAPEDRDVHDPEAWHERILCSTPEREAL 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L  +G  D  RA       +S++DY A S+ +N+G+RID ++ SP     L +A ID 
Sbjct: 176 AALTELGLADTFRAFEQPEEEFSWFDYRAASFRRNRGLRIDLVLASPALLKRLTAAGIDR 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PRGW +PSDH PV    
Sbjct: 236 EPRGWERPSDHAPVWAEF 253


>gi|293604886|ref|ZP_06687283.1| exodeoxyribonuclease III [Achromobacter piechaudii ATCC 43553]
 gi|292816714|gb|EFF75798.1| exodeoxyribonuclease III [Achromobacter piechaudii ATCC 43553]
          Length = 260

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 88/259 (33%), Positives = 140/259 (54%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+  N  D++C+QE K  D  FP    +   YH    GQK
Sbjct: 1   MKLATWNVNSLNVRLPQVLDWLAANPVDVLCIQELKLTDDKFPEAAFKEAGYHAVWAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+    ++V ++PG D D Q R +  TF      +R+   Y P+G  + S K
Sbjct: 61  TYNGVAIVSRMPGTKMVRNIPGHD-DHQQRVLALTFPSPEGDVRVVCAYCPNGQSLDSEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W +    + ++ ++    L   GDYN+ P   D +NP  WE     +   R + 
Sbjct: 120 YQYKLAWFEAMREWLAEEIKQYPRLAVLGDYNVAPADEDVHNPEKWEGHVLVSEPERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD+ R        +S+WDY   ++ +N G+RIDH++LS        +  ID 
Sbjct: 180 RALLDLGLTDSFRLFEQPEKSFSWWDYRQFAFRRNAGLRIDHVLLSAPLVKRCVACVIDK 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           +PR   +PSDH PV+ +L+
Sbjct: 240 EPRRNEQPSDHAPVVATLE 258


>gi|162456399|ref|YP_001618766.1| exodeoxyribonuclease III [Sorangium cellulosum 'So ce 56']
 gi|161166981|emb|CAN98286.1| exodeoxyribonuclease III [Sorangium cellulosum 'So ce 56']
          Length = 269

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 83/258 (32%), Positives = 135/258 (52%), Gaps = 2/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNSIR R+  L +W+    PD++C+QETK ED +FP   L  + Y     GQK
Sbjct: 1   MRIASWNVNSIRTRLEQLTSWLVRAAPDVVCMQETKVEDGSFPEAALSEVGYRSVIFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAI +++        +       +            + +R+ N+Y+P+G  + +  
Sbjct: 61  SYNGVAIATRFGLSVD--DVKKGLDGDEQDVARRMLAATIEGIRVINVYVPNGQAVGTPA 118

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W++R       R   ++ ++  GD+N+ P+  D   P  WE    F  + R + 
Sbjct: 119 FAYKLAWLERLRSELEARYRPDQQIMICGDFNVAPEAIDVAEPKKWEGQVLFHPDERAAL 178

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L   G  DA RA H     YS+WDY   ++ +NKG+RID  +++    +      IDT
Sbjct: 179 GRLMEWGLVDAFRACHPAKEAYSWWDYRMGAFRRNKGLRIDLALVTRPLAARCTDVSIDT 238

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PR   +PSDH PV+V +
Sbjct: 239 RPRELQRPSDHAPVVVEI 256


>gi|145594280|ref|YP_001158577.1| exodeoxyribonuclease III Xth [Salinispora tropica CNB-440]
 gi|145303617|gb|ABP54199.1| Exodeoxyribonuclease III [Salinispora tropica CNB-440]
          Length = 265

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 131/260 (50%), Gaps = 2/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++AR+  L  W+   NPD++CLQETK  D  FP   + +L Y + +    
Sbjct: 1   MRLATWNVNSVKARLPRLLDWLAGTNPDVVCLQETKCPDGAFPVAEVGTLGYTVASHSDG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILS+    ++    P +           + T     LR+ ++Y+P+G  +    
Sbjct: 61  RWNGVAILSRVGLTDVTVGFPDEPGFPDPEARALSATCAG--LRVWSVYVPNGRTLDDPH 118

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+          L    PL   GD+N+ P   D ++P ++      T   R + 
Sbjct: 119 YAYKLAWLGALRDTLEVELTGGAPLAVCGDFNVAPTDSDVWDPALFTGSTHVTPAERTAL 178

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+++G  D +       H +++WDY A  + +NKG+RID +  S     ++ +A +D 
Sbjct: 179 AALRDLGLDDVVPTPMKGPHPFTYWDYRAGMFHQNKGMRIDLVYASAPFARVVRAAYVDR 238

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R    PSDH P++V  D+
Sbjct: 239 EARKGKGPSDHAPIVVDADL 258


>gi|126729725|ref|ZP_01745538.1| exodeoxyribonuclease III [Sagittula stellata E-37]
 gi|126709844|gb|EBA08897.1| exodeoxyribonuclease III [Sagittula stellata E-37]
          Length = 260

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 122/258 (47%), Positives = 167/258 (64%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+ARI  L+ W++  NPD++  QE K+ D+NFP E  + + Y +ET GQK
Sbjct: 1   MKIATFNINGIKARIGALSDWLQSANPDVVLAQEIKSVDENFPREHFEDMGYAVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    ++   LPGD  D QAR+IEAT   +T  +R+  LYLP+GNP    K
Sbjct: 61  GFNGVAILSKLPLEDVSRGLPGDPDDEQARWIEATVMGDTTAVRLCGLYLPNGNPAPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W++R    A Q L  E P + AGDYN+IPQ  D   P  W +DA F  + RQ+F
Sbjct: 121 YDYKLAWMERLHTRAEQLLASEMPAVMAGDYNVIPQAEDAAKPDAWTDDALFLPQTRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFT+A RA       YSFWDY A+SW +N GIRIDH++L+P+A  LL+   I+ 
Sbjct: 181 RRIVNLGFTEAFRARTQGPGHYSFWDYQANSWQRNNGIRIDHLLLTPQAADLLNDCWIEK 240

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R   KPSDH PV   L
Sbjct: 241 DVRAAEKPSDHVPVWCDL 258


>gi|302866656|ref|YP_003835293.1| exodeoxyribonuclease III Xth [Micromonospora aurantiaca ATCC 27029]
 gi|302569515|gb|ADL45717.1| exodeoxyribonuclease III Xth [Micromonospora aurantiaca ATCC 27029]
          Length = 265

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 75/260 (28%), Positives = 127/260 (48%), Gaps = 2/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++AR+  L  W+    PD++CLQETK  D  FP   +  L Y + +    
Sbjct: 1   MRLATWNVNSVKARLPRLLDWLATTKPDVVCLQETKCPDGAFPVAEVGELGYEVASHSDG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++    PG+    +        +     LR+ ++Y+P+G       
Sbjct: 61  RWNGVAVLSRVGLADVTVGFPGEPGFPEPEARAI--SATCDELRVWSVYVPNGRAPDDPH 118

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W           +    P+   GD+N+ P   D ++P ++      T   R + 
Sbjct: 119 YAYKLAWFAALRDALEPEVAGALPVAVCGDFNVAPTDADVWDPALFVTSTHVTPAERAAL 178

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+++G  D +       H +++WDY A  + +NKG+RID +  S      + SA +D 
Sbjct: 179 AALRDLGLKDVVPTPMKGPHPFTYWDYRAGMFHQNKGMRIDLVYASASFARAVRSAYVDR 238

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R    PSDH P++V  D+
Sbjct: 239 EARKGKGPSDHAPIVVDADL 258


>gi|116072855|ref|ZP_01470120.1| Exodeoxyribonuclease III xth [Synechococcus sp. BL107]
 gi|116064381|gb|EAU70142.1| Exodeoxyribonuclease III xth [Synechococcus sp. BL107]
          Length = 282

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 94/279 (33%), Positives = 144/279 (51%), Gaps = 5/279 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R+R+  + +W+++  PD++CLQETK +D  FP +  ++  + +   GQK
Sbjct: 1   MRIATWNVNSVRSRLDQVLSWLEQAQPDLLCLQETKVDDPLFPSKAFEAKGWRVNFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT----QTLRIGNLYLPHGNPI 119
           SYNGVA++S+    ++     G+                       +R+ NLY+P+G+ +
Sbjct: 61  SYNGVALVSRAPLDDVRYGFVGELEKDPEALDLGEQKRVISALIDGVRVVNLYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           TS KY  K++W+K   R+    L+  EPL   GD+NI  +  D + P         +   
Sbjct: 121 TSDKYPYKLTWLKCLKRYLEHPLKRGEPLCVVGDFNIALEARDMHAPDRLSGGIMASDAE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           RQ+ Q     G  D  R        +S+WDY + +W +++G RIDHI L  E   L  S 
Sbjct: 181 RQALQMALANGLQDVFRVFEPDAGHWSWWDYRSGAWDRDRGWRIDHIYLCDELLGLARSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDSTSQNM 278
            I    RG  KPSDH PV V LD P P    +D  ++N 
Sbjct: 241 VIHKSVRGNDKPSDHAPVSVDLDWP-PSDDDEDGHNEND 278


>gi|78185266|ref|YP_377701.1| exodeoxyribonuclease III xth [Synechococcus sp. CC9902]
 gi|78169560|gb|ABB26657.1| Exodeoxyribonuclease III [Synechococcus sp. CC9902]
          Length = 282

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 92/277 (33%), Positives = 144/277 (51%), Gaps = 5/277 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R+R+  + +W+++  PD++CLQETK +D  FP +  ++  + +   GQK
Sbjct: 1   MRIATWNVNSVRSRLDQVLSWLEQAQPDLLCLQETKVDDPLFPLQAFEAKGWRVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT----QTLRIGNLYLPHGNPI 119
           SYNGVA++S+    ++     G+       F               +R+ NLY+P+G+ +
Sbjct: 61  SYNGVALVSRAPLDDVRCGFVGELDKDPEAFELGEQKRVISALIDGVRVVNLYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           TS KY  K+ W++   R+  Q L+  EPL   GD+NI  +  D ++P         +   
Sbjct: 121 TSDKYPYKLKWLRCLKRYLEQPLQRGEPLCVVGDFNIALEARDMHDPDRLSGGIMASDPE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++ Q     G  D  R        +S+WDY   +W +++G RIDHI L  E   L  S 
Sbjct: 181 REALQMALESGLQDVFRVFEPDGGHWSWWDYRTGAWDRDRGWRIDHIYLCDELLGLARSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDSTSQ 276
            I  + RG  KPSDH PV V LD P P    +   ++
Sbjct: 241 VIHKQVRGNEKPSDHAPVSVDLDWP-PSDDDESGDNE 276


>gi|84500937|ref|ZP_00999172.1| exodeoxyribonuclease III [Oceanicola batsensis HTCC2597]
 gi|84391004|gb|EAQ03422.1| exodeoxyribonuclease III [Oceanicola batsensis HTCC2597]
          Length = 260

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 123/260 (47%), Positives = 168/260 (64%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR   L  W+ E  PD++ LQE ++ D+NFP E  +   Y++ET GQK
Sbjct: 1   MRIATFNINGIKARHAALTTWLDEAGPDVVLLQEIRSVDENFPREIFEDRGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK    ++   LPGDD D  AR+IEAT       LR+  LYLP+GNP    K
Sbjct: 61  SFNGVAILSKLPLEDVTRGLPGDDADDHARWIEATVVGEHAALRVCGLYLPNGNPAPGPK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W++R    A Q +  EEP + AGDYNIIPQP D   P  W +DA F L+ R ++
Sbjct: 121 YDYKLAWMERLRERARQLIAQEEPALMAGDYNIIPQPEDVARPDAWRDDALFRLDSRDAY 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFT+A R  H     YSFWDY A +W +N GIRIDHI+++P+   L+  A I+ 
Sbjct: 181 RRVLNLGFTEAFRTRHPAPGHYSFWDYQAGAWQRNNGIRIDHILMTPQCADLMQDAGIEK 240

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + RG  KPSDH PV V L +
Sbjct: 241 ELRGREKPSDHVPVWVDLAV 260


>gi|315503070|ref|YP_004081957.1| exodeoxyribonuclease iii xth [Micromonospora sp. L5]
 gi|315409689|gb|ADU07806.1| exodeoxyribonuclease III Xth [Micromonospora sp. L5]
          Length = 265

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 75/260 (28%), Positives = 127/260 (48%), Gaps = 2/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++AR+  L  W+    PD++CLQETK  D  FP   +  L Y + +    
Sbjct: 1   MRLATWNVNSVKARLPRLLDWLATTKPDVVCLQETKCPDGAFPVAEVGELGYEVASHSDG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++    PG+    +        +     LR+ ++Y+P+G       
Sbjct: 61  RWNGVAVLSRVGLADVTVGFPGEPGFPEPEARAI--SATCDELRVWSVYVPNGRAPDDPH 118

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W           +    P+   GD+N+ P   D ++P ++      T   R + 
Sbjct: 119 YAYKLAWFAALRDALESEVAGALPVAVCGDFNVAPTDADVWDPALFVTSTHVTPAERAAL 178

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+++G  D +       H +++WDY A  + +NKG+RID +  S      + SA +D 
Sbjct: 179 AALRDLGLEDVVPTPMKGPHPFTYWDYRAGMFHQNKGMRIDLVYASASFARAVRSAYVDR 238

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R    PSDH P++V  D+
Sbjct: 239 EARKGKGPSDHAPIVVDADL 258


>gi|56697356|ref|YP_167724.1| exodeoxyribonuclease III [Ruegeria pomeroyi DSS-3]
 gi|56679093|gb|AAV95759.1| exodeoxyribonuclease III [Ruegeria pomeroyi DSS-3]
          Length = 268

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 120/268 (44%), Positives = 162/268 (60%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR   L AW+    PD+  LQE K+ D++FP E  +   Y++ET GQK
Sbjct: 1   MKIATFNINGIKARAEALPAWLDSAQPDVALLQEIKSVDESFPREMFEERGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEAT----FTINTQTLRIGNLYL----PH 115
            +NGVAILSK    ++   LPGDD D QAR+IEAT      +    L + N         
Sbjct: 61  GFNGVAILSKLPLEDVSRGLPGDDSDEQARWIEATVVGKQALRLCGLYLPNGNPVELTES 120

Query: 116 GNPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACF 175
           G+P+   KYD K+ W++R    A++ +  EEP + AGDYNIIPQ  D   P  W  DA F
Sbjct: 121 GDPVPGGKYDYKLRWMERLQARATELMAAEEPALMAGDYNIIPQAEDAKRPEAWREDALF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
             E R +F+++ N+GFT+A RA       YSFWDY A +W++N GIRIDH +L+P+A  L
Sbjct: 181 RPESRAAFRRILNLGFTEAFRARVQGPGHYSFWDYQAGAWNRNDGIRIDHFLLTPQAADL 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           +    ID + RG  KPSDH PV V LDI
Sbjct: 241 MRDCGIDKEVRGRDKPSDHVPVWVELDI 268


>gi|295395722|ref|ZP_06805913.1| exodeoxyribonuclease III [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971422|gb|EFG47306.1| exodeoxyribonuclease III [Brevibacterium mcbrellneri ATCC 49030]
          Length = 261

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 73/261 (27%), Positives = 121/261 (46%), Gaps = 1/261 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+RAR   + A++  ++ D++ +QE K +D  FP    +   Y +   G  
Sbjct: 1   MRIVTWNVNSVRARAERIGAFLDRSDVDVLAIQELKCKDAQFPAHVFEDRGYEVAFHGLN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDD-LDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
            +NGVA+ S+    ++     G        +      +  T  +R  +LY+P+G  +   
Sbjct: 61  QWNGVAVASRVGLDDVEVGFEGVPGFGDDDQVEARAISAVTGGVRTYSLYVPNGRELDHP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
            Y  K+ W+ +    A  RLE + P +  GD+N+ P   D ++   +E     +   R +
Sbjct: 121 HYAYKLEWLAQLRNEALVRLEQDVPFVMCGDFNVAPLDEDVWDMAAFEGATHVSQPERDA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F  L + G T+  R       +Y+FWDY    + K +G+RID  + SP        A ID
Sbjct: 181 FNGLISAGLTEVTRQFTPGPGVYTFWDYQQLRFPKKQGMRIDFQLASPSLAERATGAFID 240

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
            + R     SDH PV V   +
Sbjct: 241 REERKGKGASDHAPVWVDYQL 261


>gi|254436254|ref|ZP_05049761.1| exodeoxyribonuclease III [Nitrosococcus oceani AFC27]
 gi|207089365|gb|EDZ66637.1| exodeoxyribonuclease III [Nitrosococcus oceani AFC27]
          Length = 254

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 89/258 (34%), Positives = 141/258 (54%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R   +  W++ + PD++ LQETK  D +FP E  + + YH    GQK
Sbjct: 1   MKIATWNVNSLRVRFSQVVDWLEIHQPDVLALQETKLVDDSFPQEAFKEIGYHAAYSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL +  P +I+T LP      +         +    +R+ NLY+P+G+ + S K
Sbjct: 61  TYNGVAILCRQAPKDILTDLPNLVDSQRRIL-----GVTVDDIRLLNLYVPNGSEVGSKK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+ R   +  + L     LI  GD+N+ P   D ++P IW      +   R++ 
Sbjct: 116 YAYKLDWLGRIKDYLQEALVEYPKLIVLGDFNVAPADQDVHDPDIWHETILCSTPEREAL 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++  +GF D+ R        +S+WDY   ++ +N+G+RID I++S           ID 
Sbjct: 176 KEILALGFQDSFRLFEQEAQSFSWWDYRGGAFRRNRGLRIDLILISKALVPKCTGCVIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PR  T+PSDH PVI + 
Sbjct: 236 EPRRLTRPSDHAPVIATF 253


>gi|152980157|ref|YP_001354134.1| exodeoxyribonuclease III [Janthinobacterium sp. Marseille]
 gi|151280234|gb|ABR88644.1| exodeoxyribonuclease III [Janthinobacterium sp. Marseille]
          Length = 254

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 100/259 (38%), Positives = 149/259 (57%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+ +N  D++CLQETKT ++ FP   +++  YH+   GQK
Sbjct: 1   MKIATWNVNSLKVRLPQVLQWLTDNPVDVLCLQETKTVNEKFPLAEIEAAGYHVVYTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS++   ++V + P  D + Q   I          +RI   Y+P+G  + S K
Sbjct: 61  TYNGVAILSRHPIDDVVKNNPLFDDEHQRIIIGTIQG-----VRIICAYIPNGQSLESDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+       +  L+  E +   GDYNI P+  D ++P+ W+     +   R +F
Sbjct: 116 YQYKLRWLAGLHELLAHELKQHENVALLGDYNIAPEDRDVHDPVAWQGQVLVSEPERAAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            ++Q MGFTDA R       LYS+WDY    +  N+G+RIDHI+LSP       +  ID 
Sbjct: 176 VRMQEMGFTDAFRMFEQAEKLYSWWDYRQMGFRLNRGLRIDHILLSPSLAKRCTACVIDK 235

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR W +PSDHTPVI +LD
Sbjct: 236 VPRKWEQPSDHTPVIATLD 254


>gi|163793122|ref|ZP_02187098.1| Exonuclease III [alpha proteobacterium BAL199]
 gi|159181768|gb|EDP66280.1| Exonuclease III [alpha proteobacterium BAL199]
          Length = 259

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 115/258 (44%), Positives = 166/258 (64%), Gaps = 3/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS++AR+ N+  W+K  +PD++ LQE KT D  FP   +++L Y     GQK
Sbjct: 1   MKIASWNVNSVKARLDNVLDWLKTASPDVVLLQEIKTVDDGFPRLEIEALGYQCAIHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAILSK    ++   L GDD D QAR++EAT       +R+  +YLP+GNP+TS K
Sbjct: 61  SYNGVAILSKVGLADVQPRLFGDDNDEQARYLEATV---GGEVRVATIYLPNGNPVTSEK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+KR    A++ L  E  ++  GDYN+IP   D ++P  W  DA    E R +F
Sbjct: 118 YPYKLAWMKRLKARATELLRAEGAVVLGGDYNVIPTDDDVHDPAAWAGDALCRPETRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++  +G+TDA RA   T H Y+FWDY   +W +++G+RIDH++LSP+A   L ++ IDT
Sbjct: 178 REILWLGYTDAFRALDQTVHKYTFWDYQGGAWQRDEGVRIDHLLLSPQAADRLTASGIDT 237

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   K SDHTPV   +
Sbjct: 238 APRAKPKASDHTPVWCEI 255


>gi|91787699|ref|YP_548651.1| exodeoxyribonuclease III [Polaromonas sp. JS666]
 gi|91696924|gb|ABE43753.1| Exodeoxyribonuclease III [Polaromonas sp. JS666]
          Length = 267

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 86/262 (32%), Positives = 128/262 (48%), Gaps = 1/262 (0%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
             + +ATWNVNS+  R+  +  W+  N  D++CLQE K  D  FP + L    Y     G
Sbjct: 6   KTMKIATWNVNSLAVRLPQVLDWLAANPVDVLCLQELKLSDDKFPLQALADAGYQSAVFG 65

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK+YNGVAILS+     IV ++ G   +       AT    +  +R+ N Y  +G    +
Sbjct: 66  QKTYNGVAILSRTPARNIVKNIAGFTDEQSRVI-AATLDTPSGEVRVVNGYFVNGQAPGT 124

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            K++ K+ W+     +  + L     L+  GD+NI     D Y+          T + RQ
Sbjct: 125 EKFEYKMRWLDGLRAWLREELAEHSRLVLVGDFNITADDRDTYDAQGLHETIHHTADERQ 184

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
             Q L  +G  DA R        YS+WDY   ++ +N+G+RID+I++S      + S  I
Sbjct: 185 HLQALLGLGLHDAFRLFEQPEKTYSWWDYREFAFRRNRGLRIDYILVSNALKPAVKSCLI 244

Query: 242 DTKPRGWTKPSDHTPVIVSLDI 263
           D  PR   +PSDH PV+  LD 
Sbjct: 245 DKLPRKNERPSDHAPVVAELDW 266


>gi|254526744|ref|ZP_05138796.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9202]
 gi|221538168|gb|EEE40621.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9202]
          Length = 281

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 97/266 (36%), Positives = 148/266 (55%), Gaps = 4/266 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  +  WI + NPDI+CLQETK  D +FP E  + L Y +E  GQK
Sbjct: 1   MLIATWNVNSIRTRLSQIIDWINQVNPDILCLQETKVMDDSFPTEPFEKLGYAVEVYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT----INTQTLRIGNLYLPHGNPI 119
           SYNGVAI+SK +P  +     G     Q   I          +   ++I N+Y+P+G+ +
Sbjct: 61  SYNGVAIISKTKPENVKKGFYGCTNFNQNIEIFQDQKRLISADINNIKIINVYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S+K++ KI+W+     F  ++ +  E +   GD+NI P   D ++P  +E     +   
Sbjct: 121 ESSKFEYKINWLNCLGSFLDEQEKKGELICLLGDFNIAPSNLDIHDPKKYEGGIMASEIE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R +   +      D+ R        +S+WDY  +++  NKG RIDHI +S E +S L S 
Sbjct: 181 RNALNNVLKKRLIDSFRIFEQNTGHWSWWDYRNNAFELNKGWRIDHIYISKELSSKLKSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPE 265
            ID  PRG+ +PSDH PV++ L++ +
Sbjct: 241 VIDCSPRGYLRPSDHAPVMIDLNLND 266


>gi|159037346|ref|YP_001536599.1| exodeoxyribonuclease III Xth [Salinispora arenicola CNS-205]
 gi|157916181|gb|ABV97608.1| exodeoxyribonuclease III Xth [Salinispora arenicola CNS-205]
          Length = 265

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 80/260 (30%), Positives = 129/260 (49%), Gaps = 2/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++AR+  L  W+    PD++CLQETK  D  FP   + +L Y + +    
Sbjct: 1   MRLATWNVNSVKARLPRLLDWLAGTEPDVVCLQETKCPDGAFPVAEVGALGYTVASHSDG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILS+    E+    PG+             T     LR+ ++Y+P+G       
Sbjct: 61  RWNGVAILSRVGLTEVTVGFPGEPGFPDPEARALAATCAG--LRVWSVYVPNGRTPDDPH 118

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+          L    PL   GD+N+ P   D ++P ++      T   R + 
Sbjct: 119 YAYKLAWLGALRDALEVELTGGPPLAVCGDFNVAPTDADVWDPALFTGSTHVTPAERVAL 178

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+++G  D +       H +++WDY A  + +NKG+RID +  S   T  + +A +D 
Sbjct: 179 SALRDLGLADVVPTPMKGPHPFTYWDYRAGMFHQNKGMRIDLVYASAPFTRAVRAAYVDR 238

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R    PSDH P++V  D+
Sbjct: 239 EARKGKGPSDHAPIVVDADL 258


>gi|288960179|ref|YP_003450519.1| exodeoxyribonuclease III [Azospirillum sp. B510]
 gi|288912487|dbj|BAI73975.1| exodeoxyribonuclease III [Azospirillum sp. B510]
          Length = 257

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 115/258 (44%), Positives = 158/258 (61%), Gaps = 4/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS +AR+  +  W++  +PD+   QE K E   FP    + L YH+   GQK
Sbjct: 1   MKIATWNVNSAKARLPLITDWLRAVSPDVALFQEIKCETAAFPRAAFEELGYHVNAVGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LSK    +++T LPG+  D QAR++EAT       +RI +LYLP+GNP+   K
Sbjct: 61  AYNGVALLSKTPAEDVLTRLPGEPEDEQARYVEATVAG----VRIASLYLPNGNPVPGEK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+ R    A   L  E P++  GDYNIIP+  D ++P  +  DA F  E R  F
Sbjct: 117 FAYKLRWMDRLYDHARGLLAREIPVVLGGDYNIIPEARDVFSPQAFAGDALFQPESRAKF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L N+G T+A RA HD    Y+FWDY A  W ++ G+RIDH +LSP+A   L   RID 
Sbjct: 177 RALLNLGLTEAYRALHDDDRAYTFWDYQAGCWPRDNGLRIDHFLLSPQAADRLAGCRIDR 236

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PRG  K SDHTPV++ L
Sbjct: 237 GPRGLEKASDHTPVVLDL 254


>gi|257055607|ref|YP_003133439.1| Exodeoxyribonuclease III [Saccharomonospora viridis DSM 43017]
 gi|256585479|gb|ACU96612.1| Exodeoxyribonuclease III [Saccharomonospora viridis DSM 43017]
          Length = 259

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 75/260 (28%), Positives = 127/260 (48%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  + AW++   PD++CLQE K  D  FP + +  L Y + + G  
Sbjct: 1   MRIATWNVNSITARLPRVLAWLRSTQPDVLCLQELKCSDDGFPRDDITELGYDVASYGAN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILS+    ++   L  +     A    A        +R+ ++Y+P+G       
Sbjct: 61  RWNGVAILSRVGLEDVTRGLVDEPTYEDALHPRAVAATCGG-VRVWSVYVPNGREPDHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++            + P    GD+NI P   D ++  ++ +    T   R++ 
Sbjct: 120 YTYKLRWLEALHTTVLAENSDDRPFAVLGDFNIAPTDDDVWDISLFADSTHVTEPERKAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L++ G TD +         Y++WDY   ++ KN+G+RID +  +      +  A +D 
Sbjct: 180 ARLRDAGLTDVVPRALKYDRPYTYWDYRQLAFPKNRGMRIDLVYANRPFADAVTDAYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V L +
Sbjct: 240 EERKGKGASDHAPVVVDLTL 259


>gi|152968141|ref|YP_001363925.1| exodeoxyribonuclease III Xth [Kineococcus radiotolerans SRS30216]
 gi|151362658|gb|ABS05661.1| exodeoxyribonuclease III Xth [Kineococcus radiotolerans SRS30216]
          Length = 266

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 78/262 (29%), Positives = 127/262 (48%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR+  + AWI  ++ D++ LQETK +D+ FP +  + L Y +   G  
Sbjct: 1   MRLATWNVNSVRARLDRVLAWIDRSDVDVVALQETKCKDEQFPEQAFRDLGYEVAHHGLS 60

Query: 64  SYNGVAILSKYQPIEIVTHL--PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
            +NGVA+LS+    ++ T                          +R+ +LY+P+G  +  
Sbjct: 61  QWNGVALLSRVGLEDVSTAFSPDVPRFGEPPVVEARAVGALCGGVRVWSLYVPNGRGLED 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
             Y  K+ W++R        L  +    +   GD+NI P   D ++P  +      +   
Sbjct: 121 PHYPYKLEWLERLREAGRGWLAQDPAAQVALVGDFNIAPTDEDVWDPEAFAGATHVSAPE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R +F  L   GF D +R        Y++WDY    ++K +G+RID ++ SP   + +  A
Sbjct: 181 RAAFTALVEAGFADVVRPHAPGPGTYTYWDYQQLRFAKRQGMRIDFVLGSPALAARVSGA 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            ID + R     SDH PV+V L
Sbjct: 241 TIDREERKGKGASDHAPVVVEL 262


>gi|323529504|ref|YP_004231656.1| exodeoxyribonuclease III Xth [Burkholderia sp. CCGE1001]
 gi|323386506|gb|ADX58596.1| exodeoxyribonuclease III Xth [Burkholderia sp. CCGE1001]
          Length = 269

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M+ + +AT+N+N IR+R   L  W++   PDI+CLQE K  D  FP + L+   YH    
Sbjct: 1   MATLRIATFNINGIRSRQAALLQWLEREAPDIVCLQELKAADSAFPADALRDAGYHAIWQ 60

Query: 61  GQKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ ++NGVAILSK   P+E    LPG + D  +R++EA        L +  LYLP+GNP 
Sbjct: 61  GQSAWNGVAILSKGEPPLESRRGLPGFEDDTHSRYLEAAVGG----LLVCCLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K++ K+ W    +  A++ L    P++ AGD+N++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFEYKLKWFDHLIDHAAKLLRSGHPVVLAGDFNVVPTDEDIYNPRSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+ +++L   G+TDA+R       +Y+FWDY+   W  N G+RIDHI+LSP+    L  A
Sbjct: 177 RERYRRLVAQGWTDALRTHFGDERVYTFWDYFRRHWDTNSGLRIDHILLSPDLAPRLRDA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQ 270
            +D   RG    SDH P  V LD+   R+K 
Sbjct: 237 GVDRWVRGEPHASDHAPTWVELDMGAKRRKA 267


>gi|126695849|ref|YP_001090735.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9301]
 gi|126542892|gb|ABO17134.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9301]
          Length = 281

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 98/264 (37%), Positives = 145/264 (54%), Gaps = 4/264 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  +  WI + NPDI+CLQETK  D NFP E  + L Y +E  GQK
Sbjct: 1   MLIATWNVNSIRTRLSQIIDWINQVNPDILCLQETKVMDDNFPVEPFEKLGYSLEIYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT----INTQTLRIGNLYLPHGNPI 119
           SYNGVAI+SK +P  +     G     Q   I          +   ++I N+Y+P+G+ +
Sbjct: 61  SYNGVAIISKIKPENVKKGFNGCTESNQNSEIFLDQKRLISADINGIKIINVYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S+K+  KI+W+     F  ++ +  E +   GD+N+ P   D ++P  +E     +   
Sbjct: 121 DSSKFAYKINWLNCLSSFLDEQEKKGELICLMGDFNVAPSNLDIHDPKKYEGGIMASEIE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R + + +      D+ R        +S+WDY  + +  NKG RIDHI +S E TS L S 
Sbjct: 181 RNALKNVLKKRLIDSFRIFEQNTGHWSWWDYRNNGFELNKGWRIDHIYISKELTSKLKSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDI 263
            ID  PRG  +PSDH PV++ L++
Sbjct: 241 VIDCSPRGNLRPSDHAPVMIELNL 264


>gi|311105771|ref|YP_003978624.1| exodeoxyribonuclease III 1 [Achromobacter xylosoxidans A8]
 gi|310760460|gb|ADP15909.1| exodeoxyribonuclease III 1 [Achromobacter xylosoxidans A8]
          Length = 260

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 88/259 (33%), Positives = 136/259 (52%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+  N  D++C+QE K  D  FP        YH    GQK
Sbjct: 1   MKLATWNVNSLNVRLPQVLDWLAANPVDVLCIQELKLTDDKFPEAAFTEAGYHAVWAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+     +V ++PG + D Q R +  TF      +R+   Y P+G  + S K
Sbjct: 61  TYNGVAIISRVPGTSMVRNIPGYE-DPQQRVLALTFPSPEGDVRVVCAYCPNGQAVGSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +    + +  ++    L   GDYN+ P   D +NP  WE     +   R++F
Sbjct: 120 YAYKLDWFEAMRAWLADEIKQYPRLAVLGDYNVAPADEDVHNPEKWEGQVLVSEPERKAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L ++G  D+ R        +S+WDY   ++ +N G+RIDH++LS        +  ID 
Sbjct: 180 GALLDLGLADSFRLFEQPEKSFSWWDYRQFAFRRNAGLRIDHVLLSAPLVKRCIACAIDK 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           +PR   +PSDH PVI +L+
Sbjct: 240 EPRRNEQPSDHAPVIATLE 258


>gi|86605184|ref|YP_473947.1| exodeoxyribonuclease III [Synechococcus sp. JA-3-3Ab]
 gi|86553726|gb|ABC98684.1| exodeoxyribonuclease III [Synechococcus sp. JA-3-3Ab]
          Length = 261

 Score =  215 bits (546), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 92/262 (35%), Positives = 138/262 (52%), Gaps = 3/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNP-DIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           + VATWNVNSIR R+  + AW+ +    D++CLQETK  D  FP    +   +H+E  GQ
Sbjct: 1   MQVATWNVNSIRTRLPQVLAWLDKQGSLDVLCLQETKVVDAEFPRAPFEERGFHVEVYGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEAT-FTINTQTLRIGNLYLPHGNPITS 121
           K+YNGVA++S+  P ++                +        + +RI NLY+P+G  + S
Sbjct: 61  KAYNGVALISREVPEKVERGFAALLPAAAELDEQKRLIGGLYRGIRILNLYVPNGEAVGS 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY  K+ W+     +    L+  +P++  GD+NI P+  D Y+P           E + 
Sbjct: 121 DKYAYKLRWLACLKDYLQVALDQGQPILLCGDFNIAPEDRDIYDPGKAGEIMASEPERQ- 179

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           + QK+  +GF DA R  +     +S+WDY    + KN+G RIDH+ LSP       +  I
Sbjct: 180 ALQKILALGFEDAFRKFNPDPGHFSWWDYRGGGFQKNRGWRIDHLYLSPLLQDKATACWI 239

Query: 242 DTKPRGWTKPSDHTPVIVSLDI 263
           D +PR   KPSDH PV+V L +
Sbjct: 240 DVEPRRAEKPSDHAPVVVELAV 261


>gi|119899170|ref|YP_934383.1| exodeoxyribonuclease III [Azoarcus sp. BH72]
 gi|119671583|emb|CAL95496.1| exodeoxyribonuclease III [Azoarcus sp. BH72]
          Length = 253

 Score =  215 bits (546), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 86/260 (33%), Positives = 138/260 (53%), Gaps = 7/260 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+ ++  W+  N PD +CLQE K EDK FP   LQ+  Y+    GQK
Sbjct: 1   MKIATWNVNSLKVRLPHVLDWLAANQPDALCLQELKLEDKGFPVAELQAAGYNAVFNGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS +   ++V  +PG   + +              +RI   Y P+G  + S K
Sbjct: 61  TYNGVAILSPHPLEDVVRDIPGFSDEQKRIIAATVNG-----VRIVCGYFPNGQAVGSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           ++ K+ W+     +    L     L+  GD+NI P+  D +    W+++   +   R +F
Sbjct: 116 FEYKLRWLGALTEWLRAELTAHPRLVLGGDFNIAPEDRDAHPD--WKDEIHVSAPERAAF 173

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L  +G  DA R        +S+WDY   ++ +N G+RIDH+++SP       +  +D 
Sbjct: 174 TALTALGLVDAFRLYDQPERAFSWWDYRMGAFRRNFGLRIDHLLVSPALQPACRACTVDK 233

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
            PR   +PSDH PV++ L++
Sbjct: 234 APRKLERPSDHAPVVLDLEV 253


>gi|220933200|ref|YP_002512099.1| exodeoxyribonuclease III [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994510|gb|ACL71112.1| exodeoxyribonuclease III [Thioalkalivibrio sp. HL-EbGR7]
          Length = 255

 Score =  215 bits (546), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 85/258 (32%), Positives = 141/258 (54%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+    PD++ LQETK  D  FP E ++   YH    GQK
Sbjct: 1   MKIATWNVNSLKVRLPQVLDWLAAQQPDVLALQETKLTDDAFPVEAIREAGYHCVYSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++++ ++ +T + G D   +              +R+ NLY+ +G+ + S K
Sbjct: 61  TYNGVAILARHELLDPLTDIDGLDDPQRRILAATVDG-----VRVINLYVVNGSEVGSEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+ +   F +  ++  E L+  GD+NI P+  D ++P  W      +   R++ 
Sbjct: 116 YAYKLDWLGKVTGFIAGEMKRHEKLVVLGDFNIAPEDRDVHDPEAWHEKILCSTPEREAL 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +K+ ++G +D  R        +S+WDY A  + +N G+RID I+ SP  T    +  ID 
Sbjct: 176 KKILDLGLSDCFRRFEQPEQSFSWWDYRAAGFRRNLGLRIDLILSSPALTETCTACIIDV 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PR   +PSDH PV+   
Sbjct: 236 EPRRLERPSDHAPVVAEF 253


>gi|148360698|ref|YP_001251905.1| hypothetical protein LPC_2645 [Legionella pneumophila str. Corby]
 gi|296106237|ref|YP_003617937.1| exodeoxyribonuclease III [Legionella pneumophila 2300/99 Alcoy]
 gi|148282471|gb|ABQ56559.1| hypothetical protein LPC_2645 [Legionella pneumophila str. Corby]
 gi|158512142|gb|ABW69103.1| exodeoxyribonuclease III [Legionella pneumophila]
 gi|295648138|gb|ADG23985.1| exodeoxyribonuclease III [Legionella pneumophila 2300/99 Alcoy]
          Length = 256

 Score =  215 bits (546), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 91/261 (34%), Positives = 151/261 (57%), Gaps = 5/261 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           +  +A+WNVNS++ R+  +  W++ +  D++ +QETK  D NFP  +     YH+   GQ
Sbjct: 1   MFKLASWNVNSLKVRLEQVLQWLESSQVDVLAMQETKLTDDNFPVASFTDKGYHVIFSGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVAI+S+Y   +I T +P  +   +              +R+ NLY+P+G  +TS 
Sbjct: 61  KTYNGVAIISRYPMTDIQTDIPELEDPQRRILAATVKG-----IRLINLYVPNGGELTSD 115

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K+ W+K+  RF   +L +   +   GD+NI P+  D ++P+ WE     +   RQ+
Sbjct: 116 KYQYKLDWLKKVTRFIQHQLSIYSKVAVVGDFNIAPEDRDVHDPVEWEGCVLVSPAERQA 175

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F ++  +G  D+ R        +S+WDY A ++ +N+G+RIDH++LS E  +L   ++ID
Sbjct: 176 FMEILELGLHDSFRNFAQEEKAFSWWDYRAAAFRRNRGLRIDHVLLSHELNALCRQSKID 235

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
            +PR   +PSDH PV V L++
Sbjct: 236 KEPRKAERPSDHAPVWVELEL 256


>gi|157412901|ref|YP_001483767.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9215]
 gi|157387476|gb|ABV50181.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9215]
          Length = 281

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 96/266 (36%), Positives = 147/266 (55%), Gaps = 4/266 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  +  WI + NPDI+CLQETK  D +FP E  + L Y +E  GQK
Sbjct: 1   MLIATWNVNSIRTRLSQIIDWINQVNPDILCLQETKVMDDSFPTEPFEKLGYAVEVYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT----INTQTLRIGNLYLPHGNPI 119
           SYNGVAI+SK +P  +     G     Q   I          +   ++I N+Y+P+G+ +
Sbjct: 61  SYNGVAIISKTKPENVKKGFYGCTNFNQNIEIFQDQKRLISADINNIKIINVYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S+K+  KI+W+     F  ++ +  E +   GD+N+ P   D ++P  +E     +   
Sbjct: 121 ESSKFKYKINWLNCLASFLDEQEKKGELICLLGDFNVAPSNLDIHDPKKYEGGIMASEIE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R +   +      D+ R        +S+WDY  +++  NKG RIDHI +S E +S L S 
Sbjct: 181 RNALNNVLKKRLIDSFRIFEQNTGHWSWWDYRNNAFELNKGWRIDHIYISKELSSKLKSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPE 265
            ID  PRG+ +PSDH PV++ L++ +
Sbjct: 241 VIDCSPRGYLRPSDHAPVMIDLNLND 266


>gi|85375417|ref|YP_459479.1| hypothetical protein ELI_12950 [Erythrobacter litoralis HTCC2594]
 gi|84788500|gb|ABC64682.1| hypothetical protein ELI_12950 [Erythrobacter litoralis HTCC2594]
          Length = 262

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 95/259 (36%), Positives = 145/259 (55%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR+  L  W++E  P + CLQE K++D  FP +  + + YH    GQK
Sbjct: 1   MRIATFNINGIKARLPRLIEWLEETRPTVACLQEIKSQDDGFPADEFEKIGYHAIWHGQK 60

Query: 64  SYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           S+NGVAIL+   +P E    L  D               +   +RI  LYLP+GNP    
Sbjct: 61  SFNGVAILADGVKPEETQRGLGVDGPKEGEGEQARYLEAHVNGVRIACLYLPNGNPHPGP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K++W+++      +  + E+P I  GD+N+IP   D ++P   ++DA    E R +
Sbjct: 121 KFDYKLAWMEKLRARMRELWQSEQPTIVTGDFNVIPHDDDVWSPKAMQDDALMQPESRDA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           +Q+    G+TDA+R  +    +++FWDY   +W ++ G RIDH +LSPE    L +  +D
Sbjct: 181 YQRQLADGWTDAVRTLNPRGGVWTFWDYQRGAWQRDHGFRIDHCLLSPELADRLTAVGVD 240

Query: 243 TKPRGWTKPSDHTPVIVSL 261
              RG  K SDHTPV V L
Sbjct: 241 KDYRGREKASDHTPVWVEL 259


>gi|71909260|ref|YP_286847.1| exodeoxyribonuclease III [Dechloromonas aromatica RCB]
 gi|71848881|gb|AAZ48377.1| Exodeoxyribonuclease III [Dechloromonas aromatica RCB]
          Length = 254

 Score =  214 bits (545), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 82/258 (31%), Positives = 131/258 (50%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS++ R+ +L  W+    PD +CLQE K ED NFP   +++  Y +   GQK
Sbjct: 1   MKIASWNVNSLKVRLPHLLDWLAAAQPDALCLQELKLEDHNFPRAEIEAAGYQVAFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+L++    +++   P    + +               R+   Y+P+G  + S K
Sbjct: 61  TYNGVALLARQPIHDVICGNPHFPDEQKRLISGTVGDT-----RVVCAYMPNGQAVGSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K+ W+     +  + +     L   GDYNI P   D ++P  W  +   +   R +F
Sbjct: 116 YDYKLRWLDALAVWLGEEMSKYPKLALCGDYNIAPDDRDVHDPKAWAGNILCSEPERAAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q+   +G  D+ R        +S+WDY    + KN G+RIDH++LS    +   +A ID 
Sbjct: 176 QRFIGLGLNDSFRLFEQPEKTFSWWDYRMLGFQKNLGLRIDHVLLSAPLAAKCSAAGIDR 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV   +
Sbjct: 236 APRKLERPSDHAPVWAEI 253


>gi|237747770|ref|ZP_04578250.1| exodeoxyribonuclease III [Oxalobacter formigenes OXCC13]
 gi|229379132|gb|EEO29223.1| exodeoxyribonuclease III [Oxalobacter formigenes OXCC13]
          Length = 255

 Score =  214 bits (545), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 99/260 (38%), Positives = 146/260 (56%), Gaps = 5/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+ ++  W+++N  D++CLQETK  D  FP   + +  Y +   GQK
Sbjct: 1   MKIATWNVNSLKVRLPHVLQWLEDNPVDVLCLQETKLTDDKFPVMEIGAAGYQVAFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILSK    +IV + P    + Q              +RI   Y+P+G  + S K
Sbjct: 61  TYNGVAILSKKPVTDIVKNNPLFPDEQQRIVAAT-----VDNIRIVCAYVPNGQAVGSEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++   ++ ++  +    L   GDYNI P+  D Y+P+ WE +   +   R +F
Sbjct: 116 YSYKLDWLRSLTQWLAEERQKHPYLALLGDYNIAPEDRDVYDPVAWEGNVLVSPPERDAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + LQ++ F DA R        YS+WDY    + KN+G+RIDHI+LS        +  ID 
Sbjct: 176 RALQDIDFIDAYRLFEQPEKSYSWWDYRQLGFQKNRGLRIDHILLSKALAPHCTACTIDR 235

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
            PR WT+PSDHTPVI  LDI
Sbjct: 236 IPRKWTQPSDHTPVIAELDI 255


>gi|53802810|ref|YP_115457.1| exodeoxyribonuclease III [Methylococcus capsulatus str. Bath]
 gi|53756571|gb|AAU90862.1| exodeoxyribonuclease III [Methylococcus capsulatus str. Bath]
          Length = 256

 Score =  214 bits (545), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 88/259 (33%), Positives = 135/259 (52%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+  +  W+    P ++ +QETK  D  FP E L+++ YH    GQK
Sbjct: 1   MKIATWNVNSLRVRLPQVLDWLDSVQPGVLAVQETKLTDDAFPVEALRAVGYHAVYSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LSK    +++T  P  D   +         +    LRI NLY+P+G+ + S K
Sbjct: 61  TYNGVAVLSKAPVEDVLTDPPNLDDPQRRIL-----AVTAGPLRIINLYVPNGSEVGSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+ +   F ++ +      +  GD+NI P+  D ++P  W      +   R +F
Sbjct: 116 YAYKLDWLAKVRDFIAEEMAAHPHTVVLGDFNIAPEDRDVHDPESWREKILCSTPERDAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +    +G +D  R        +S+WDY A  + +N G+RIDHI+ S        +  ID 
Sbjct: 176 RAWAGLGLSDLFRRFEQPEGSFSWWDYRAAGFRRNLGLRIDHILASLPLAGRCTACSIDK 235

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR   +PSDH PVI   D
Sbjct: 236 TPRSLERPSDHAPVIAEFD 254


>gi|254293701|ref|YP_003059724.1| exodeoxyribonuclease III Xth [Hirschia baltica ATCC 49814]
 gi|254042232|gb|ACT59027.1| exodeoxyribonuclease III Xth [Hirschia baltica ATCC 49814]
          Length = 259

 Score =  214 bits (545), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 117/260 (45%), Positives = 163/260 (62%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+ AR+  +   +K    D++C QE K  D NFP   ++ + Y+I T GQK
Sbjct: 1   MKIASWNVNSVNARLPTVLEVLKNLELDVVCFQEIKCIDDNFPRLEIEDMGYNIITHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAILSK+   ++   LPGDD D QAR+IEA     T  +R+ ++YLP+GNP    K
Sbjct: 61  SYNGVAILSKHPIEDVQIGLPGDDEDDQARYIEALIMGETP-VRVASIYLPNGNPFPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W+ R    A + L  EE ++ AGDYN IP+  DCY+P  W +DA    E R  F
Sbjct: 120 FDYKLAWMDRLNARAKELLSYEEAVVLAGDYNCIPRDEDCYDPAAWVDDALAQPETRGKF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++LQ MG+T+   A  +  H Y+FWDY A +W K+ GIRIDH++ SP+A   L S  I  
Sbjct: 180 RELQWMGYTEGFAARDNRGHQYTFWDYQAGAWQKDNGIRIDHLLCSPQAADKLKSVSIYK 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             RG TKPSDH P+I   ++
Sbjct: 240 DARGMTKPSDHVPIIGEFEL 259


>gi|300312415|ref|YP_003776507.1| exodeoxyribonuclease III protein [Herbaspirillum seropedicae SmR1]
 gi|300075200|gb|ADJ64599.1| exodeoxyribonuclease III protein [Herbaspirillum seropedicae SmR1]
          Length = 255

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 94/258 (36%), Positives = 143/258 (55%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W++EN  D++CLQETK  D  FP   + +  Y +E  GQK
Sbjct: 1   MKIATWNVNSLKVRLPQVLKWLEENPVDVLCLQETKLTDDKFPAAEIAAAGYLVEFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS++   ++V + P    + Q              +R    Y+P+G  + S K
Sbjct: 61  TYNGVAILSRHPMNDVVKNNPLFPDEQQRIIAATIEG-----VRYVCAYIPNGQSLESEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+     + +Q       L   GDYNI P+  D ++P+ W+     +   R++F
Sbjct: 116 YPYKLNWLAALHEWLAQEKAKNPRLALLGDYNIAPEDRDVHDPVAWQGQVLVSEPEREAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +KLQ +G TD+ R       +YS+WDY    +  N+G+RIDHI+LS E      +  ID 
Sbjct: 176 RKLQALGLTDSYRLFEQPEKMYSWWDYRQMGFRLNRGLRIDHILLSEELVPRCTACVIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDH PVI +L
Sbjct: 236 VPRKWEQPSDHAPVIATL 253


>gi|254413694|ref|ZP_05027463.1| exodeoxyribonuclease III [Microcoleus chthonoplastes PCC 7420]
 gi|196179291|gb|EDX74286.1| exodeoxyribonuclease III [Microcoleus chthonoplastes PCC 7420]
          Length = 264

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 94/263 (35%), Positives = 138/263 (52%), Gaps = 4/263 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R  ++  W+  N  D++CLQETK  D+ FP    + L YH+   GQK
Sbjct: 1   MKIATWNVNSIRTRQDHVCQWLTANPVDVLCLQETKVVDEQFPRSRFEDLGYHLYVSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT---QTLRIGNLYLPHGNPIT 120
           SYNGVA+ S+     +     G     +   ++    + T     +RI NLY+P+G  + 
Sbjct: 61  SYNGVALFSRKPLEAVTVGFTGVLTPEEVGELDGQKRLITGILDGVRIINLYVPNGAEVG 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPL-IFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           S KY+ K+SW+K    +    LE +       GD+NI P   D +NP   +     +   
Sbjct: 121 SEKYEYKLSWLKLLKEYVRSLLETQPHELCICGDFNIAPDDRDIHNPKNKDKHIMASPAE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           RQ+ +++  +G  DA R        +S+WDY    +S+N+G RIDH  L+P+        
Sbjct: 181 RQALEEVLALGLGDAFRKFTQDGGHFSWWDYRHGGFSRNRGWRIDHHYLTPKLYEAATRC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLD 262
           RID +PR   KPSDH PVIV  +
Sbjct: 241 RIDVEPRKLEKPSDHAPVIVEFE 263


>gi|325982581|ref|YP_004294983.1| exodeoxyribonuclease III Xth [Nitrosomonas sp. AL212]
 gi|325532100|gb|ADZ26821.1| exodeoxyribonuclease III Xth [Nitrosomonas sp. AL212]
          Length = 261

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 92/259 (35%), Positives = 143/259 (55%), Gaps = 5/259 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           V+ +ATWNVNS++ R+  +  W+  + PD++CLQE K  ++NFP   +++  Y     GQ
Sbjct: 2   VMKLATWNVNSLKVRLPQVIDWLVAHQPDVLCLQEIKLINENFPINEIKAAGYESVFAGQ 61

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVAILSK Q   IVT +PG   + +              LR+   Y+P+G  + S 
Sbjct: 62  KTYNGVAILSKRQGSNIVTAIPGLADEQKRVIAATYGD-----LRVICAYVPNGENVESE 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY+ K+ W+  F ++  Q L   + L   GD+NI P+  D Y+  +W+     +   R +
Sbjct: 117 KYEYKLCWLPAFTQWLKQELIDYKRLAVLGDFNIAPEDRDVYDAELWKGKVLCSEPERSA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F  + N+G  D+ R        Y++WDY   ++ +N+G+RIDHI+LS E  +   +  ID
Sbjct: 177 FGNMLNLGLADSFRLFEQPEKSYTWWDYRMLAFRRNQGLRIDHILLSEELCNACVTCAID 236

Query: 243 TKPRGWTKPSDHTPVIVSL 261
              R   +PSDH PV+V L
Sbjct: 237 KTMRKLERPSDHAPVLVEL 255


>gi|254454283|ref|ZP_05067720.1| exodeoxyribonuclease III [Octadecabacter antarcticus 238]
 gi|198268689|gb|EDY92959.1| exodeoxyribonuclease III [Octadecabacter antarcticus 238]
          Length = 266

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 119/265 (44%), Positives = 159/265 (60%), Gaps = 6/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N ++ARI  L  W++ + PD+  LQE K+ D+ FP E +Q L Y +ET GQK
Sbjct: 1   MKIATFNINGVKARIGALTDWLEASKPDVALLQEIKSVDEGFPREHIQDLGYTVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT------QTLRIGNLYLPHGN 117
            +NGVAILSK    ++   LP  +   +    +             + +RI  LYLP+GN
Sbjct: 61  GFNGVAILSKLPLEDVTRGLPDPEGAGRDGEDDIEARYIEATVMGEKAIRICGLYLPNGN 120

Query: 118 PITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTL 177
           P    KYD K+ W+ R    ASQ +ELEEP + AGDYNIIPQP D   P +W +DA F  
Sbjct: 121 PAPGPKYDYKLHWMDRLKARASQLIELEEPFLIAGDYNIIPQPEDAARPDVWADDALFRP 180

Query: 178 EVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLH 237
           + R +F++L N+G T+A RA H     YSFWDY A +W KN GIRIDH +LS +   LL 
Sbjct: 181 DSRAAFRRLLNLGLTEAFRACHQGSGHYSFWDYQAGAWDKNDGIRIDHFLLSNQCADLLK 240

Query: 238 SARIDTKPRGWTKPSDHTPVIVSLD 262
              I++  RG  KPSDH PV V LD
Sbjct: 241 DCWIESDVRGREKPSDHVPVWVELD 265


>gi|54027277|ref|YP_121519.1| putative exonuclease [Nocardia farcinica IFM 10152]
 gi|54018785|dbj|BAD60155.1| putative exonuclease [Nocardia farcinica IFM 10152]
          Length = 303

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 76/276 (27%), Positives = 127/276 (46%), Gaps = 11/276 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR+R+  +  W+ E++ D++ +QETK  D  FPFE    L Y +   G  
Sbjct: 7   LRLATWNVNSIRSRLDRVTTWLDEHDIDVLAMQETKCRDDQFPFERFAELGYEVAHLGVN 66

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQ---------ARFIEATFTINTQTLRIGNLYLP 114
            +NGVAI S+    +I    PG     +                       +R+ +LY+P
Sbjct: 67  QWNGVAIASRVGLADIAPAFPGQPGFDKDAADSLISAPVVESRALAATCGGVRVWSLYVP 126

Query: 115 HGNPITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWEND 172
           +G  +    Y  K+ W+      A+  L  +    +   GD+NI P   D ++   +   
Sbjct: 127 NGRALDDPHYAYKLEWLAALRASAADWLAADPAAKIALVGDWNIAPTDDDVWSVEFFAGK 186

Query: 173 ACFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEA 232
              +   R +F  + + GF D +R       +Y++WDY    + + +G+RID ++ SP  
Sbjct: 187 THTSQPERDAFAAILDTGFADVMRPFAPGPGVYTYWDYTRLRFPRKEGMRIDFVLASPAL 246

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLDIPEPRK 268
            + +  A +D + R     SDH PVI   D+ +   
Sbjct: 247 AATVVDAGVDREARKGKGASDHAPVIAEFDLGDAPP 282


>gi|328886193|emb|CCA59432.1| Exodeoxyribonuclease III [Streptomyces venezuelae ATCC 10712]
          Length = 271

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 77/263 (29%), Positives = 132/263 (50%), Gaps = 1/263 (0%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           ++++ +ATWNVNSI AR+  L AW++ +  D++C+QETK   + FP E L++L Y     
Sbjct: 8   LALMRIATWNVNSITARLPRLLAWLESSGTDVLCVQETKCTAEQFPTEELRALGYESVVN 67

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
               +NGVA++S+    ++VT LPG           A        +R+ ++Y+P+G  + 
Sbjct: 68  ATGRWNGVALVSRVGLADVVTGLPGGPEYDGMDEPRAISATCGP-VRVWSVYVPNGREVA 126

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
              Y  K+ W++      ++    + P    GDYNI P   D ++   +E     T   R
Sbjct: 127 HEHYAYKLRWLEALKAAVAEDAAGDRPFAVLGDYNIAPTDDDVWDRAAFEGLTHVTEPER 186

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +   L+  G +D +       H +++WDY    + KN+G+RID +  +      +  + 
Sbjct: 187 AALAGLREAGLSDVVPRPLKYDHPFTYWDYRQLCFPKNRGMRIDLVYGNKPFAEAVTDSY 246

Query: 241 IDTKPRGWTKPSDHTPVIVSLDI 263
           +D + R     SDH PV+V LD+
Sbjct: 247 VDREERKGKGASDHAPVVVDLDV 269


>gi|302877385|ref|YP_003845949.1| exodeoxyribonuclease III Xth [Gallionella capsiferriformans ES-2]
 gi|302580174|gb|ADL54185.1| exodeoxyribonuclease III Xth [Gallionella capsiferriformans ES-2]
          Length = 255

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 90/258 (34%), Positives = 140/258 (54%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+  N  D++CLQETK +D +FP   L +  YH    GQK
Sbjct: 1   MKLATWNVNSLKVRLPQVLDWLAANPVDVLCLQETKQQDADFPDTELAAAGYHTVFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+   I++   +PG + + +              +R+ ++Y+P+G    S K
Sbjct: 61  TYNGVAILSREAAIDVQIGIPGFEDEQKRVIAATFGD-----IRVVDVYIPNGQSPDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+     +  + L     L+  GDYNI P+  D ++P  W  +   +   R +F
Sbjct: 116 YQYKLGWLAALHDWLKEELVRYPKLVLLGDYNIAPEDRDVHDPAAWVGNVLVSPPERDAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L  +G TD+ R        +S+WDY    + +N G+RIDHI++S    +   S  ID 
Sbjct: 176 KSLLALGLTDSYRLFEQADKTFSWWDYRMMGFRRNLGMRIDHILISAPLVAQCKSCIIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDHTPV+V L
Sbjct: 236 APRKLERPSDHTPVVVEL 253


>gi|284053675|ref|ZP_06383885.1| exodeoxyribonuclease III [Arthrospira platensis str. Paraca]
 gi|291570470|dbj|BAI92742.1| exodeoxyribonuclease III [Arthrospira platensis NIES-39]
          Length = 263

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 93/261 (35%), Positives = 139/261 (53%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R   +  W++  + D++CLQETK  D++FP    + L YH+   GQK
Sbjct: 1   MKIATWNVNSIRTRQDQVLGWLQGQDIDVLCLQETKVIDQDFPRSPFEELGYHVYIYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT---QTLRIGNLYLPHGNPIT 120
           +YNGVAI S+     I+          +   ++    +       + I N+Y+P+G+ + 
Sbjct: 61  AYNGVAIFSRLNIESIIMGFTPILSADKVGDLDDQKRVIAGVIDDICIINVYIPNGSSVG 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           S KY+ K+ W+ R   +  Q L     L   GD+NI P+  D YNP   EN    +   R
Sbjct: 121 SDKYEYKLQWLNRLRDYLQQMLIKYPHLCICGDFNIAPEDRDIYNPQNRENHIMASAAER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           Q+   + N+G  D  R        +++WDY A S+++N+G RIDH  LSP       +  
Sbjct: 181 QALDAIANLGLADGFRKFTQDGGHFTWWDYRAASFTRNRGWRIDHHYLSPGLYENAIACY 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           IDT+PR   KPSDH PVI+ +
Sbjct: 241 IDTEPRTQPKPSDHAPVILEI 261


>gi|56751512|ref|YP_172213.1| exodeoxyribonuclease III [Synechococcus elongatus PCC 6301]
 gi|81301416|ref|YP_401624.1| exodeoxyribonuclease III [Synechococcus elongatus PCC 7942]
 gi|56686471|dbj|BAD79693.1| exodeoxyribonuclease III [Synechococcus elongatus PCC 6301]
 gi|81170297|gb|ABB58637.1| Exodeoxyribonuclease III [Synechococcus elongatus PCC 7942]
          Length = 265

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 98/262 (37%), Positives = 145/262 (55%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R+R+ +L  W+ +   DI+CLQETK  D+ FP E LQ+L YH    GQK
Sbjct: 1   MRIATWNVNSVRSRLEHLQRWLTDQTLDIVCLQETKVVDEQFPLEPLQALGYHCAIAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP---GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           SYNGVAILS+    ++        G +        +   +  +  LRI NLY+P+G+ + 
Sbjct: 61  SYNGVAILSRQPLADVQIGFGAVLGAEAVGDLDEQKRVISGRSGDLRIINLYVPNGSELG 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTL-EV 179
           S KYD K+ W+    ++ +   + E  +   GD+NI  +  D Y+P   E     +  E 
Sbjct: 121 SEKYDYKLRWLTCLQQYLTVLGDRESQIHICGDFNIALEDRDIYDPAGKETHIMSSPTER 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
               Q + ++GF DA R        +S+WDY   ++ +N+G RIDH  LS  A +   + 
Sbjct: 181 EALRQSVLSLGFVDAFRLFEAGADQFSWWDYRTGAFRRNRGWRIDHHYLSESAKARAIAC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            ID +PR W KPSDHTPV++ L
Sbjct: 241 HIDREPRTWEKPSDHTPVVLEL 262


>gi|297563086|ref|YP_003682060.1| exodeoxyribonuclease III Xth [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296847534|gb|ADH69554.1| exodeoxyribonuclease III Xth [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 275

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 82/262 (31%), Positives = 129/262 (49%), Gaps = 3/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS RAR   + AW+  ++ D++ +QETK  D  FP   L    Y +   G  
Sbjct: 1   MRIATWNVNSARARAERIGAWLDRSDVDVLAIQETKARDDQFPASVLTDRGYEVAHHGLS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT-LRIGNLYLPHGNPITST 122
            +NGVAI S+    ++    PG          EA     T   +++ +LY+P+G  +   
Sbjct: 61  QWNGVAIASRVGLEDVRIGFPGQPGYGDPEEAEARAIGATCGGVQVWSLYVPNGREVDHP 120

Query: 123 KYDDKISWIKRFLRFASQRL--ELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
            Y  K+ W++      +  L  +    + + GD+NI P+  D ++   +E     T   R
Sbjct: 121 HYAYKLRWLEALREAGAASLAADPGAQIAYVGDFNIAPRDEDVWDMAAFEGSTHVTEPER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +F KL   GF + +RA      +Y++WDY   ++ K +G+RID ++ SP     +  A 
Sbjct: 181 VAFDKLVGAGFDEVVRAYTPGPGVYTYWDYKGLAFPKRRGMRIDFVLASPALRDRVSGAS 240

Query: 241 IDTKPRGWTKPSDHTPVIVSLD 262
           ID + R     SDH PVIV LD
Sbjct: 241 IDREERKGKGASDHAPVIVGLD 262


>gi|253997518|ref|YP_003049582.1| exodeoxyribonuclease III Xth [Methylotenera mobilis JLW8]
 gi|253984197|gb|ACT49055.1| exodeoxyribonuclease III Xth [Methylotenera mobilis JLW8]
          Length = 256

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 93/259 (35%), Positives = 141/259 (54%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+ ++  W+  N PD++CLQETK ED  FP+     L YH    GQK
Sbjct: 1   MKLATWNVNSLNVRLPHVLDWLTANQPDVLCLQETKQEDSKFPYAAFSELGYHAVHIGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS++  + +  ++P  + D Q              +R+   Y+P+G  + S K
Sbjct: 61  TYNGVAILSRHPILNVQRNIPDFEDDQQRVLAADING-----VRMVCAYIPNGQAVDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+     +    L     L   GDYNI P+  DC++P  WE     +   R++F
Sbjct: 116 YQYKMRWLSALNAWLKTELTQHAKLALLGDYNIAPEDRDCHDPAAWEGQILVSPLEREAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L ++G +D+ R        +S+WDY    + +N G+RIDHI++S     L  +A ID 
Sbjct: 176 NHLVSLGLSDSFRLFEQPEKSFSWWDYRMMGFRRNLGMRIDHILVSDALKVLCAAAYIDK 235

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR   +PSDHTPV++ L+
Sbjct: 236 APRKLERPSDHTPVVLELN 254


>gi|329940384|ref|ZP_08289665.1| exonuclease [Streptomyces griseoaurantiacus M045]
 gi|329300445|gb|EGG44342.1| exonuclease [Streptomyces griseoaurantiacus M045]
          Length = 259

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 79/260 (30%), Positives = 128/260 (49%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++C+QE KT ++ FP E L+ L Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCVQEAKTTEEQFPSEALRELGYESAVHATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA++S+    ++V  LPGD      +   A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVVSRVGLEDVVKGLPGDPGYEGVQEPRAVSATCGP-VRVWSVYVPNGREVDHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +      +     + P    GDYN+ P   D Y+   +E     T   R + 
Sbjct: 120 YAYKLQWFEALRAAVAGDAAGDRPFAVLGDYNVAPTDEDVYDRAAFEGSTHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G TD +       H Y++WDY    + KN+G+RID +  +      +  A +D 
Sbjct: 180 ASLREAGLTDVVPRPLKYDHPYTYWDYRQLCFPKNRGMRIDLVYGNEPFAKAVQDAYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V L++
Sbjct: 240 EERKGKGASDHAPVVVDLEV 259


>gi|91774528|ref|YP_544284.1| exodeoxyribonuclease III [Methylobacillus flagellatus KT]
 gi|91708515|gb|ABE48443.1| Exodeoxyribonuclease III [Methylobacillus flagellatus KT]
          Length = 255

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 89/258 (34%), Positives = 135/258 (52%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  WI    PD++CLQETK ED  FPF+ L+   Y+    GQK
Sbjct: 1   MKLATWNVNSLNVRLPQVLDWIAVEKPDVLCLQETKQEDSKFPFDALKEAGYNAVHSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS ++  ++   +PG + + +              +RI   Y+P+G  + S K
Sbjct: 61  TYNGVAILSPHEIEDVTYGIPGLNDEQKRLVAATIND-----IRIVCAYIPNGQSLDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++    +    L     L   GDYNI P+  D ++P+ W      +   R +F
Sbjct: 116 YQYKLGWLEALTAYLKTELAAHPKLALLGDYNIAPEDRDVHDPVAWAGQVLVSEPERAAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + +  +G  D  R        +S+WDY    + +N G+RIDHI++S    S      ID 
Sbjct: 176 RAIMALGLHDGFRLFDQEPDSFSWWDYRMAGFRRNLGLRIDHILVSEALKSECMRCWIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDHTPV++ L
Sbjct: 236 GPRKLERPSDHTPVVLQL 253


>gi|170692673|ref|ZP_02883835.1| exodeoxyribonuclease III Xth [Burkholderia graminis C4D1M]
 gi|170142329|gb|EDT10495.1| exodeoxyribonuclease III Xth [Burkholderia graminis C4D1M]
          Length = 268

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 104/271 (38%), Positives = 152/271 (56%), Gaps = 5/271 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M+ + +AT+N+N IR+R   L  W++   PDI+CLQE K  D  FP + ++   YH    
Sbjct: 1   MATLRIATFNINGIRSRQTALLQWLEREAPDIVCLQELKAADSAFPADAVRDAGYHAIWH 60

Query: 61  GQKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ ++NGVAILSK   P+E    LPG + D  +R++E         L +  LYLP+GNP 
Sbjct: 61  GQSAWNGVAILSKGEAPLESRRGLPGFEADTHSRYLEVAVDG----LLVCCLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K++ K+ W    +  A+  L+   P++ AGD+N++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFEYKLKWFDHLIDHAANLLKSGHPVVLAGDFNVVPTDEDIYNPRSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+ +++L   G+TD++R       +Y+FWDY+   W  N G+RIDHI+LSP+    L  A
Sbjct: 177 RERYRRLLAQGWTDSLRTHFGDERVYTFWDYFRRHWDTNSGLRIDHILLSPDLAPRLRDA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQ 270
            +D   RG    SDH P  V LD+   R+K 
Sbjct: 237 GVDRWVRGEPHASDHAPTWVELDMSARRRKT 267


>gi|197103425|ref|YP_002128803.1| exodeoxyribonuclease III [Phenylobacterium zucineum HLK1]
 gi|196480701|gb|ACG80228.1| exodeoxyribonuclease III [Phenylobacterium zucineum HLK1]
          Length = 262

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 105/260 (40%), Positives = 163/260 (62%), Gaps = 5/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN +  R+  L  W++E  PD++CLQE K   + FP E ++   Y     GQK
Sbjct: 1   MRIATFNVNGVNGRLPVLLRWLEETRPDVVCLQELKAPQERFPAEAIERAGYGAIWAGQK 60

Query: 64  SYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           S+NGVA+L++  +P+EI   LPGD  D+Q+R++EA        + +  LY P+GNP    
Sbjct: 61  SWNGVAMLARGAEPVEIRRGLPGDTEDLQSRYLEAAVEG----VLVACLYAPNGNPAPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K++W+ R  R A++ ++   P + AGD+NIIP   D Y P  W +DA F  E R +
Sbjct: 117 KFDYKLAWLARLNRRAAELVKTCTPAVLAGDFNIIPTELDAYKPERWVDDALFRPESRAA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F+ L + G+ DA+R+ H    +++FWDY+ +++ ++ G+RIDH++LSP  +S L +A +D
Sbjct: 177 FEALLDQGWRDALRSLHPAERIFTFWDYFRNAFPRDAGLRIDHLLLSPTLSSRLVAAGVD 236

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              RGW K SDH PV V L+
Sbjct: 237 RHVRGWAKTSDHAPVWVELE 256


>gi|329850335|ref|ZP_08265180.1| exodeoxyribonuclease III [Asticcacaulis biprosthecum C19]
 gi|328840650|gb|EGF90221.1| exodeoxyribonuclease III [Asticcacaulis biprosthecum C19]
          Length = 262

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 119/262 (45%), Positives = 163/262 (62%), Gaps = 5/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+ AR+  L  W +E  PD+  LQE K  D+ FP E  +SL Y+    GQK
Sbjct: 1   MKLATWNVNSVNARLPLLLEWFREAAPDVCALQEIKCIDEKFPIEAFESLGYNCAVFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVAILSK+   ++   LPGDD D Q+R+IEA      Q +R   +YLP+GNP+ + K
Sbjct: 61  TWNGVAILSKFPLSDVTKGLPGDDSDEQSRYIEALVEAP-QPVRFVGIYLPNGNPLGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++R    A+Q L LEE  I  GD+NIIP   DC+   +W +DA +   VRQ++
Sbjct: 120 FAYKLRWLERLHARAAQLLTLEEATIITGDFNIIPTKADCWKESVWLDDALYQPAVRQAY 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L+N+G+TDA        + Y+FWDY A +W KN+GIRIDH +LSP+A   L+   I  
Sbjct: 180 QGLKNLGYTDAFDVMPPEGNRYTFWDYQAGAWQKNEGIRIDHHLLSPQAADRLNGLVIHK 239

Query: 244 KPRGWT----KPSDHTPVIVSL 261
             RG T    KPSDH PV + L
Sbjct: 240 DTRGRTHDEAKPSDHVPVEIEL 261


>gi|37526441|ref|NP_929785.1| exonuclease III [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36785872|emb|CAE14923.1| Exodeoxyribonuclease III (exonuclease III) (EXO III) (AP
           endonuclease VI) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 268

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 86/268 (32%), Positives = 129/268 (48%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D+ FP E +  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDEAFPLEEVGKLGYHVFYYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           ++ GVA+L++  P+ +    PGDD + Q R I A        L + N Y P G       
Sbjct: 61  AHYGVALLTRQVPLAVYRGFPGDDEEAQRRVIMAEVETPHGLLTVINGYFPQGENREHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWE------NDACFT 176
           K+  K  + +    +  Q L  +  +I  GD NI P   D       +          F 
Sbjct: 121 KFPAKEKFYQDLQNYLEQNLTPQSHVIIMGDMNISPTDLDIGIGENNQKRWLKTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R    +L+N G  D  R  +   +  +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEERDWMDRLKNWGLVDTFRHLNPECNDQFSWFDYRSKGFDDNRGLRIDLLLASKPLMDR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID K R   KPSDH PV    +I
Sbjct: 241 CIATGIDYKIREMEKPSDHAPVWAEFEI 268


>gi|264679401|ref|YP_003279308.1| exodeoxyribonuclease III Xth [Comamonas testosteroni CNB-2]
 gi|262209914|gb|ACY34012.1| exodeoxyribonuclease III Xth [Comamonas testosteroni CNB-2]
          Length = 260

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 142/260 (54%), Gaps = 1/260 (0%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
            + +ATWNVNS+  R+  +  W+  N  D + LQE K  D  FP    +   Y   + GQ
Sbjct: 2   TMKIATWNVNSLSVRLPQVLDWLAANPVDALGLQELKLTDDKFPHMAFEEAGYKAVSHGQ 61

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVA +++    ++V ++PG D D QAR I  T       +R+ N Y  +G    S 
Sbjct: 62  KTYNGVAWITRDTGRDVVRNIPGLD-DEQARIIATTIDSPNGEIRLINGYFVNGQEPGSE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+  K+ W++    +   ++ L   L+  GD+N+ P+  D Y+P+  ++    T+E R  
Sbjct: 121 KFAYKMRWLQALHDWIQNQMTLHPRLVLVGDFNVAPEDRDSYDPVGLKDTIHHTVEERDH 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           FQ+L  +G +DA R        YS+WDY    + KN+G+RIDHI++S    S + +  +D
Sbjct: 181 FQRLLQLGLSDAFRMFEQPEKSYSWWDYRMLGFQKNRGLRIDHILVSEALKSKVSACSVD 240

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
             PR   +PSDH PV+V+LD
Sbjct: 241 RAPRKNKQPSDHAPVVVTLD 260


>gi|54296672|ref|YP_123041.1| hypothetical protein lpp0703 [Legionella pneumophila str. Paris]
 gi|53750457|emb|CAH11851.1| hypothetical protein lpp0703 [Legionella pneumophila str. Paris]
          Length = 256

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 91/261 (34%), Positives = 151/261 (57%), Gaps = 5/261 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           +  +A+WNVNS++ R+  +  W++ +  D++ +QETK  D+NFP  +     YH+   GQ
Sbjct: 1   MFKLASWNVNSLKVRLEQVLQWLESSQVDLLAMQETKLTDENFPVASFTDKGYHVIFSGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVAI+S+Y   +I T +P  +   +              +R+ NLY+P+G  +TS 
Sbjct: 61  KTYNGVAIISRYPMTDIQTDIPELEDPQRRILAATVKG-----IRLINLYVPNGGELTSD 115

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K+ W+ +  RF   +L +   +   GD+NI P+  D ++P+ WE     +   RQ+
Sbjct: 116 KYQYKLDWLNKVTRFIENQLSIYSKVAVVGDFNIAPEDRDVHDPVEWEGCVLVSPAERQA 175

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F K+  +G  D+ R        +S+WDY A ++ +N+G+RIDH++LS E  +L   ++ID
Sbjct: 176 FMKILELGLHDSFRNFAQEEKAFSWWDYRAAAFRRNRGLRIDHVLLSHELNALCRQSKID 235

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
            +PR   +PSDH PV V L++
Sbjct: 236 KEPRKAERPSDHAPVWVELEL 256


>gi|307726281|ref|YP_003909494.1| exodeoxyribonuclease III Xth [Burkholderia sp. CCGE1003]
 gi|307586806|gb|ADN60203.1| exodeoxyribonuclease III Xth [Burkholderia sp. CCGE1003]
          Length = 269

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 108/271 (39%), Positives = 154/271 (56%), Gaps = 5/271 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M+ + +AT+N+N IR+R   L  W++   PDI+CLQE K  D  FP + L+  +YH    
Sbjct: 1   MATLRIATFNINGIRSRQAALVQWLEREAPDIVCLQELKAADSAFPADALRDADYHAIWH 60

Query: 61  GQKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ ++NGVAILSK   P+E    LPG + D  +R++EA        L +  LYLP+GNP 
Sbjct: 61  GQSAWNGVAILSKGEAPLESRRGLPGFEADTHSRYLEAAVGG----LLVCCLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K++ K+ W    +  A+  L+   P++ AGD+N++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFEYKLKWFDHLIEHAANLLKSGHPVVLAGDFNVVPTDEDIYNPRSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+ +Q+L   G+TD++R       +Y+FWDY+   W  N G+RIDHI+LSPE    L  A
Sbjct: 177 RERYQRLLAQGWTDSLRKHFGDERVYTFWDYFRRHWDTNSGLRIDHILLSPELAPRLRDA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQ 270
            +D   RG    SDH P  V LD+   R+K 
Sbjct: 237 GVDRWVRGEAHASDHAPTWVELDMSARRRKT 267


>gi|241765066|ref|ZP_04763058.1| exodeoxyribonuclease III Xth [Acidovorax delafieldii 2AN]
 gi|241365303|gb|EER60125.1| exodeoxyribonuclease III Xth [Acidovorax delafieldii 2AN]
          Length = 258

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 96/259 (37%), Positives = 135/259 (52%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS+  R+  + AW+  N  D +CLQE K  D  FPF  LQ   YH    GQK
Sbjct: 1   MQLATWNINSLSVRLPQVVAWLAANPVDALCLQELKLTDDKFPFAALQEAGYHAVAMGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+    ++V ++PG D         AT    T  +R+ N Y  +G    S K
Sbjct: 61  TYNGVAILSRSPLRDVVRNIPGHDDQQARVI-AATMDTATGPVRLVNCYFVNGQEPGSEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++    +    L     L   GD+N+ P+  D Y+P+        T E R  F
Sbjct: 120 FAYKMRWLQALHDWLRTELAAHPRLALLGDFNVAPEDRDSYDPVGLRETIHHTTEERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA R        YS+WDY    + KN+G+RIDHI++S      + +  ID 
Sbjct: 180 QALLALGLTDAYRMFEQPEKAYSWWDYRMLGFQKNRGLRIDHILVSEALRGTVKACTIDR 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR   +PSDH PV+ +LD
Sbjct: 240 APRKNPQPSDHAPVVATLD 258


>gi|163857201|ref|YP_001631499.1| putative exodeoxyribonuclease III [Bordetella petrii DSM 12804]
 gi|163260929|emb|CAP43231.1| putative exodeoxyribonuclease III [Bordetella petrii]
          Length = 260

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 93/260 (35%), Positives = 142/260 (54%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+  N  D +CLQE K  D+NFP +    L YH    GQK
Sbjct: 1   MKLATWNVNSLKVRLPQVLDWLAANPVDALCLQELKLTDENFPLDAFTQLGYHAAWAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+     +V ++PG D D Q R +  T       +R+ + Y P+G  + S K
Sbjct: 61  TYNGVAILSREPGAAMVRNIPGMD-DPQQRLLAVTLPSPAGDVRVISAYCPNGQALESDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W ++   + +Q ++    L   GDYN+ P   D +NP  WE     +   R +F
Sbjct: 120 YAYKLNWFQQLRDWLAQEIQTYPRLALLGDYNVAPADEDVHNPAKWEGQVLVSEPERAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G  D+ R        +S+WDY   ++ +N G+RIDHI+LS        +  ID 
Sbjct: 180 RALLDLGLADSFRLFEQPEKSFSWWDYRQFAFRRNAGLRIDHILLSQPLVPHCVACVIDK 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
            PR   +PSDH PV+ +L +
Sbjct: 240 APRANEQPSDHAPVVATLQL 259


>gi|113477060|ref|YP_723121.1| exodeoxyribonuclease III [Trichodesmium erythraeum IMS101]
 gi|110168108|gb|ABG52648.1| Exodeoxyribonuclease III [Trichodesmium erythraeum IMS101]
          Length = 261

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 102/261 (39%), Positives = 138/261 (52%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R   +  W+K N+ DI+CLQETK  D++FP      L YHI   GQK
Sbjct: 1   MKIATWNVNSIRTRKQQVIEWLKANSVDILCLQETKVIDQDFPRSPFAELGYHIYVSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP---GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           SYNGVAI S+    +I +      GD         +   T     +RI NLY+P+G+ + 
Sbjct: 61  SYNGVAIFSRSPMEDISSGFAPILGDHKVGDFDIQKRLITGVINDVRILNLYVPNGSSVG 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           S KYD K+ W+K    +    L+    L   GD+NI+P+  D Y+P   +N    +   R
Sbjct: 121 SEKYDYKLDWLKLLQEYVKIILDKSPNLCICGDFNIVPEDRDIYDPEGCKNSVGLSDLER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           Q+ Q++  +G  DA R        YS+WDY A  + +N+G RIDH  LS   +       
Sbjct: 181 QALQEILKLGLVDAFRQFTTEGGHYSWWDYRAAGFRRNRGWRIDHHYLSLPLSQKATMCV 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           ID  PR   KPSDH PVIV  
Sbjct: 241 IDKNPRELLKPSDHAPVIVEF 261


>gi|282864972|ref|ZP_06274026.1| exodeoxyribonuclease III Xth [Streptomyces sp. ACTE]
 gi|282560397|gb|EFB65945.1| exodeoxyribonuclease III Xth [Streptomyces sp. ACTE]
          Length = 259

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 77/260 (29%), Positives = 128/260 (49%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++CLQETK   + FP E L+   Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCLQETKCTLEQFPAEALREAGYESAVNATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGV +LS+    ++VT LP        +   A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVGLLSRVGLTDVVTGLPDGPEYEGVQEPRAVSAACGP-VRVWSVYVPNGREVAHDH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++   +  +       P    GD+NI P   D ++P ++E     T   R + 
Sbjct: 120 YAYKLRWLEALRKAVAADAAGPVPFAVLGDFNIAPTDDDVWDPSLFEGATHVTPAERDAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +       H Y++WDY    + KN+G+RID +  +    + +  + +D 
Sbjct: 180 AALRAGGLSDVVPRPLKYDHPYTYWDYRQLGFPKNRGMRIDLVYGNAPFAAAVQDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDV 259


>gi|298370009|ref|ZP_06981325.1| exodeoxyribonuclease III [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281469|gb|EFI22958.1| exodeoxyribonuclease III [Neisseria sp. oral taxon 014 str. F0314]
          Length = 256

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 89/260 (34%), Positives = 138/260 (53%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +  W+ ++ PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNWLADHQPDILVLQELKLDQDKFPAAALQMMGWHSVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+ +P ++ T LP    D Q R I AT       +R+ N+Y  +G    S K
Sbjct: 61  TYNGVAIISRSEPQDVHTGLPAMPDDPQRRVIAATIGG----VRVINVYCVNGEAPDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +   E L+  GD+NI P   DCY+   W      T   R  F
Sbjct: 117 FQYKQQWFAALTEFVRDEMARYEKLVLLGDFNIAPTDDDCYDAEKWRGKILCTDSERGWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDH+++SP  +++L   ++D+
Sbjct: 177 KNLLDLGLTDSLRKIHPEGAFYTWFDYRGAMFQRGLGLRIDHLLVSPALSAVLKDVQVDS 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R   +PSDH PV    D+
Sbjct: 237 DARAQERPSDHAPVWAEFDL 256


>gi|17232798|ref|NP_489346.1| exodeoxyribonuclease III [Nostoc sp. PCC 7120]
 gi|17134445|dbj|BAB77005.1| exodeoxyribonuclease III [Nostoc sp. PCC 7120]
          Length = 260

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 98/260 (37%), Positives = 146/260 (56%), Gaps = 2/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  +  W+K+N  D++CLQETK  D +FP    ++L YH    GQK
Sbjct: 1   MKIATWNVNSIRTRLEQVLDWLKQNPVDVLCLQETKVIDDDFPRSPFENLGYHSYISGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT--LRIGNLYLPHGNPITS 121
           +YNGVA++S+    ++ T       D++  + E    I      +RI NLY+P+G+ I S
Sbjct: 61  AYNGVALISQQPLTDVTTGFTPILPDIEPIWDEQKRVITGVIDGVRIVNLYVPNGSAIAS 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY+ K+ W+     +    L L+  +   GD+NI  +  D +  +  EN    +L  RQ
Sbjct: 121 EKYEYKLRWLTVLREYLRSLLLLQPAICICGDFNIALEDKDIHEKVKAENHIMASLAERQ 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           + + +  +GF DA R        +S+WDY A S+ +N+G RIDH  L+P   +   S  I
Sbjct: 181 ALRDVLELGFADAFRKFTTEGGHFSWWDYRAASFRRNQGWRIDHHYLTPVLYAQAKSCTI 240

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D  PR  T+PSDHTPVIV +
Sbjct: 241 DVSPRKLTQPSDHTPVIVEI 260


>gi|76810233|ref|YP_334150.1| exodeoxyribonuclease III [Burkholderia pseudomallei 1710b]
 gi|76579686|gb|ABA49161.1| exodeoxyribonuclease III [Burkholderia pseudomallei 1710b]
          Length = 322

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 134/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ +++ D++CLQE K  D+ FP E L++  Y     GQK
Sbjct: 65  MRIATWNVNSLNVRKQHVLDWLAQSDVDVLCLQELKIPDEKFPREALEAAGYRSWFAGQK 124

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       T +  +    +              +RI + Y P+G  + S K
Sbjct: 125 TYNGVAILARASLPFDETDIVRNIPGFEDAQQRLIAATIDG-VRIVSAYFPNGQALDSDK 183

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 184 FVYKMQWLDALQAWLKDELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 243

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 244 AQLVALGFVDAFRRFEQPEKTFTWWDYRMLAFRRNAGLRIDHILLSPALAETCTSCTVDR 303

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDHTPV+  L
Sbjct: 304 VPRTWEQPSDHTPVVAQL 321


>gi|300868692|ref|ZP_07113303.1| exodeoxyribonuclease III [Oscillatoria sp. PCC 6506]
 gi|300333253|emb|CBN58495.1| exodeoxyribonuclease III [Oscillatoria sp. PCC 6506]
          Length = 261

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 96/261 (36%), Positives = 141/261 (54%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR+R+  +  W++ N  D++CLQETK  D++FP +    + Y+    GQK
Sbjct: 1   MKIATWNVNSIRSRLEQVLEWLQANPVDVLCLQETKVIDQDFPLQPFLDIGYNFYISGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQ---TLRIGNLYLPHGNPIT 120
           SYNGVAI S+    +I T              +    + T     +RI NLY+P+G+ + 
Sbjct: 61  SYNGVAIFSRLPMTDISTGFAPILGTDIVGEFDEQKRLITGIIADIRIVNLYIPNGSEVG 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           S KY+ K++W+K    +    ++    L   GD+NI P   D +NP  ++N    +   R
Sbjct: 121 SEKYNYKLNWLKLLQEYLKIIIDKSPNLCVCGDFNIAPDDRDIHNPKAFKNQIMASPAER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           Q+ Q++  +GF+DA R   D    +S+WDY    +  N+G RIDH  LS        S  
Sbjct: 181 QALQEIVALGFSDAFRIFTDEGGHFSWWDYRTGGFRHNRGWRIDHHYLSLSLCDRAKSCT 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           ID  PR  TKPSDH PVIV +
Sbjct: 241 IDKTPRQLTKPSDHAPVIVEI 261


>gi|150376441|ref|YP_001313037.1| exodeoxyribonuclease III Xth [Sinorhizobium medicae WSM419]
 gi|150030988|gb|ABR63104.1| exodeoxyribonuclease III Xth [Sinorhizobium medicae WSM419]
          Length = 257

 Score =  212 bits (539), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 98/259 (37%), Positives = 151/259 (58%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N +  R+ +L  W+    PD++CLQE K  D  FP   +++  Y     GQ 
Sbjct: 1   MKIATFNINGVNKRLDHLLIWLAAAGPDVVCLQELKATDGQFPEAAIEAAGYGAVWLGQT 60

Query: 64  SYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           ++NGVAIL++  +P+   T LPGD  D Q+R+IEA        + I +LY P+GNP    
Sbjct: 61  AWNGVAILARGCEPVLTRTGLPGDPSDTQSRYIEAAVNG----ILIASLYAPNGNPQPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K++W +R    A+  LE   P++ AGDYN++P+P D Y    ++ +A    E R +
Sbjct: 117 KFDYKLAWHQRLNLHAAALLEARVPVLLAGDYNVVPEPRDIYPTRSYDGNALVQPESRAA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F+ L   G+ DA+R  H    L++FWDY  + W ++ G+R+DHI+LS +    L  A ID
Sbjct: 177 FKSLVEQGWLDALRKVHPQAQLFTFWDYRRNRWQRDAGLRLDHILLSGKLKRRLTGAGID 236

Query: 243 TKPRGWTKPSDHTPVIVSL 261
            + RG    SDH PV ++L
Sbjct: 237 REIRGLEGASDHAPVWITL 255


>gi|237745581|ref|ZP_04576061.1| exodeoxyribonuclease III [Oxalobacter formigenes HOxBLS]
 gi|229376932|gb|EEO27023.1| exodeoxyribonuclease III [Oxalobacter formigenes HOxBLS]
          Length = 255

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 95/260 (36%), Positives = 141/260 (54%), Gaps = 5/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+ +N  D++CLQETK  D  FP   + +  Y     GQK
Sbjct: 1   MKIATWNVNSLKVRLPQVLQWLNDNPVDVLCLQETKLTDDKFPVMEIAAAGYQTVFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+    +I+ + P    + Q        T     LR+   Y+P+G  + S K
Sbjct: 61  TYNGVAILSRQSAGDILKNNPFFPDEQQRIV-----TGTFGKLRVVCAYVPNGQAVDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  KI W+K    +  +  +    L   GDYNI P+  D Y+P  WE +   +   R +F
Sbjct: 116 YRYKIEWLKALHAWLLEEKKKYPYLALLGDYNIAPEDRDVYDPAAWEGNVLVSEPERAAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++GF DA R        YS+WDY   ++ +N+G+R+DHI+LS        +  ID 
Sbjct: 176 RALLDIGFVDAFRLFSQPEKTYSWWDYRQLAFPRNRGLRLDHILLSENLAPHCTACTIDR 235

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
            PR W +PSDHTPVI  L++
Sbjct: 236 MPRKWKQPSDHTPVIAELEL 255


>gi|167581292|ref|ZP_02374166.1| exodeoxyribonuclease III [Burkholderia thailandensis TXDOH]
          Length = 258

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 134/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ +++ D++CLQE K  D+ FP E L++  Y     GQK
Sbjct: 1   MRIATWNVNSLNVRKQHVLDWLAQSDVDVLCLQELKIPDEKFPREALEAAGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       T +  +    +              +RI + Y P+G  + S K
Sbjct: 61  TYNGVAILARASLPFDETDVVRNIPGFEDTQQRLIAATIDG-VRIVSAYFPNGQALDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLKNELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 180 AQLVALGFVDAFRRFDQPEKTFTWWDYRMLAFRRNAGLRIDHILLSPALAETCTSCTVDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDHTPV+  L
Sbjct: 240 APRAWEQPSDHTPVVAQL 257


>gi|294815857|ref|ZP_06774500.1| Exonuclease [Streptomyces clavuligerus ATCC 27064]
 gi|294328456|gb|EFG10099.1| Exonuclease [Streptomyces clavuligerus ATCC 27064]
          Length = 269

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 78/263 (29%), Positives = 130/263 (49%), Gaps = 1/263 (0%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           +S + +ATWNVNS+ AR+  L AW++ +  D++C+QETK  ++ FP E L+ + Y     
Sbjct: 8   LSSMRIATWNVNSVTARLPRLLAWLESSGTDVLCIQETKCAEEQFPAEELREIGYESAIH 67

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
               +NGVA++S+    E+V  LPG      A+   A        +R+ ++Y+P+G  +T
Sbjct: 68  ADGRWNGVALVSRVGLDEVVKGLPGGPAYDGAQEPRAISATCGP-VRLWSVYVPNGREVT 126

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
              Y  K+ W+       +       P    GDYNI P   D ++   +E     T   R
Sbjct: 127 HDHYAYKLEWLAALKEAVAADAAGPRPFAVLGDYNIAPADEDVWDRAAFEGSTHVTEPER 186

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +   L+  G +D +       H +++WDY    + KN+G+RID +  +      +  + 
Sbjct: 187 AALAALRETGLSDVVPRPLKYDHPFTYWDYRQLCFPKNRGMRIDLVYGNGPFAGAVKDSY 246

Query: 241 IDTKPRGWTKPSDHTPVIVSLDI 263
           +D + R     SDH PV+V LD+
Sbjct: 247 VDREERKGKGASDHAPVVVDLDV 269


>gi|83718841|ref|YP_442378.1| exodeoxyribonuclease III [Burkholderia thailandensis E264]
 gi|167619376|ref|ZP_02388007.1| exodeoxyribonuclease III [Burkholderia thailandensis Bt4]
 gi|257138580|ref|ZP_05586842.1| exodeoxyribonuclease III [Burkholderia thailandensis E264]
 gi|83652666|gb|ABC36729.1| exodeoxyribonuclease III [Burkholderia thailandensis E264]
          Length = 258

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 134/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ +++ D++CLQE K  D+ FP E L++  Y     GQK
Sbjct: 1   MRIATWNVNSLNVRKQHVLDWLAQSDVDVLCLQELKIPDEKFPREALEAAGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       T +  +    +              +RI + Y P+G  + S K
Sbjct: 61  TYNGVAILARASLPFDETDVVRNIPGFEDTQQRLIAATIDG-VRIVSAYFPNGQALDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLKNELQRYPKLALLGDYNIAPEDRDVHDPSKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 180 AQLVALGFVDAFRRFDQPEKTFTWWDYRMLAFRRNAGLRIDHILLSPALAETCTSCTVDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDHTPV+  L
Sbjct: 240 APRAWEQPSDHTPVVAQL 257


>gi|87198182|ref|YP_495439.1| exodeoxyribonuclease III [Novosphingobium aromaticivorans DSM
           12444]
 gi|87133863|gb|ABD24605.1| Exodeoxyribonuclease III [Novosphingobium aromaticivorans DSM
           12444]
          Length = 259

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 102/260 (39%), Positives = 152/260 (58%), Gaps = 5/260 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
            + VA++N+N I+AR+  L  W++E  P + CLQE KT+D+ FP E  + + Y     GQ
Sbjct: 2   TLKVASFNINGIKARLPRLLEWLEETRPSVACLQEIKTQDEGFPAEEFEKIGYRAIWHGQ 61

Query: 63  KSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           K +NGVAIL+   QP+E+   L GD  D  +R++EA        LR+  +YLP+GNP   
Sbjct: 62  KGFNGVAILADGEQPVEVQRGLAGDPEDEHSRYLEADV----FGLRVVCIYLPNGNPQPG 117

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            K+D K+ W++R     +     E P +  GDYN+IP+  D ++     +DA    E R 
Sbjct: 118 PKFDYKLRWMERLRARMADIASEEVPALVIGDYNVIPEDKDTFSVKAMASDALMQPESRD 177

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           ++++L N G+TDAI   +    +++FWDY A +W ++ G RIDH +LSPE    L +A +
Sbjct: 178 AYRRLLNDGWTDAIDLFNPQGGVWTFWDYQAGAWQRDHGFRIDHALLSPELADRLVAAGV 237

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D   RG  K SDH PV V+L
Sbjct: 238 DKDYRGREKASDHAPVWVTL 257


>gi|52840886|ref|YP_094685.1| hypothetical protein lpg0649 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52627997|gb|AAU26738.1| exodeoxyribonuclease III [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 263

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 92/261 (35%), Positives = 149/261 (57%), Gaps = 5/261 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           V  +A+WNVNS++ R+  +  W++ +  D++ +QETK  D NFP  +     YH+   GQ
Sbjct: 8   VFKLASWNVNSLKVRLEQVLQWLESSQVDVLAMQETKLTDDNFPVASFIDKGYHVIFSGQ 67

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVAI+S+Y   +I T +P  +   +              +R+ NLY+P+G  +TS 
Sbjct: 68  KTYNGVAIISRYPMTDIQTDIPELEDPQRRILAATVKG-----IRLINLYVPNGGELTSD 122

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K+ W+ +  RF    + +   +   GD+NI P+  D Y+P+ WE     +   RQ+
Sbjct: 123 KYQYKLDWLNKVTRFIQHEISIYSKVAVVGDFNIAPEDRDVYDPVEWEGCVLVSPPERQA 182

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F K+  +G  D+ R        +S+WDY A ++ +N+G+RIDH++LS E  +L   ++ID
Sbjct: 183 FMKILELGLHDSFRNFAQEEKAFSWWDYRAAAFRRNRGLRIDHVLLSHELNALCRQSKID 242

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
            +PR   +PSDH PV V L++
Sbjct: 243 KEPRKAERPSDHAPVWVELEL 263


>gi|297190955|ref|ZP_06908353.1| exonuclease [Streptomyces pristinaespiralis ATCC 25486]
 gi|197721867|gb|EDY65775.1| exonuclease [Streptomyces pristinaespiralis ATCC 25486]
          Length = 259

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 76/260 (29%), Positives = 129/260 (49%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++CLQETK  ++ FP   L+ L Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCLQETKCTEEQFPAAQLRELGYESAVNASG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA++S+    ++V  LPG       +   A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVISRVGLDDVVRGLPGAPDYEGVQEPRAISATCGP-VRVWSVYVPNGREVAHDH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++      +       P    GD+NI P   D ++P  ++     T   R + 
Sbjct: 120 YGYKLRWLEALSVAVTDDAAAGRPFAVLGDFNIAPTDDDVWDPSFFDGMTHVTPPERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L+  G  D +       H +++WDY    + KN+G+RID +  +   T+ +  + +D 
Sbjct: 180 EALRKRGLADVVPRPLKYEHPFTYWDYRQLCFPKNRGMRIDLVYGNEPFTAAVKDSFVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDM 259


>gi|329911665|ref|ZP_08275588.1| Exodeoxyribonuclease III [Oxalobacteraceae bacterium IMCC9480]
 gi|327545815|gb|EGF30936.1| Exodeoxyribonuclease III [Oxalobacteraceae bacterium IMCC9480]
          Length = 256

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 141/260 (54%), Gaps = 5/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+ +N  D++CLQETKT D+ FP   +++  YH+   GQK
Sbjct: 1   MKLATWNVNSLKVRLPQVLQWLADNPIDVLCLQETKTIDEKFPQAEIEAAGYHVAFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILSK    ++V + P    + Q              +R+   Y+P+G    S K
Sbjct: 61  TYNGVAILSKQPMTDVVRNNPHFADEQQRLIAATIDG-----VRVICAYIPNGQAPDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+    ++ +  +         GDYNI P+  D ++P  W      +   R +F
Sbjct: 116 YQYKLRWLDGLQQWLALEMAAHPKFALLGDYNIAPEDRDVHDPAAWVGQILVSEPERAAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q++  +  TDA R       L+S+WDY    + +N G+RIDHI+LS E  +   S  ID 
Sbjct: 176 QRMIALELTDAFRLFEQADKLFSWWDYRQMGFRRNAGMRIDHILLSKELAAACTSCVIDK 235

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
            PR W +PSDHTPV+ ++ +
Sbjct: 236 VPRKWEQPSDHTPVVATIAL 255


>gi|296161285|ref|ZP_06844093.1| exodeoxyribonuclease III Xth [Burkholderia sp. Ch1-1]
 gi|295888443|gb|EFG68253.1| exodeoxyribonuclease III Xth [Burkholderia sp. Ch1-1]
          Length = 270

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 103/272 (37%), Positives = 155/272 (56%), Gaps = 5/272 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M+ + +AT+N+N IR+R+  L  W++   PDI+CLQE K  D  FP E L+   Y     
Sbjct: 1   MARLRIATFNINGIRSRLPALLQWLEREAPDIVCLQELKAADSAFPVEELRDAGYGAIWQ 60

Query: 61  GQKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ ++NGVAIL+K   P+E    LPG + D  +R++EA        + +  LYLP+GNP 
Sbjct: 61  GQSAWNGVAILAKGEAPLESRRGLPGFEDDTHSRYLEAAVGG----IVVACLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K+D K++W    +R A++  +   P++ AGD+N++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFDYKLAWFGHLIRHAAKLYKSGHPVVLAGDFNVVPTDEDIYNPRSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+ +++L   G+TDA+R       +Y+FWDY+   W  N G+RIDH++LS +    L  A
Sbjct: 177 RERYRQLLAQGWTDALRTHFGAERVYTFWDYFRRHWETNSGLRIDHVLLSADLAPRLRDA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQ 271
            +D   RG    SDH P  V L++   R+K+ 
Sbjct: 237 GVDRWVRGEPHASDHAPAWVELEVGAGRRKKS 268


>gi|54293632|ref|YP_126047.1| hypothetical protein lpl0685 [Legionella pneumophila str. Lens]
 gi|53753464|emb|CAH14919.1| hypothetical protein lpl0685 [Legionella pneumophila str. Lens]
          Length = 256

 Score =  211 bits (538), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 90/261 (34%), Positives = 150/261 (57%), Gaps = 5/261 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           +  +A+WNVNS++ R+  +  W++ +  D++ +QETK  D+NFP  +     YH+   GQ
Sbjct: 1   MFKLASWNVNSLKVRLEQVLQWLESSQVDVLAMQETKLTDENFPVVSFTDKGYHVIFSGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVAI+S+Y   +I T +P  +   +              +R+ NLY+P+G  +TS 
Sbjct: 61  KTYNGVAIISRYPMTDIQTDIPELEDPQRRILAATVKG-----IRLINLYVPNGGELTSD 115

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K+ W+ +  RF    + +   +   GD+NI P+  D ++P+ WE     +   RQ+
Sbjct: 116 KYQYKLDWLNKVTRFIQHEISIYSKVAVVGDFNIAPEDRDVHDPVEWEGCVLVSPPERQA 175

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F K+  +G  D+ R        +S+WDY A ++ +N+G+RIDH++LS E  +L   ++ID
Sbjct: 176 FMKILELGLHDSFRNFAQEEKAFSWWDYRAAAFRRNRGLRIDHVLLSHELNALCRQSKID 235

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
            +PR   +PSDH PV V L++
Sbjct: 236 KEPRKAERPSDHAPVWVELEL 256


>gi|121999062|ref|YP_001003849.1| exodeoxyribonuclease III Xth [Halorhodospira halophila SL1]
 gi|121590467|gb|ABM63047.1| Exodeoxyribonuclease III [Halorhodospira halophila SL1]
          Length = 267

 Score =  211 bits (538), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 143/259 (55%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS++ R+  + AW +   P +I LQETK  D  FP + LQ   Y     GQ+
Sbjct: 1   MKIASWNVNSLKVRLPQVKAWAQSATPSVIALQETKVPDDQFPLKALQEAGYRAAFAGQR 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+L++  P ++VT LPG     +              +R+ NLY+P+G  + S K
Sbjct: 61  TYNGVAVLARSAPQDVVTDLPGFADTQRRVLACTVSG-----VRVINLYVPNGQEVGSEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++    + ++ LE  E ++  GD+NI PQ  D ++P  WE    F+   R + 
Sbjct: 116 YGYKLRWLEALHHWVARELEAHEHVVVLGDFNIAPQAADVHDPAEWEGKVLFSQSERDAL 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L N+G  D  R        +S+WDY  +S+ +N+G+RID I+ S        ++R+D 
Sbjct: 176 RGLLNLGLVDTFRLFEQPEGQFSWWDYRVNSFKRNRGLRIDLILASSALARACVASRVDV 235

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           +PR W +PSDH PV+   D
Sbjct: 236 EPRRWERPSDHAPVVAEFD 254


>gi|171057931|ref|YP_001790280.1| exodeoxyribonuclease III Xth [Leptothrix cholodnii SP-6]
 gi|170775376|gb|ACB33515.1| exodeoxyribonuclease III Xth [Leptothrix cholodnii SP-6]
          Length = 254

 Score =  211 bits (538), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 88/258 (34%), Positives = 130/258 (50%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  L  W+    PD + LQETK  D  FP   L +  YH    GQK
Sbjct: 1   MKLATWNVNSLSVRLPQLLDWLVSAQPDALVLQETKLTDDKFPAAELLAAGYHAVWHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LS+   +++V ++P  D                  +R+   Y P+G    S K
Sbjct: 61  TYNGVALLSRTPAVDVVRNIPALDDPQARVI-----AGTVDGVRVIGGYFPNGQAPDSEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L     L+  GD+NI P+  D Y+P+ W      T E R  F
Sbjct: 116 FVYKMGWLTALEAWLQTELAAHTQLVLMGDFNIAPEDRDVYDPVAWAGQIHCTPEERAHF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G  DA R        +S+WDY   ++ KN+G+RIDH+++     + + + +ID 
Sbjct: 176 QALVGLGLVDAFRLFEQPPKSWSWWDYRNLAFRKNQGLRIDHVLVGEALKARVTACQIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV V L
Sbjct: 236 APRKNERPSDHAPVWVEL 253


>gi|255535312|ref|YP_003095683.1| Exodeoxyribonuclease III [Flavobacteriaceae bacterium 3519-10]
 gi|255341508|gb|ACU07621.1| Exodeoxyribonuclease III [Flavobacteriaceae bacterium 3519-10]
          Length = 301

 Score =  211 bits (538), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 95/262 (36%), Positives = 135/262 (51%), Gaps = 3/262 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
              + +AT+NVN I  R+  L  W+ E  PDI CLQE K     FP   +    Y     
Sbjct: 43  FEPMKIATYNVNGINGRLPVLLRWLNEKQPDIACLQELKAPQDKFPEAAIAEAGYEAVWV 102

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQKS+NGVA+LSK     +           ++        +    L I  LYLP+GNP  
Sbjct: 103 GQKSWNGVAVLSKIGTPTVSR---TSLPGDESDEASRYLEVKIADLIIACLYLPNGNPAP 159

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             K+D K+ W  R    A   +   + ++  GD+N++P   D Y P  + NDA F  +V+
Sbjct: 160 GPKFDYKMQWFSRLDAHAEMLITSGKKVLLIGDFNVMPTEKDVYKPEKYINDALFHPDVQ 219

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +F  L   G+TDAIR  +    +Y+FWDY+ +++ +N G+RIDH +LS E    L  A 
Sbjct: 220 AAFHNLTEQGWTDAIRYLYPDETIYTFWDYFRNAYQRNAGMRIDHFLLSAEVLPQLKKAG 279

Query: 241 IDTKPRGWTKPSDHTPVIVSLD 262
           +DT  RGW K SDH PV + L+
Sbjct: 280 VDTDVRGWEKSSDHGPVWIELE 301


>gi|302557371|ref|ZP_07309713.1| exodeoxyribonuclease III [Streptomyces griseoflavus Tu4000]
 gi|302474989|gb|EFL38082.1| exodeoxyribonuclease III [Streptomyces griseoflavus Tu4000]
          Length = 259

 Score =  211 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 80/260 (30%), Positives = 125/260 (48%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++CLQE K  +  FP E L+ L Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCLQEAKVAEDQFPAEQLRELGYESAVHATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++V  LPGD     +    A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVLSRVGLADVVKGLPGDPGYDGSVEPRAIAATCGP-VRVWSVYVPNGREVEHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +      S       P    GDYN+ P   D Y+   +E     T   R + 
Sbjct: 120 YAYKLQWFEALTAAVSGDAAGGRPFAVLGDYNVAPTDDDVYDRSAFEGSTHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +       H Y++WDY    + KN+G+RID +  +      +  + +D 
Sbjct: 180 ASLREAGLSDVVPRPLKYEHPYTYWDYRQLCFPKNRGMRIDLVYGNAPFAKAVTDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDV 259


>gi|307609446|emb|CBW98940.1| hypothetical protein LPW_07251 [Legionella pneumophila 130b]
          Length = 256

 Score =  211 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 90/261 (34%), Positives = 149/261 (57%), Gaps = 5/261 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           +  +A+WNVNS++ R+  +  W++ +  D++ +QETK  D+NFP  +     YH+   GQ
Sbjct: 1   MFKLASWNVNSLKVRLEQVLQWLESSQVDVLAMQETKLTDENFPVVSFTDKGYHVIFSGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVAI+S+Y   +I T +P  +   +              +R+ NLY+P+G  +TS 
Sbjct: 61  KTYNGVAIISRYPMTDIQTDIPELEDPQRRILAATVKG-----IRLINLYVPNGGELTSD 115

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K+ W+ +  RF    + +   +   GD+NI P   D ++P+ WE     +   RQ+
Sbjct: 116 KYQYKLDWLNKVTRFIQHEISIYSKVAVVGDFNIAPDDRDVHDPVEWEGCVLVSPPERQA 175

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F K+  +G  D+ R        +S+WDY A ++ +N+G+RIDH++LS E  +L   ++ID
Sbjct: 176 FMKILELGLHDSFRNFAQEEKAFSWWDYRAAAFRRNRGLRIDHVLLSHELNALCRQSKID 235

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
            +PR   +PSDH PV V L++
Sbjct: 236 KEPRKAERPSDHAPVWVELEL 256


>gi|75908773|ref|YP_323069.1| exodeoxyribonuclease III [Anabaena variabilis ATCC 29413]
 gi|75702498|gb|ABA22174.1| Exodeoxyribonuclease III [Anabaena variabilis ATCC 29413]
          Length = 260

 Score =  211 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 98/260 (37%), Positives = 145/260 (55%), Gaps = 2/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  +  W+K+N  D++CLQETK  D +FP    ++L YH    GQK
Sbjct: 1   MKIATWNVNSIRTRLEQVVDWLKQNPVDVLCLQETKVIDHDFPRSPFENLGYHSYISGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT--LRIGNLYLPHGNPITS 121
           +YNGVA++S+ Q  ++ T       D++  + E    I      +RI NLY+P+G+ I S
Sbjct: 61  AYNGVALISQQQLTDVTTGFTPILPDIEPIWDEQKRVITGVIDGVRIVNLYVPNGSAIAS 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY+ K+ W+     +    L L+  +   GD+NI  +  D +  +  EN    +   RQ
Sbjct: 121 EKYEYKLRWLTVLKEYLRSLLLLQPSICICGDFNIALEDKDIHEKVKAENHIMASPAERQ 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           + + +  +GF DA R        +S+WDY A S+ +N+G RIDH  L+P       S  I
Sbjct: 181 ALRDVLELGFADAFRKFTTEGGHFSWWDYRAASFRRNQGWRIDHHYLTPVLYEQAKSCII 240

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D  PR  T+PSDHTPVIV +
Sbjct: 241 DVSPRKLTQPSDHTPVIVEI 260


>gi|119491403|ref|ZP_01623422.1| Exodeoxyribonuclease III xth [Lyngbya sp. PCC 8106]
 gi|119453398|gb|EAW34561.1| Exodeoxyribonuclease III xth [Lyngbya sp. PCC 8106]
          Length = 261

 Score =  211 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 95/261 (36%), Positives = 137/261 (52%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R   + AW++ N  D++CLQETK  D +FP    + L YH+   GQK
Sbjct: 1   MKIATWNVNSIRTRKEQVLAWLQANPVDLLCLQETKVIDPDFPRSPFEDLGYHLYVSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT---QTLRIGNLYLPHGNPIT 120
           +YNGVAI S+    ++             +  +    +       +R+ NLY+P+G  + 
Sbjct: 61  AYNGVAIFSRQPLEDVSLGFTAILAQNTVQTFDEQKRVIAGTIDGIRVINLYVPNGASVG 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           S KY  K+SW+K    +  + LE    +   GD+NI  +  D +NP   EN    +   R
Sbjct: 121 SEKYLYKLSWLKLLKEYLQKTLEKNPNICVCGDFNIALEDRDIHNPKGRENHIMASDAER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           Q+ +++  +G  DA R  +     +S+WDY A S+ +NKG RIDH  L+        S  
Sbjct: 181 QALKEILELGLADAFRKFNSESEQFSWWDYRAASFPRNKGWRIDHHYLTSSLYEKAKSCI 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           ID  PR   KPSDHTPVIV  
Sbjct: 241 IDKTPRKLEKPSDHTPVIVEF 261


>gi|327399082|ref|YP_004339951.1| exodeoxyribonuclease III Xth [Hippea maritima DSM 10411]
 gi|327181711|gb|AEA33892.1| exodeoxyribonuclease III Xth [Hippea maritima DSM 10411]
          Length = 258

 Score =  211 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 88/259 (33%), Positives = 139/259 (53%), Gaps = 6/259 (2%)

Query: 5   TVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQKS 64
            V +WNVNSIRAR+  +  ++K N PD++C+QETK E+  FP E  + L Y++ T GQK 
Sbjct: 4   KVVSWNVNSIRARLELVLDFLKANQPDVLCMQETKVENVLFPKEAFEELGYNVATAGQKR 63

Query: 65  YNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTKY 124
           +NGVA +SK    +I T     + D +   +          + I NLY P+G    + ++
Sbjct: 64  FNGVATVSKLNLEDIKTDFFDAEKDHKRSLL-----TKINDITIINLYFPNGQAPDTEQF 118

Query: 125 DDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSFQ 184
             K+++I     F S+   +E+ LI  GD+N+  + +D Y+    E    F  E R++ +
Sbjct: 119 QYKLNFIYELKSFLSKHYSIEDKLIILGDFNVAMEENDVYDVKQMEGKIGFHPEERKALK 178

Query: 185 KLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDTK 244
           +L + GF D  R  +     +S+WDY A S+ K++G+RID+I  +P          ID  
Sbjct: 179 ELYSWGFVDLFRKFNK-EKAFSWWDYRAASFWKDRGLRIDYIWSTPTLADKCKDCFIDKS 237

Query: 245 PRGWTKPSDHTPVIVSLDI 263
            R   KPSDH PV+   ++
Sbjct: 238 YRRKKKPSDHAPVVAVFEL 256


>gi|78778870|ref|YP_396982.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9312]
 gi|78712369|gb|ABB49546.1| Exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9312]
          Length = 281

 Score =  211 bits (537), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 93/266 (34%), Positives = 146/266 (54%), Gaps = 4/266 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  +  W+ + NPDI+CLQETK  D +FPFE  + L Y +E  GQK
Sbjct: 1   MLIATWNVNSIRTRLSQIIDWMNQVNPDILCLQETKVMDNSFPFEPFEKLGYSVEVYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT----INTQTLRIGNLYLPHGNPI 119
           +YNGVAI+SK +   +     G     Q   I          +   ++I N+Y+P+G+ +
Sbjct: 61  AYNGVAIISKIKAENVKKGFYGCSDSDQNAEIFLDQKRLISADINGIKIINVYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S K++ KI+W+     +  ++ +  E +   GD+N+ P   D Y+P  +E     +   
Sbjct: 121 ESNKFEYKINWLSSLASYLDEQEKKGELICLMGDFNVAPSNLDIYDPKKYEGGIMASEIE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R +   +      D+ R        +S+WDY  +++  NKG RIDHI +S E +S L S 
Sbjct: 181 RNALNNVLKERLIDSFRIFEKNPGHWSWWDYRNNAYELNKGWRIDHIYISKELSSKLKSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPE 265
            ID+ PR   +PSDH PV++ L++ +
Sbjct: 241 VIDSSPRANLRPSDHAPVMIDLNLND 266


>gi|258653319|ref|YP_003202475.1| exodeoxyribonuclease III Xth [Nakamurella multipartita DSM 44233]
 gi|258556544|gb|ACV79486.1| exodeoxyribonuclease III Xth [Nakamurella multipartita DSM 44233]
          Length = 264

 Score =  211 bits (537), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 84/262 (32%), Positives = 139/262 (53%), Gaps = 3/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NSIRAR   + AW++ ++ D++ +QETK +D  FP E+ + L Y +   G  
Sbjct: 1   MRIATWNINSIRARHDRVLAWLERSDVDVLAIQETKIDDARFPVESFERLGYRVAHHGTN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT-LRIGNLYLPHGNPITST 122
            +NGVAI S+    ++   +P      +   +EA         +R+ +LY+P+G  +   
Sbjct: 61  QWNGVAIASRVGLDDVQVGVPDLPAFGEDPAVEARSLGALCGGVRVWSLYVPNGRAVDDP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEP--LIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
            Y  K+ W+     +A+++L  E    ++  GD+NI P   D ++   ++     T   R
Sbjct: 121 HYHYKLHWLAVLRDYAAKQLADEPHLPMLLCGDFNIAPTDDDIWSVEYYQGSTHVTGPER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           Q+F  L + GFTD +R  H    +Y++WDY   S+ K +G+RID  + SP   + +  A+
Sbjct: 181 QAFANLTDAGFTDVVRPFHPGPGVYTYWDYTRLSFPKRRGMRIDFALASPALAARVTDAQ 240

Query: 241 IDTKPRGWTKPSDHTPVIVSLD 262
           ID + R     SDH PVIV   
Sbjct: 241 IDREERKGKGSSDHAPVIVEFK 262


>gi|268318163|ref|YP_003291882.1| exodeoxyribonuclease III Xth [Rhodothermus marinus DSM 4252]
 gi|262335697|gb|ACY49494.1| exodeoxyribonuclease III Xth [Rhodothermus marinus DSM 4252]
          Length = 254

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 89/260 (34%), Positives = 138/260 (53%), Gaps = 6/260 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + VATWNVNSIRAR+  +  W+    PDI+CLQETK  D +FP +  +   Y +   GQK
Sbjct: 1   MIVATWNVNSIRARLERVLQWLDRTEPDIVCLQETKVVDADFPADPFRERGYELAVFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+    ++   L G+      +            L + ++Y+P+G  + S  
Sbjct: 61  AYNGVAILSRLPLQDVRRGLDGEQEARFLQAR------CGDRLVVCSVYVPNGGTVGSEA 114

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K+ W  R   +  +    E PL+ AGD+N+ P+P D   P  W +   F    R +F
Sbjct: 115 WDYKLRWFDRLRAYLERAASPETPLLLAGDFNVAPEPRDVAFPEAWADSVLFHEAARAAF 174

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +KL + G  D IR  H+    +++WDY   ++ +  G+RIDH++ +P   +    A +  
Sbjct: 175 RKLIDWGLVDLIRLHHEGPGPFTWWDYRNLAFPRGDGLRIDHLLATPPVAACCTEAGVHR 234

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   KPSDH PV   L++
Sbjct: 235 EERKGKKPSDHAPVWARLNL 254


>gi|294083994|ref|YP_003550751.1| exodeoxyribonuclease III [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663566|gb|ADE38667.1| exodeoxyribonuclease III [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 256

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 119/258 (46%), Positives = 169/258 (65%), Gaps = 4/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS +AR+ ++  W+K +N DI+ +QE K++D+NFP +    L +HI   GQK
Sbjct: 1   MRIASWNVNSAKARLDHITGWLKADNADILMMQEIKSQDENFPHDAFTDLGWHIAVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAI S++   +++  LPGDD D QAR+IEAT       +RIGN+YLP+GNP    K
Sbjct: 61  SYNGVAIASRFPIDDVMNGLPGDDADEQARYIEATING----VRIGNIYLPNGNPAPGPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K+SW+ R    A + L  E P++  GDYN++PQ  DCY+P  W  DA    + R +F
Sbjct: 117 FDYKLSWMARLYDRAVELLATEMPVVLGGDYNVLPQDVDCYDPAAWVGDALTHDDSRAAF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            K+ + G+ DA+RA H +   Y++WDY A +W ++ G+RIDH++LSPEA   L    ID 
Sbjct: 177 FKILHAGYMDALRALHPSGVHYTYWDYQAGAWQRDNGLRIDHLLLSPEAGDRLTDVGIDR 236

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PRG  KPSDHTP+   L
Sbjct: 237 APRGLEKPSDHTPIWCQL 254


>gi|326801889|ref|YP_004319708.1| exodeoxyribonuclease III Xth [Sphingobacterium sp. 21]
 gi|326552653|gb|ADZ81038.1| exodeoxyribonuclease III Xth [Sphingobacterium sp. 21]
          Length = 259

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 101/262 (38%), Positives = 152/262 (58%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN +  R+  L  W++E  PD++CLQE K   + FP + ++   Y++   GQK
Sbjct: 1   MKIATYNVNGVNGRLPVLLRWLEEAKPDVVCLQELKAPQEKFPEQAIREAGYNVIWHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAIL+++  I     +   D +            +   + IG LYLP+GNP+   K
Sbjct: 61  SWNGVAILARHLDIIEFGRVLPGDPEDTHS---RYIEASINNIHIGCLYLPNGNPVPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K+ W++R    A + L    P+I  GDYN+IP   D Y P  W +DA F  EVR +F
Sbjct: 118 FDYKLKWLQRLANHAQELLNKNIPVILTGDYNVIPTELDVYKPERWVDDALFRPEVRMAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L   G+TDAIR  +    +Y+FWDY+ +++ ++ G+RIDH +LSP+    L +A +D 
Sbjct: 178 SDLMTQGWTDAIRQLYPNERIYTFWDYFRNAYGRDAGLRIDHFLLSPQLVEKLVAAGVDR 237

Query: 244 KPRGWTKPSDHTPVIVSL-DIP 264
             RGW K SDH PV + L D+P
Sbjct: 238 YVRGWEKTSDHAPVWIELRDLP 259


>gi|226361308|ref|YP_002779086.1| exodeoxyribonuclease III [Rhodococcus opacus B4]
 gi|226239793|dbj|BAH50141.1| putative exodeoxyribonuclease III [Rhodococcus opacus B4]
          Length = 267

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 77/265 (29%), Positives = 129/265 (48%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   +  W++ ++ D++ +QETK +D+ FP+E  + L Y +   G  
Sbjct: 1   MRIATWNVNSVRARTDRILDWLQRSDVDVLAIQETKCKDEQFPYERFRELGYEVAHVGLS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPHGNP 118
            +NGVAI S+    ++     G     +   +               +R+ +LY+P+G  
Sbjct: 61  QWNGVAIASRVGLDDVQIGFEGQPGFHKDPEVAPAQEARAIGATCNGVRVWSLYVPNGRE 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEEPLIF--AGDYNIIPQPHDCYNPIIWENDACFT 176
           +    Y  K+ W+ +    A   L+          GD+N+ P   D ++P ++E     +
Sbjct: 121 LADPHYTYKLEWLAKLHTDAVGWLDRNPDAQIALVGDWNVAPTDEDVWDPALFEGKTHTS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
           +  R++FQ     GF D +R       +Y++WDY    + K +G+RID ++ SP     +
Sbjct: 181 VPEREAFQAFVESGFADVVRPHTPGPGVYTYWDYTQLRFPKKQGMRIDFVLGSPALAGRV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
             A ID   R     SDH PVIV L
Sbjct: 241 DKAEIDRNERKGKGASDHAPVIVDL 265


>gi|111019171|ref|YP_702143.1| DNA-(apurinic or apyrimidinic site) lyase [Rhodococcus jostii RHA1]
 gi|110818701|gb|ABG93985.1| probable DNA-(apurinic or apyrimidinic site) lyase [Rhodococcus
           jostii RHA1]
          Length = 270

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 128/268 (47%), Gaps = 7/268 (2%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M+ V +ATWNVNS+RAR   +  W++ ++ D++ +QETK +D+ FP+E  + L Y +   
Sbjct: 1   MAAVRIATWNVNSVRARTDRILDWLQRSDVDVLAMQETKCKDEQFPYERFRELGYEVAHV 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPH 115
           G   +NGVAI S+    ++           +   +               +RI +LY+P+
Sbjct: 61  GLSQWNGVAIASRVGLEDVQIGFEDQPGFHKDPEVAPAQEARAIGATCNGVRIWSLYVPN 120

Query: 116 GNPITSTKYDDKISWIKRFLRFASQRLELEEPLIF--AGDYNIIPQPHDCYNPIIWENDA 173
           G  +    Y  K+ W+ +    A   L           GD+N+ P   D ++P ++E   
Sbjct: 121 GRELADPHYTYKLDWLAKLHTDAVGWLGQNPDAQIALVGDWNVAPTDEDVWDPALFEGKT 180

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
             +   R++FQ     GF D +R       +Y++WDY    + K +G+RID ++ SP   
Sbjct: 181 HTSAPEREAFQAFVESGFADVVRPHTPGPGVYTYWDYTQLRFPKKQGMRIDFVLGSPALA 240

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
             +  A ID   R     SDH PVIV L
Sbjct: 241 GRVDKAEIDRNERKGKGASDHAPVIVDL 268


>gi|299530483|ref|ZP_07043903.1| exodeoxyribonuclease III Xth [Comamonas testosteroni S44]
 gi|298721459|gb|EFI62396.1| exodeoxyribonuclease III Xth [Comamonas testosteroni S44]
          Length = 258

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 90/259 (34%), Positives = 142/259 (54%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+  N  D + LQE K  D  FP    +   Y   + GQK
Sbjct: 1   MKIATWNVNSLSVRLPQVLDWLAANPVDALGLQELKLTDDKFPHMAFEEAGYKAVSHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA +++    ++V ++PG D D QAR I  T       +R+ N Y  +G    S K
Sbjct: 61  TYNGVAWITRDTGRDVVRNIPGLD-DEQARIIATTIDSPNGEIRLINGYFVNGQEPGSEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++    +   ++ L   L+  GD+N+ P+  D Y+P+  ++    T+E R  F
Sbjct: 120 FAYKMRWLQALHDWIQNQMTLHPRLVLVGDFNVAPEDRDSYDPVGLKDTIHHTVEERDHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q+L  +G +DA R        YS+WDY    + KN+G+RIDHI++S    S + +  +D 
Sbjct: 180 QRLLQLGLSDAFRMFEQPEKSYSWWDYRMLGFQKNRGLRIDHILVSEALKSKVSACSVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR   +PSDH PV+V+L+
Sbjct: 240 APRKNKQPSDHAPVVVTLN 258


>gi|256824430|ref|YP_003148390.1| Exodeoxyribonuclease III [Kytococcus sedentarius DSM 20547]
 gi|256687823|gb|ACV05625.1| Exodeoxyribonuclease III [Kytococcus sedentarius DSM 20547]
          Length = 281

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 82/282 (29%), Positives = 128/282 (45%), Gaps = 13/282 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR+  +A +++ +  D++ LQETK +D  FP E    L Y I   G  
Sbjct: 1   MRIATWNVNSLRARLDRVAEFLQRHEVDVLALQETKVQDDKFPAERFAELGYEIAFHGLN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEAT------------FTINTQTLRIGNL 111
            +NGVAI S+    ++    P          +EA                 T  +R+ +L
Sbjct: 61  QWNGVAIASRVGLEDVTVAFPDQPGWGDEPVVEARALGATVGGQPRADGSATPRIRLWSL 120

Query: 112 YLPHGNPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWEN 171
           Y+P+G  I     D K+ W+      A      + PL   GD+N+ P   D ++   +E 
Sbjct: 121 YVPNGREIGHPHMDYKVGWLDTLAGHAGTWAGEDLPLALVGDFNVAPLDTDVWDIAAFEG 180

Query: 172 DACFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPE 231
               T   R +FQ   + G  D +R  H     +++WDY    + K +G+RID ++ S  
Sbjct: 181 HTHVTEPERAAFQGFLDAGLVDVVR-PHTEPDTFTYWDYQQLRFPKRQGMRIDFVLGSQP 239

Query: 232 ATSLLHSARIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDS 273
               +  A +D + R     SDH PV+V L I  P   +   
Sbjct: 240 FADRVTGAFVDREERKGKGASDHAPVVVDLAIDLPTGTRDTP 281


>gi|317492293|ref|ZP_07950722.1| exodeoxyribonuclease III [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919632|gb|EFV40962.1| exodeoxyribonuclease III [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 269

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 83/268 (30%), Positives = 123/268 (45%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I ++ PD+I LQETK  D  FP   L+ L YHI   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIAKHQPDVIGLQETKVHDDMFPLADLEHLGYHIFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K QP+ +    P D+ D Q R I A     T  L + N Y P G       
Sbjct: 61  GHYGVALLTKEQPLAVRKGFPTDEEDAQRRIIMADIATPTGVLTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACFT 176
            +  K  + +    +          +I  GD NI P   D           +      F 
Sbjct: 121 KFPAKTKFYQDLQNYLETEQTPAGQVIVMGDVNISPTDSDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L+N G  D  R  +   +  +S++DY +  + +N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLKNWGLIDTYRQANPERNDQFSWFDYRSKGFDENRGLRIDLVLASQSLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID + RG  KPSDH P+     +
Sbjct: 241 CIDTGIDYEIRGMEKPSDHAPIWADFKL 268


>gi|302555181|ref|ZP_07307523.1| exodeoxyribonuclease III [Streptomyces viridochromogenes DSM 40736]
 gi|302472799|gb|EFL35892.1| exodeoxyribonuclease III [Streptomyces viridochromogenes DSM 40736]
          Length = 259

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 80/260 (30%), Positives = 128/260 (49%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++CLQE K  ++ FP E L+ L Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCLQEAKVAEEQFPSEQLRELGYESAVHATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++V  LPGD     +    A        LR+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVLSRVGIEDVVKGLPGDPGFDGSVEPRAISATCGP-LRVWSVYVPNGREVDHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +      +       P    GDYN+ P   D ++P  + +    T   R + 
Sbjct: 120 YAYKLQWFEALKAAVAGDAAGSRPFAVMGDYNVAPTDDDVFDPAAFADSTHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +       H +++WDY    + KN+G+RID +  +   T  +  A +D 
Sbjct: 180 ASLREAGLSDVVPRPLKYEHPFTYWDYRQLCFPKNRGMRIDLVYANEPFTKAVEDAYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDV 259


>gi|89901754|ref|YP_524225.1| exodeoxyribonuclease III [Rhodoferax ferrireducens T118]
 gi|89346491|gb|ABD70694.1| Exodeoxyribonuclease III [Rhodoferax ferrireducens T118]
          Length = 274

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 86/259 (33%), Positives = 134/259 (51%), Gaps = 5/259 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
            +  ATWNVNS+  R+  +  W++ N  D++ LQE K  D  FP +  +   YH E  GQ
Sbjct: 15  TMKFATWNVNSLTVRLPQVLDWLQANPVDVLALQELKLTDDKFPVDAFRQAGYHAECFGQ 74

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVA+LS+   + +V ++PG   D+               +R+   Y P+G    S 
Sbjct: 75  KTYNGVALLSREPALNVVRNVPGFADDMARSISAEVNG-----VRVIGAYFPNGQEPGSD 129

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K++ K++W+K    +    L     L+  GDYNI     D ++P+  ++    T E R  
Sbjct: 130 KFEYKMAWLKGLRDWVRGELLTHPRLVLMGDYNITFDDADVWDPVGLKDTIHCTEEERYH 189

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
            + L  +G  D+ R        YS+WDY   ++ +N G+RIDHI++S     L+ +  ID
Sbjct: 190 LRALIALGLHDSFRLFAQPEKSYSWWDYRDFAFRRNHGLRIDHILVSDALKPLVTACVID 249

Query: 243 TKPRGWTKPSDHTPVIVSL 261
             PR   +PSDH PV+V+L
Sbjct: 250 KAPRKNERPSDHAPVVVTL 268


>gi|289705726|ref|ZP_06502110.1| exodeoxyribonuclease III [Micrococcus luteus SK58]
 gi|289557566|gb|EFD50873.1| exodeoxyribonuclease III [Micrococcus luteus SK58]
          Length = 275

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 78/274 (28%), Positives = 133/274 (48%), Gaps = 16/274 (5%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   + A+++ ++ D++ +QETK  D+NFP+E  +   Y +   G  
Sbjct: 1   MKIATWNVNSLRARADRVEAFLERHDIDVLAIQETKCRDENFPWELFERAGYEVVHNGTS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT------------INTQTLRIGNL 111
            +NGVAI S+    ++    PG     +        +                 +R+ +L
Sbjct: 61  QWNGVAIASRVGLSDVQRGFPGQPHFGKGGVDPQEESRAIGATVGAEAADGVAPVRLWSL 120

Query: 112 YLPHGNPITSTKYDDKISWIKRFLRFASQRLELEEPLI--FAGDYNIIPQPHDCYNPIIW 169
           Y+P+G  + +     K+ W++     A+ RL  +       AGD+NI PQ  D ++  ++
Sbjct: 121 YVPNGRGLENEHMGYKLEWLRVLQEHAAARLAEDPDTRLALAGDWNIAPQDEDVWDIELF 180

Query: 170 E--NDACFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIM 227
           +       +   R +F   ++ G  D +R  H    +Y++WDY   ++ K KG+RID  +
Sbjct: 181 QREGYTHVSPAERAAFHAFEDAGLVDVVRPRHPGPGVYTYWDYTGLAFPKKKGMRIDFQL 240

Query: 228 LSPEATSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
            SP     +  A ID + R     SDH PV+V L
Sbjct: 241 CSPALAQTVTDAWIDREERKGKGASDHAPVVVEL 274


>gi|21224654|ref|NP_630433.1| exonuclease [Streptomyces coelicolor A3(2)]
 gi|3367747|emb|CAA20072.1| putative exonuclease [Streptomyces coelicolor A3(2)]
          Length = 259

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 77/260 (29%), Positives = 124/260 (47%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++CLQE K  +  FPF+ L+   Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCLQEAKVAEAQFPFDALREAGYEAAVHATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++V  LPGD      +   A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVLSRVGLEDVVKGLPGDPGYEGVQEPRAISATCGP-VRVWSVYVPNGREVDHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +              P    GDYN+ P   D Y+   +E     T   R + 
Sbjct: 120 YAYKLQWFEALRAAVEGDAAGGRPFAVLGDYNVAPTDDDVYDRAAFEGATHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +       H +++WDY    + KN+G+RID +  +      +  + +D 
Sbjct: 180 ASLRGAGLSDVVPRPLKYDHPFTYWDYRQLCFPKNRGMRIDLVYGNEPFAKAVTDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDL 259


>gi|294632194|ref|ZP_06710754.1| exodeoxyribonuclease III [Streptomyces sp. e14]
 gi|292835527|gb|EFF93876.1| exodeoxyribonuclease III [Streptomyces sp. e14]
          Length = 261

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 79/260 (30%), Positives = 124/260 (47%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++CLQE K  +  FP E L+ L Y        
Sbjct: 3   MRIATWNVNSITARLPRLLAWLESSGTDVLCLQEAKVAEDQFPAEQLRELGYESAVHATG 62

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++V  LPGD      +   A        +R+ ++Y+P+G  +    
Sbjct: 63  RWNGVAVLSRVGLADVVKGLPGDPGYDGVQEPRAVSATCGP-VRVWSVYVPNGREVDHPH 121

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +      +       P    GDYN+ P   D Y+   +E     T   R + 
Sbjct: 122 YAYKLEWFEALKAAVAGDAAGSRPFAVLGDYNVAPTDDDVYDRAAFEGATHVTPAERAAL 181

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G  D +       H +++WDY    + KN+G+RID +  +      +  A +D 
Sbjct: 182 ASLREAGLADVVPRPLKYEHPFTYWDYRQLCFPKNRGMRIDLVYGNEPFAKAVTDAYVDR 241

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 242 EERKGKGASDHAPVVVDLDV 261


>gi|91777907|ref|YP_553115.1| exodeoxyribonuclease III [Burkholderia xenovorans LB400]
 gi|91690567|gb|ABE33765.1| Exodeoxyribonuclease III [Burkholderia xenovorans LB400]
          Length = 270

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 104/272 (38%), Positives = 154/272 (56%), Gaps = 5/272 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M+ + +AT+N+N IR+R+  L  W++   PDI+CLQE K  D  FP E L+   Y     
Sbjct: 1   MAKLRIATFNINGIRSRLPALLQWLEREAPDIVCLQELKAADSAFPVEQLRDAGYGAIWQ 60

Query: 61  GQKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ ++NGVAILSK   P+E    LPG + D  +R++EA        + +  LYLP+GNP 
Sbjct: 61  GQSAWNGVAILSKGEAPLESRRGLPGFEDDTHSRYLEAAVGG----IVVACLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K+D K++W    +R A++      P++ AGD+N++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFDYKLAWFDHLIRHAAKLYRSGHPVVLAGDFNVVPTDEDIYNPRSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+ +++L   G+TDA+R       +Y+FWDY+   W  N G+RIDH++LS +    L  A
Sbjct: 177 RERYRQLLAQGWTDALRTRFGNERVYTFWDYFRRHWETNSGLRIDHLLLSADLAPRLRDA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQ 271
            +D   RG    SDH P  V L++   R+K+ 
Sbjct: 237 GVDRWVRGEPHASDHAPTWVELEMGAGRRKKS 268


>gi|256422393|ref|YP_003123046.1| exodeoxyribonuclease III Xth [Chitinophaga pinensis DSM 2588]
 gi|256037301|gb|ACU60845.1| exodeoxyribonuclease III Xth [Chitinophaga pinensis DSM 2588]
          Length = 259

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 99/257 (38%), Positives = 148/257 (57%), Gaps = 2/257 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN +  R+  L  W++E+ PD++CLQE K   + FP + ++   Y+    GQK
Sbjct: 1   MKIATYNVNGVNGRLPVLLRWLEESAPDVVCLQELKAPQEKFPEQAIRDAGYNAIWHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAIL++   IE +        D +         +      +G LYLP+GNP    K
Sbjct: 61  SWNGVAILARNLQIEEIRRAL--PGDPEDVHSRYIEAVINGDFILGCLYLPNGNPAPGPK 118

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W KR    A + L  + P+I  GDYN++P   D Y P  W +DA F  E R +F
Sbjct: 119 FDYKLNWFKRLTAHAKELLAQDVPVILTGDYNVMPTELDVYKPERWVDDALFRPETRAAF 178

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L  +G+TDAIR  +    +Y+FWDY+ D++ +N G+RIDH +LSP     L +A +D 
Sbjct: 179 KELVELGWTDAIRKLYPEEKIYTFWDYFRDAYGRNAGLRIDHFLLSPHFGKRLKAAGVDR 238

Query: 244 KPRGWTKPSDHTPVIVS 260
             RGW K SDH PV + 
Sbjct: 239 DVRGWEKTSDHAPVWIE 255


>gi|86607730|ref|YP_476492.1| exodeoxyribonuclease III [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86556272|gb|ABD01229.1| exodeoxyribonuclease III [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 261

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 94/262 (35%), Positives = 140/262 (53%), Gaps = 3/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNP-DIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           + VATWNVNSIR R+  + AW+      D++CLQETK  D++FP    Q   +H+E  GQ
Sbjct: 1   MQVATWNVNSIRTRLPQVLAWLDSQGSLDVLCLQETKVVDEDFPRAAFQERGFHVEVYGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEAT-FTINTQTLRIGNLYLPHGNPITS 121
           KSYNGVA++S+  P ++                +    +   + +RI NLY+P+G  + S
Sbjct: 61  KSYNGVALISRDPPEKVERGFGALLPSAADLDEQKRLMSAIYRGIRILNLYVPNGAEVGS 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY  K+ W+     + +  L   +P++  GD+NI  +  D Y+P           E + 
Sbjct: 121 EKYAYKLRWLATLKDYLAVALSQGDPILLCGDFNIALEDRDIYDPQKAGEIMASEPERQ- 179

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           + Q++  +GF DA R        +S+WDY +  + +N+G RIDH  LS E      +  I
Sbjct: 180 ALQEILALGFEDAFRRFTPDPGHFSWWDYRSGGFQRNRGWRIDHHYLSRELQEKATACWI 239

Query: 242 DTKPRGWTKPSDHTPVIVSLDI 263
           D +PR   KPSDH PVIV+LDI
Sbjct: 240 DVEPRRAEKPSDHAPVIVALDI 261


>gi|254818951|ref|ZP_05223952.1| exodeoxyribonuclease III [Mycobacterium intracellulare ATCC 13950]
          Length = 268

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 80/268 (29%), Positives = 125/268 (46%), Gaps = 7/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR+R+  +  W+   + D++ +QETK  D  FP      L Y +   G  
Sbjct: 1   MRIATWNVNSIRSRLPRVLDWLARTDVDVLAMQETKCSDSQFPTLPFFELGYEVAHVGFN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLD-----VQARFIEATFTINTQTLRIGNLYLPHGNP 118
            +NGVAI S+    ++     G         V A             +R+ +LY+P+G  
Sbjct: 61  QWNGVAIASRVGLDDVQIGFDGQPTWSGKPEVAAVAEARALAATCGGVRLWSLYVPNGRA 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEEP--LIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           +    Y  K+ W+      A   L  +    +  AGD+NI PQ  D ++   +      +
Sbjct: 121 LGDPHYAYKLDWLAALRDSAEGWLRDDPGAAIALAGDWNIAPQDDDVWSMEFFAGATHVS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R++F  +    FTD +R       +Y++WDY    + K +G+RID I+ SP   S +
Sbjct: 181 APERRAFNAIVEAQFTDLVRPFAPGPGVYTYWDYTRLRFPKRQGMRIDFILGSPALASRV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSLDIP 264
             ARID + R     SDH PV+V L + 
Sbjct: 241 TDARIDREERKGKAASDHAPVLVDLRVD 268


>gi|217979561|ref|YP_002363708.1| exodeoxyribonuclease III Xth [Methylocella silvestris BL2]
 gi|217504937|gb|ACK52346.1| exodeoxyribonuclease III Xth [Methylocella silvestris BL2]
          Length = 303

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 122/279 (43%), Positives = 173/279 (62%), Gaps = 6/279 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN I  R+  L  W+KE  PD++CLQE K  D+ FP   L++  Y     GQK
Sbjct: 1   MKIATFNVNGINGRLSVLLRWLKETRPDVVCLQELKAPDERFPIRELENAGYGAIWHGQK 60

Query: 64  SYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           S+NGVAILS   +PIE    LPGD  D Q+R++EA        + +  LYLP+GNP    
Sbjct: 61  SWNGVAILSASGKPIETRRGLPGDPDDSQSRYLEAAIDG----IVVACLYLPNGNPAPGR 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W++R   +A++ L L+ P+I AGDYNIIP   D Y P  W +DA F LEVR++
Sbjct: 117 KFDYKLQWLQRLTDYAAELLALKVPVILAGDYNIIPTELDVYKPERWVDDALFRLEVREA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           FQ L + G+TDA+R  H    +Y+FWDY+ ++W +N G+R+DH++L+P  T  L +A +D
Sbjct: 177 FQILVSQGWTDALRTLHPGERVYTFWDYFRNAWDRNAGLRLDHLLLNPPVTKRLIAADVD 236

Query: 243 TKPRGWTKPSDHTPVIVSL-DIPEPRKKQQDSTSQNMKP 280
              RGW K SDH PV + L D   P ++   S+    +P
Sbjct: 237 RAVRGWEKASDHAPVWIELSDAARPLRRPSASSKGVARP 275


>gi|310814721|ref|YP_003962685.1| exodeoxyribonuclease III [Ketogulonicigenium vulgare Y25]
 gi|308753456|gb|ADO41385.1| exodeoxyribonuclease III [Ketogulonicigenium vulgare Y25]
          Length = 259

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 118/259 (45%), Positives = 163/259 (62%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR+  +  W+   +PD+   QE K+ D+ FP   ++ L Y++ET GQK
Sbjct: 1   MRIATYNINGIKARLETVTEWLTRESPDVAIFQEIKSVDEGFPRSAIEDLGYNLETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAI SK    ++   LPGDD D Q+R+IEAT  I    +RI  LYLP+GNP    K
Sbjct: 61  GFNGVAIASKLPMEDVTRGLPGDDNDEQSRWIEAT-VIGKTAVRICGLYLPNGNPAPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K++W++R  + A   L  EEP   AGDYN+IPQ  D  NP  W  DA +  + R +F
Sbjct: 120 YDYKLAWMERLHKRAEALLASEEPAFMAGDYNVIPQAEDAKNPAEWLEDALYLPQTRDAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFTDA RA       YSFWD+ A +W ++ GIRIDH +L+P+   LL +A I+ 
Sbjct: 180 RRILNLGFTDAFRAITQGPGHYSFWDFQAGAWQRDNGIRIDHFLLTPQCADLLQNAWIEK 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RG  KPSDH PV V LD
Sbjct: 240 DARGREKPSDHVPVWVELD 258


>gi|238794520|ref|ZP_04638129.1| Exodeoxyribonuclease III [Yersinia intermedia ATCC 29909]
 gi|238726203|gb|EEQ17748.1| Exodeoxyribonuclease III [Yersinia intermedia ATCC 29909]
          Length = 271

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 85/271 (31%), Positives = 131/271 (48%), Gaps = 8/271 (2%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   
Sbjct: 1   MLTMKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSQHGYHVFYH 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQK + GVA+L+K +P+ +    P D+ D Q R I A    +   L + N Y P G    
Sbjct: 61  GQKGHYGVALLTKNEPLAVRRGFPTDEEDAQRRIIMADIATSNGPLTVINGYFPQGESRD 120

Query: 121 STK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDA 173
               +  K  +     ++  Q+L  +  ++  GD NI P         D     +     
Sbjct: 121 HPIKFPAKERFYADLQQYLEQQLSADAQVLIMGDLNISPTDLDIGIGEDSRKRWLRTGKC 180

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEA 232
            F  E R    +LQN G  D  RA +   +  +S++DY +  + +N+G+RID ++ S   
Sbjct: 181 SFLPEERAWLARLQNWGLVDTFRAANPECNDQFSWFDYRSRGFDENRGLRIDLLLASQPL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
            +   +  ID + RG  KPSDH PV     +
Sbjct: 241 ATRCIATGIDYEIRGMEKPSDHAPVWSEFAL 271


>gi|327481832|gb|AEA85142.1| exodeoxyribonuclease III [Pseudomonas stutzeri DSM 4166]
          Length = 263

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 109/262 (41%), Positives = 159/262 (60%), Gaps = 5/262 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  + +AT+N+N IRAR+ NL  W++   PD++CLQE K +D +FP + ++   Y     
Sbjct: 1   MDRLKIATFNINGIRARLPNLLEWLEREQPDVVCLQELKAQDADFPIDDIRGAGYGAIWH 60

Query: 61  GQKSYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQKS+NGVAIL++  +P+EI   LPGD  D  +R++EA        + + +LYLP+GNP 
Sbjct: 61  GQKSWNGVAILARDSEPLEIRRGLPGDPDDSHSRYLEAAV----HGVIVASLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K+D K++W +R +  A+  L    P++ AGDYN++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFDYKLAWFERLIEHAAGLLASGHPVVLAGDYNVVPTDEDIYNPRSWRKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R  +++L   G+TDA+RA      +Y+FWDY+   W KN G+RIDH++LSP+    L +A
Sbjct: 177 RACYERLLAQGWTDALRAQFPDEPVYTFWDYFRQHWQKNSGLRIDHLLLSPDLAPCLQAA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            +D   RG    SDH P  VSL
Sbjct: 237 GVDRWVRGQEHASDHAPTWVSL 258


>gi|302537782|ref|ZP_07290124.1| exodeoxyribonuclease III [Streptomyces sp. C]
 gi|302446677|gb|EFL18493.1| exodeoxyribonuclease III [Streptomyces sp. C]
          Length = 259

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 76/260 (29%), Positives = 126/260 (48%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVNSI AR+  L AW++ +  D++C+QETK   + FP   L+ L Y        
Sbjct: 1   MRIATYNVNSITARLPRLLAWLESSGTDVLCVQETKCSAEQFPAAELRELGYESVVNATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++V  LPG       +   A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVALLSRVGLEDVVVGLPGGPDYEGVQEPRAISATCGG-VRVWSVYVPNGREVEHDH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W        ++      P    GD+N+ P   D Y+P ++      T   R + 
Sbjct: 120 YGYKLNWFGALATAIAEDAAGTRPFAVLGDFNVAPTDEDVYDPAVFAGLTHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L+  G  D +         Y+FWDY   ++ KN+G+RID +  +      +  A +D 
Sbjct: 180 EALRTAGLADVMPRALKYDRPYTFWDYRQLAFPKNRGMRIDLVYGNEPFAKAVKDAYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDL 259


>gi|126735878|ref|ZP_01751622.1| exodeoxyribonuclease III [Roseobacter sp. CCS2]
 gi|126714435|gb|EBA11302.1| exodeoxyribonuclease III [Roseobacter sp. CCS2]
          Length = 266

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 111/264 (42%), Positives = 154/264 (58%), Gaps = 6/264 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N ++ARI  L  WI E  PD+  LQE K+ D+ FP E  +   Y++ET GQK
Sbjct: 1   MKIATFNINGVKARIGALTDWIDEAQPDVAVLQEIKSVDEGFPREVFEDKGYNVETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT------QTLRIGNLYLPHGN 117
            +NGVAILSK    ++   LPG +   +    +             + +RI  LYLP+GN
Sbjct: 61  GFNGVAILSKLPLEDVTRGLPGAEGAGREGVDDEEARYIEATVVGEKAVRICGLYLPNGN 120

Query: 118 PITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTL 177
           P    KYD K+ W++R    A Q +  EE  +  GDYNIIPQ  D   P  W +DA F  
Sbjct: 121 PAPGPKYDYKLRWMERLHARAQQLMAHEEVALMCGDYNIIPQAEDAARPDAWRDDALFRQ 180

Query: 178 EVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLH 237
           + R +++++ N+GFT+A RA       YSFWDY A +W KN GIRIDH +L+P+   LL+
Sbjct: 181 DSRDAYRRILNLGFTEAFRAREAGAGHYSFWDYQAGAWDKNDGIRIDHFLLTPQCADLLN 240

Query: 238 SARIDTKPRGWTKPSDHTPVIVSL 261
           +  I++  RG  KPSDH PV V L
Sbjct: 241 TCWIESDVRGREKPSDHVPVWVDL 264


>gi|254422826|ref|ZP_05036544.1| exodeoxyribonuclease III [Synechococcus sp. PCC 7335]
 gi|196190315|gb|EDX85279.1| exodeoxyribonuclease III [Synechococcus sp. PCC 7335]
          Length = 261

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 92/261 (35%), Positives = 138/261 (52%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V +WNVNSIR R+  +  W++ N  D++CLQETK  DK+FP +    + YH    GQK
Sbjct: 1   MKVTSWNVNSIRTRLEQVTQWLQANPVDVLCLQETKVVDKDFPAQAFIDIGYHAYFYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQA---RFIEATFTINTQTLRIGNLYLPHGNPIT 120
           SYNGVA++S+     +         +         +   +     +RI NLY+P+G+ I 
Sbjct: 61  SYNGVALVSRAPLESVQMGFGAILDEATVGDLDAQKRVISGVLGNVRIVNLYVPNGSSIN 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           S KY+ K+SW+    ++   +LE    L   GD+NI  +  D Y     +     +   R
Sbjct: 121 SEKYEYKLSWLALLKQYLVHQLEAHPKLNVCGDFNIALENKDIYTDKNRDKHIMSSPVER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           Q+ + + ++G +DA R   D    +S+WDY  +S+++N G RIDH  LSP    +  S  
Sbjct: 181 QTLRDVLSVGLSDAFRKFTDEGGHFSWWDYRTNSFARNTGWRIDHHYLSPSLYEIATSCT 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           IDT PRG  +PSDH PV V  
Sbjct: 241 IDTVPRGLERPSDHAPVTVEY 261


>gi|217969881|ref|YP_002355115.1| exodeoxyribonuclease III Xth [Thauera sp. MZ1T]
 gi|217507208|gb|ACK54219.1| exodeoxyribonuclease III Xth [Thauera sp. MZ1T]
          Length = 254

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 138/258 (53%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+  N PD +CLQE K EDK FP   L++  YH    GQK
Sbjct: 1   MKIATWNVNSLKVRLPQVLDWLAANQPDALCLQELKLEDKAFPLAELEAAGYHAVFIGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS                + + + I A        +R+   Y P+G  + S K
Sbjct: 61  TYNGVAILSPQPIDAATVVRNIPGFEDEQKRIIAATIAG---VRVVCGYFPNGQAVGSDK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           ++ K+ W+     +    L+  E L+ AGD+NI P+  D +    W+++   +   R +F
Sbjct: 118 FEYKLRWLAALTEWLRAELKTHERLVLAGDFNIAPEDRDAHPD--WKDEIHVSAPERAAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + LQ +G  DA R        +S+WDY   ++ +N G+RIDH+++SP   +   +  +D 
Sbjct: 176 RALQELGLIDAFRLFEQPERAFSWWDYRMMAFRRNFGLRIDHLLVSPALRAACRNCVVDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PR   +PSDH PV++ L
Sbjct: 236 EPRRLERPSDHAPVVLEL 253


>gi|238751649|ref|ZP_04613139.1| Exodeoxyribonuclease III [Yersinia rohdei ATCC 43380]
 gi|238710211|gb|EEQ02439.1| Exodeoxyribonuclease III [Yersinia rohdei ATCC 43380]
          Length = 271

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 86/271 (31%), Positives = 130/271 (47%), Gaps = 8/271 (2%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   
Sbjct: 1   MLTMKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSQHGYHVFYH 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQK + GVA+L+K QP+ +    P D+ D Q R I A       TL + N Y P G    
Sbjct: 61  GQKGHYGVALLTKEQPLAVRRGFPTDEEDAQRRIIMADIATPQGTLTVINGYFPQGESRD 120

Query: 121 STK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDA 173
               +  K  +     ++  Q L  E  ++  GD NI P         +     +     
Sbjct: 121 HPIKFPAKQRFYADLQQYLEQHLSPESQVLIMGDINISPTDLDIGIGEESRKRWLRTGKC 180

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEA 232
            F  E R   + LQ+ G  D  RA +   +  +S++DY +  + +N+G+RID ++ S   
Sbjct: 181 SFLPEERAWLEHLQSWGLVDTFRAANPDCNDQFSWFDYRSRGFDENRGLRIDLLLASQPL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
            +   +  ID + RG  KPSDH PV     +
Sbjct: 241 AARCIATGIDYEIRGMEKPSDHAPVWSEFAL 271


>gi|148548255|ref|YP_001268357.1| exodeoxyribonuclease III [Pseudomonas putida F1]
 gi|148512313|gb|ABQ79173.1| Exodeoxyribonuclease III [Pseudomonas putida F1]
          Length = 265

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 104/262 (39%), Positives = 152/262 (58%), Gaps = 5/262 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  + +AT+N+N IR+R+  L AW++   PDI CLQE K  D+ FP   L++  Y     
Sbjct: 1   MKALKIATFNINGIRSRLPALLAWLEREQPDIACLQELKAADQQFPRAELEAAGYGSLHH 60

Query: 61  GQKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ S+NGVAIL +   P+E+   LPG + D Q+R++EA        + +  LYLP+GNP 
Sbjct: 61  GQPSWNGVAILVRGSDPLEVRRGLPGLEEDSQSRYLEAA----AHGVLVACLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K+D K+ W +  ++ A    E   P + AGD+N++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFDYKLHWFECLIQHARSLYESGHPTLLAGDFNVVPTDMDIYNPRSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R  +Q+L + G+ DAIR  +    +Y+FWDY+ + W++N G+RIDH++L+PE    L  A
Sbjct: 177 RACYQRLLDQGWLDAIRHLYPDERVYTFWDYFRNHWARNAGLRIDHLLLNPELAPYLKRA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            +D   R   K SDH PV + L
Sbjct: 237 GVDAWVRNEAKASDHAPVWIEL 258


>gi|330466791|ref|YP_004404534.1| exodeoxyribonuclease III Xth [Verrucosispora maris AB-18-032]
 gi|328809762|gb|AEB43934.1| exodeoxyribonuclease III Xth [Verrucosispora maris AB-18-032]
          Length = 265

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 76/257 (29%), Positives = 126/257 (49%), Gaps = 2/257 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++AR+  L  W+    PD++CLQETK  D  FP   +  L Y + +    
Sbjct: 1   MRLATWNVNSVKARLPRLLDWLAGTEPDVVCLQETKCPDGAFPVAEVGDLGYTVASHSDG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILS+    ++    PG+    +        T +   +R+ ++Y+P+G       
Sbjct: 61  RWNGVAILSRIGLSDVTVGFPGEPGFPEPEARAIAATCDG--VRVWSVYVPNGRTPDDPH 118

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+          L     L   GD+N+ P   D ++P ++      T   R + 
Sbjct: 119 YAYKLAWLAALRDALDAELTDGRALAVCGDFNVAPTDDDVWDPALFATSTHVTPAERAAL 178

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+++G  D +       H +++WDY A  + +NKG+RID +  S      + SA +D 
Sbjct: 179 AALRDLGLVDVVPTPMKGPHPFTYWDYRAGMFHQNKGMRIDLVYASAPFARTVSSAYVDR 238

Query: 244 KPRGWTKPSDHTPVIVS 260
           + R    PSDH P++V 
Sbjct: 239 EARKGRSPSDHAPIVVD 255


>gi|227820280|ref|YP_002824251.1| exonuclease [Sinorhizobium fredii NGR234]
 gi|227339279|gb|ACP23498.1| probable exonuclease [Sinorhizobium fredii NGR234]
          Length = 257

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 88/259 (33%), Positives = 141/259 (54%), Gaps = 3/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N +  R+ NL AW+    PD++CLQE K  D  FP   +++  Y     GQ 
Sbjct: 1   MKIATFNINGVNKRLENLLAWLDAAEPDVVCLQELKATDGQFPKSAIEAAGYGAVWRGQS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVAIL++     +      +     +             + I  LY P+GNP    K
Sbjct: 61  AWNGVAILARDSEPVLTR---TELPGDPSDTQSRYIEAAVNGILIAALYAPNGNPQPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W +R    A++ LE   P++ AGDYNI+P+P D Y    ++++A    E R +F
Sbjct: 118 FDYKLAWHRRLAGHAAELLETGLPVVLAGDYNIVPEPRDIYPTRSYDDNALVQPESRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L + G+ DA+R  +    L++FWDY  + W +N G+R+DHI+LS +    L    ID 
Sbjct: 178 RQLLDQGWLDALRKVYPDEELFTFWDYRRNRWQRNAGLRLDHILLSRKLARRLTGGGIDR 237

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RG    SDH PV ++L+
Sbjct: 238 DVRGQENASDHAPVWIALE 256


>gi|238561644|ref|ZP_00441777.2| exodeoxyribonuclease III [Burkholderia mallei GB8 horse 4]
 gi|254200314|ref|ZP_04906680.1| exodeoxyribonuclease III [Burkholderia mallei FMH]
 gi|254209389|ref|ZP_04915735.1| exodeoxyribonuclease III [Burkholderia mallei JHU]
 gi|147749910|gb|EDK56984.1| exodeoxyribonuclease III [Burkholderia mallei FMH]
 gi|147750162|gb|EDK57233.1| exodeoxyribonuclease III [Burkholderia mallei JHU]
 gi|238524267|gb|EEP87701.1| exodeoxyribonuclease III [Burkholderia mallei GB8 horse 4]
          Length = 269

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 134/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ +++ D++CLQE K  D+ FP E L++  Y     GQK
Sbjct: 12  MRIATWNVNSLNVRKQHVLDWLAQSDVDVLCLQELKIPDEKFPREALEAAGYRSWFAGQK 71

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       T +  +    +              +RI + Y P+G  + S K
Sbjct: 72  TYNGVAILARASLPFDETDIVRNIPGFEDAQQRLIAATIDG-VRIVSAYFPNGQALDSDK 130

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 131 FVYKMQWLDALQAWLKDELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 190

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 191 AQLVALGFVDAFRRFEQPEKTFTWWDYRMLAFRRNAGLRIDHILLSPALAETCTSCTVDR 250

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDHTPV+  L
Sbjct: 251 VPRTWEQPSDHTPVVAQL 268


>gi|312113058|ref|YP_004010654.1| exodeoxyribonuclease III Xth [Rhodomicrobium vannielii ATCC 17100]
 gi|311218187|gb|ADP69555.1| exodeoxyribonuclease III Xth [Rhodomicrobium vannielii ATCC 17100]
          Length = 262

 Score =  210 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 128/260 (49%), Positives = 167/260 (64%), Gaps = 1/260 (0%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           ++TVATWNVNSI+ R      W+K   PD++CLQE K + + FP    + L Y+    GQ
Sbjct: 1   MLTVATWNVNSIKQREIAAVQWLKRARPDVLCLQEIKCQTEAFPRGAFEDLGYNCAVIGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT-LRIGNLYLPHGNPITS 121
           KS+NGVAILSK+   E V  LPGDD D Q+R+IEA  ++      R+ ++Y P+GNP+ S
Sbjct: 61  KSFNGVAILSKFPIDETVVGLPGDDTDEQSRYIEAVLSLPGGGAFRVASVYAPNGNPVAS 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            K D K+ W+ RF   A   L  EEP   AGDYNIIP+  D YNP  W  DA + LE RQ
Sbjct: 121 PKLDYKLEWLARFKAHAETLLSYEEPFALAGDYNIIPRGIDVYNPAAWTEDALYRLESRQ 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +F+++ N+G  DA+ A +     ++FWDY A +W KN G+RIDHI+LSP+A S L S  I
Sbjct: 181 AFRRILNLGLADAVEACNSGGGQFTFWDYQAGAWQKNLGLRIDHILLSPQAFSRLRSTVI 240

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D  PR W KPSDHTPV V+L
Sbjct: 241 DRTPRSWDKPSDHTPVQVTL 260


>gi|254447579|ref|ZP_05061045.1| exodeoxyribonuclease III [gamma proteobacterium HTCC5015]
 gi|198262922|gb|EDY87201.1| exodeoxyribonuclease III [gamma proteobacterium HTCC5015]
          Length = 261

 Score =  210 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 85/258 (32%), Positives = 136/258 (52%), Gaps = 2/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS++ R+  +  W+++ N D++CLQETK  D  FP   ++   Y +   GQK
Sbjct: 1   MKIASWNVNSLKVRLPYVLDWLEQTNTDVLCLQETKLTDDKFPDLAIEEAGYEVAFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL K     +   +      V  +      TI    +R+ +LY+ +G  + S K
Sbjct: 61  TYNGVAILLKKNAASLRDVVTDVPGLVDPQRRIMAATIGD--VRVIDLYVVNGKEVGSDK 118

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K+ W+K+   +  Q+ +  E LI  GD+NI P+  D Y+PI W      +   R + 
Sbjct: 119 YDYKLHWLKKVGDYIEQQSQQYEKLIVLGDFNIAPEDEDVYDPIAWSEKILCSTPERDAL 178

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++++ G  D  R  +     YS+WD+    +   +G+RID I+ S     +L    ID 
Sbjct: 179 KRIKDNGLKDCFRMLNQDSGEYSWWDFRTKGFENGRGLRIDLILASEALQKVLKGCWIDR 238

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PR   KPSDH PV+   
Sbjct: 239 QPRAGEKPSDHAPVVAEF 256


>gi|254561142|ref|YP_003068237.1| exodeoxyribonuclease III [Methylobacterium extorquens DM4]
 gi|254268420|emb|CAX24377.1| Exodeoxyribonuclease III (Exonuclease III) (EXO III) (AP
           endonuclease VI) [Methylobacterium extorquens DM4]
          Length = 264

 Score =  210 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 115/261 (44%), Positives = 161/261 (61%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNSI+ R+ +L  ++ E  PD++CLQE K +D +FP E +++  Y +ET GQK
Sbjct: 1   MRITTWNVNSIKQRVGHLLGFLDEAKPDVVCLQELKCQDASFPREEIEAAGYAVETLGQK 60

Query: 64  SYNGVAILSKYQPIEIV--THLPGDDLDVQARFIEATFTINTQ-TLRIGNLYLPHGNPIT 120
           +YNGVA+L +           LPGD  D QAR+IEA         +R+ ++YLP+GNP  
Sbjct: 61  AYNGVALLVRAPLQYTQLLRGLPGDAEDEQARYIEALVHGEGVAPVRVASIYLPNGNPAP 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             KY  K++++ R    A   +  EE L+ AGD+N+IP+P D  +P  W  DA F  E R
Sbjct: 121 GPKYSYKLAFMARLRTHARALMTTEEALVLAGDFNVIPEPEDAADPTAWTQDALFLPETR 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           ++F+ L   GFTD +RA   +  LY+FWDY A  W +N+GIRIDH++LSP+A   L SA 
Sbjct: 181 RAFRALVAEGFTDGLRACEPSAGLYTFWDYQAGCWPRNQGIRIDHLLLSPQAADRLVSAS 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           +    RG  KPSDH PV V L
Sbjct: 241 VQRHLRGLEKPSDHVPVTVEL 261


>gi|238028045|ref|YP_002912276.1| exodeoxyribonuclease III xth [Burkholderia glumae BGR1]
 gi|237877239|gb|ACR29572.1| Exodeoxyribonuclease III xth [Burkholderia glumae BGR1]
          Length = 258

 Score =  210 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 82/256 (32%), Positives = 127/256 (49%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+  +  D++CLQE K  D+ FP   L++  Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLASSQTDVLCLQELKLPDEKFPKADLEAAGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL +   + +       ++       +         +RI + Y P+G    + K
Sbjct: 61  TYNGVAILVRDT-LGVDETDVVKNIPGFEDAQQRVIAATVNGVRIVSAYFPNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L     L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FAYKMQWLDALQAWLKDELARHPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L  MG  DA R        +++WDY    + +N G+RIDHI+LSP   + L +  +D 
Sbjct: 180 AALLGMGLVDAFRRFEQPEKTFTWWDYRMLGFRRNAGLRIDHILLSPALATTLRACEVDR 239

Query: 244 KPRGWTKPSDHTPVIV 259
           +PRGW +PSDH P+  
Sbjct: 240 EPRGWEQPSDHAPIFA 255


>gi|270159292|ref|ZP_06187948.1| exodeoxyribonuclease III [Legionella longbeachae D-4968]
 gi|289165884|ref|YP_003456022.1| exodeoxyribonuclease III XthA [Legionella longbeachae NSW150]
 gi|269987631|gb|EEZ93886.1| exodeoxyribonuclease III [Legionella longbeachae D-4968]
 gi|288859057|emb|CBJ12986.1| putative exodeoxyribonuclease III XthA [Legionella longbeachae
           NSW150]
          Length = 259

 Score =  210 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 94/263 (35%), Positives = 155/263 (58%), Gaps = 5/263 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           ++ +A+WNVNS++ R+  + +W+  ++ DI+ +QETK  D NFP    +   YH+   GQ
Sbjct: 1   MIKLASWNVNSLKVRLEQVISWLDSSHVDILAIQETKLIDDNFPRAVFEEKGYHVVFSGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVAI+S+Y   +++T +P  D   +         +     R+ NLY+P+G+ +TS 
Sbjct: 61  KTYNGVAIISRYPFSDVLTDIPDLDDPQRRIL-----IVTVAGFRLINLYVPNGSELTSD 115

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K+ W+++   F  Q++ +   +   GD+NI P+  D ++PI WE     +   R +
Sbjct: 116 KYQYKLDWLQKVTNFIQQQINIYSKIAVVGDFNIAPEDRDVHDPIAWEGSVLVSPAERNA 175

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F +L  +GF D+ R        +S+WDY A ++ +N+G+RIDHI+LS E   L   + ID
Sbjct: 176 FVQLLQLGFHDSFRNFVQEDQSFSWWDYRAAAFRRNRGLRIDHILLSKELNHLCTQSVID 235

Query: 243 TKPRGWTKPSDHTPVIVSLDIPE 265
            +PR   +PSDH PV V+L++ E
Sbjct: 236 KEPRKVERPSDHAPVWVALELSE 258


>gi|53724173|ref|YP_103357.1| exodeoxyribonuclease III [Burkholderia mallei ATCC 23344]
 gi|121601562|ref|YP_993558.1| exodeoxyribonuclease III [Burkholderia mallei SAVP1]
 gi|124384052|ref|YP_001029013.1| exodeoxyribonuclease III [Burkholderia mallei NCTC 10229]
 gi|126440535|ref|YP_001059656.1| exodeoxyribonuclease III [Burkholderia pseudomallei 668]
 gi|126449755|ref|YP_001081066.1| exodeoxyribonuclease III [Burkholderia mallei NCTC 10247]
 gi|126452052|ref|YP_001066939.1| exodeoxyribonuclease III [Burkholderia pseudomallei 1106a]
 gi|134277971|ref|ZP_01764686.1| exodeoxyribonuclease III [Burkholderia pseudomallei 305]
 gi|167003440|ref|ZP_02269226.1| exodeoxyribonuclease III [Burkholderia mallei PRL-20]
 gi|167720390|ref|ZP_02403626.1| exodeoxyribonuclease III [Burkholderia pseudomallei DM98]
 gi|167739381|ref|ZP_02412155.1| exodeoxyribonuclease III [Burkholderia pseudomallei 14]
 gi|167816592|ref|ZP_02448272.1| exodeoxyribonuclease III [Burkholderia pseudomallei 91]
 gi|167846507|ref|ZP_02472015.1| exodeoxyribonuclease III [Burkholderia pseudomallei B7210]
 gi|167895086|ref|ZP_02482488.1| exodeoxyribonuclease III [Burkholderia pseudomallei 7894]
 gi|167903470|ref|ZP_02490675.1| exodeoxyribonuclease III [Burkholderia pseudomallei NCTC 13177]
 gi|167911721|ref|ZP_02498812.1| exodeoxyribonuclease III [Burkholderia pseudomallei 112]
 gi|167919720|ref|ZP_02506811.1| exodeoxyribonuclease III [Burkholderia pseudomallei BCC215]
 gi|217421040|ref|ZP_03452545.1| exodeoxyribonuclease III [Burkholderia pseudomallei 576]
 gi|237813050|ref|YP_002897501.1| exodeoxyribonuclease III [Burkholderia pseudomallei MSHR346]
 gi|242317870|ref|ZP_04816886.1| exodeoxyribonuclease III [Burkholderia pseudomallei 1106b]
 gi|254178518|ref|ZP_04885173.1| exodeoxyribonuclease III [Burkholderia mallei ATCC 10399]
 gi|254184341|ref|ZP_04890931.1| exodeoxyribonuclease III [Burkholderia pseudomallei 1655]
 gi|254191371|ref|ZP_04897875.1| exodeoxyribonuclease III [Burkholderia pseudomallei Pasteur 52237]
 gi|254195861|ref|ZP_04902287.1| exodeoxyribonuclease III [Burkholderia pseudomallei S13]
 gi|254261312|ref|ZP_04952366.1| exodeoxyribonuclease III [Burkholderia pseudomallei 1710a]
 gi|254297001|ref|ZP_04964454.1| exodeoxyribonuclease III [Burkholderia pseudomallei 406e]
 gi|254357938|ref|ZP_04974211.1| exodeoxyribonuclease III [Burkholderia mallei 2002721280]
 gi|52427596|gb|AAU48189.1| exodeoxyribonuclease III [Burkholderia mallei ATCC 23344]
 gi|121230372|gb|ABM52890.1| exodeoxyribonuclease III [Burkholderia mallei SAVP1]
 gi|124292072|gb|ABN01341.1| exodeoxyribonuclease III [Burkholderia mallei NCTC 10229]
 gi|126220028|gb|ABN83534.1| exodeoxyribonuclease III [Burkholderia pseudomallei 668]
 gi|126225694|gb|ABN89234.1| exodeoxyribonuclease III [Burkholderia pseudomallei 1106a]
 gi|126242625|gb|ABO05718.1| exodeoxyribonuclease III [Burkholderia mallei NCTC 10247]
 gi|134251621|gb|EBA51700.1| exodeoxyribonuclease III [Burkholderia pseudomallei 305]
 gi|148027065|gb|EDK85086.1| exodeoxyribonuclease III [Burkholderia mallei 2002721280]
 gi|157807529|gb|EDO84699.1| exodeoxyribonuclease III [Burkholderia pseudomallei 406e]
 gi|157939043|gb|EDO94713.1| exodeoxyribonuclease III [Burkholderia pseudomallei Pasteur 52237]
 gi|160699557|gb|EDP89527.1| exodeoxyribonuclease III [Burkholderia mallei ATCC 10399]
 gi|169652606|gb|EDS85299.1| exodeoxyribonuclease III [Burkholderia pseudomallei S13]
 gi|184214872|gb|EDU11915.1| exodeoxyribonuclease III [Burkholderia pseudomallei 1655]
 gi|217396452|gb|EEC36469.1| exodeoxyribonuclease III [Burkholderia pseudomallei 576]
 gi|237503790|gb|ACQ96108.1| exodeoxyribonuclease III [Burkholderia pseudomallei MSHR346]
 gi|242141109|gb|EES27511.1| exodeoxyribonuclease III [Burkholderia pseudomallei 1106b]
 gi|243061042|gb|EES43228.1| exodeoxyribonuclease III [Burkholderia mallei PRL-20]
 gi|254220001|gb|EET09385.1| exodeoxyribonuclease III [Burkholderia pseudomallei 1710a]
          Length = 258

 Score =  210 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 134/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ +++ D++CLQE K  D+ FP E L++  Y     GQK
Sbjct: 1   MRIATWNVNSLNVRKQHVLDWLAQSDVDVLCLQELKIPDEKFPREALEAAGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       T +  +    +              +RI + Y P+G  + S K
Sbjct: 61  TYNGVAILARASLPFDETDIVRNIPGFEDAQQRLIAATIDG-VRIVSAYFPNGQALDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLKDELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 180 AQLVALGFVDAFRRFEQPEKTFTWWDYRMLAFRRNAGLRIDHILLSPALAETCTSCTVDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDHTPV+  L
Sbjct: 240 VPRTWEQPSDHTPVVAQL 257


>gi|149185250|ref|ZP_01863567.1| hypothetical protein ED21_19392 [Erythrobacter sp. SD-21]
 gi|148831361|gb|EDL49795.1| hypothetical protein ED21_19392 [Erythrobacter sp. SD-21]
          Length = 265

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 99/261 (37%), Positives = 149/261 (57%), Gaps = 1/261 (0%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + + +AT+N+N I+AR+  L  W++E  P + CLQE KT D+ FP E  + + Y     G
Sbjct: 3   ASMKIATFNINGIKARLPRLLEWLEETRPTVACLQEIKTMDEGFPAEEFEKIGYQAIWHG 62

Query: 62  QKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           QKS+NGVAILS   +P+EI   L  D                   +RI NLYLP+GNP  
Sbjct: 63  QKSFNGVAILSDGTKPVEIQRGLDIDGPKEGEGEQARYLEAEVNGIRICNLYLPNGNPHP 122

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             K+D K++W+++     +Q    E P +  GD+N+IP+  D ++P    +DA    E R
Sbjct: 123 GPKFDYKLAWMEKLRGRMAQIWAEEVPAVVLGDFNVIPEDKDVWSPKAMASDALMQPESR 182

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            ++++    G+TDAI   +    ++++WDY A +W ++ G RIDH++LSPE    + SA 
Sbjct: 183 DAYRRFLANGWTDAIDTLNPRGGVWTYWDYQAGAWQRDHGFRIDHLLLSPETADRMVSAG 242

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           +D + RG  K SDHTPV V L
Sbjct: 243 VDKEYRGREKSSDHTPVWVEL 263


>gi|300115398|ref|YP_003761973.1| exodeoxyribonuclease III [Nitrosococcus watsonii C-113]
 gi|299541335|gb|ADJ29652.1| exodeoxyribonuclease III [Nitrosococcus watsonii C-113]
          Length = 254

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 90/258 (34%), Positives = 141/258 (54%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R   +  W++ + PD + LQETK  D+NFP E  + + YH    GQK
Sbjct: 1   MKIATWNVNSLRVRFSQVVDWLEIHQPDALALQETKLVDENFPQEAFKDIGYHAVYSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL + +P +I+T LP      +         +    + + NLY+P+G+ + S K
Sbjct: 61  TYNGVAILCRQEPKDILTDLPNLVDSQRRIL-----GVTLDDIHVLNLYVPNGSEVGSEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+ R   +  + L     LI  GD+N+ P   D Y+P +W      +   R++ 
Sbjct: 116 YAYKLDWLGRIKDYLQEALVEYPKLIVLGDFNVAPADQDVYDPEVWHETILCSTPEREAL 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q++  +GF D+ R        +S+WDY   ++ +N+G+RID I++S    S      ID 
Sbjct: 176 QEILALGFQDSFRLFEQQAQSFSWWDYRGGAFHRNRGLRIDLILISKALVSKCMGCVIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PR   +PSDH PVI + 
Sbjct: 236 EPRRLPRPSDHAPVIATF 253


>gi|326316303|ref|YP_004233975.1| exodeoxyribonuclease III [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323373139|gb|ADX45408.1| exodeoxyribonuclease III [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 258

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 90/258 (34%), Positives = 139/258 (53%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  + AW+ +N  D I LQE K  D+ FP +  ++  YH  T GQK
Sbjct: 1   MKLATWNVNSLSVRLPQVLAWLADNPVDAIGLQELKLVDEKFPHDAFEAAGYHAVTFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+    ++V ++PG +            T     LR  N Y  +G    + K
Sbjct: 61  TYNGVAILSRAPVRDVVRNIPGHEDAQARVIAATLDTPQGP-LRFINCYFVNGQAPGTEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+    R+  + L     L+  GD+N+ P+  D ++P+  ++    T+E R  F
Sbjct: 120 FAYKMLWLDALHRWVREELLAHPRLVLVGDFNVAPEDRDSFDPVGLKDTIHHTVEERTHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA R        +S+WDY    + KN+G+RIDHI++S      + +  ID 
Sbjct: 180 QSLLQLGLTDAYRMFDQPEKSFSWWDYRMLGFQKNRGLRIDHILVSEALRGQVTACTIDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PR   +PSDH PV+ +L
Sbjct: 240 QPRKNPQPSDHAPVVATL 257


>gi|282901543|ref|ZP_06309465.1| Exodeoxyribonuclease III xth [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193586|gb|EFA68561.1| Exodeoxyribonuclease III xth [Cylindrospermopsis raciborskii
           CS-505]
          Length = 260

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 90/259 (34%), Positives = 138/259 (53%), Gaps = 2/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  + +W+ ENN D++CLQETK  D +FP      + YH    GQK
Sbjct: 1   MKIATWNVNSIRTRLGQVISWLGENNVDVLCLQETKVIDTDFPLTVFHDMGYHTYIYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT--QTLRIGNLYLPHGNPITS 121
           +YNGVA++S+     + T       +++  + +    I      +RI NLY+P+G+ + S
Sbjct: 61  AYNGVALISRQPMKSVSTGFCQVLENLEPEWDDQKRVITGIVDKVRIINLYVPNGSAVGS 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY  K+ W+     +    L+    +I  GD+NI  +  D Y  +  EN    +L  R+
Sbjct: 121 EKYQYKLQWLAVLKTYLEVLLKSNSDVIMCGDFNIALEDIDIYKQVDTENQIMASLLERK 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           + +++ N+GF D  R  +     YS+WDY   ++ +N G RIDH  L+        S  I
Sbjct: 181 ALREILNLGFGDGFRKFNSQGGNYSWWDYRTGAFKRNSGWRIDHHYLTDVLYKQAKSCLI 240

Query: 242 DTKPRGWTKPSDHTPVIVS 260
           D  PR   +PSDH PV+V 
Sbjct: 241 DISPRKLEQPSDHAPVVVE 259


>gi|159903026|ref|YP_001550370.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9211]
 gi|159888202|gb|ABX08416.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9211]
          Length = 277

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 95/273 (34%), Positives = 148/273 (54%), Gaps = 4/273 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR RI  + A++ E NPD++CLQETK ED +FP +  +  +YH+   GQK
Sbjct: 1   MLIATWNVNSIRTRISQVEAFLSEVNPDLLCLQETKVEDASFPTKIFEDKDYHLSFFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT----INTQTLRIGNLYLPHGNPI 119
           +YNGVA++SK    ++   + G+  +                    +RI N+Y+P+G+ +
Sbjct: 61  AYNGVALISKSPLKDVRFGMSGELSNNPEAQYLDEQKRVISTLLNGVRIINVYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           TS KY+ K+ W+     +   + E +EP+   GD+NI  +  D +NP         +   
Sbjct: 121 TSDKYEYKLQWLNCLKNYLDCQSERDEPICLLGDFNIALEDKDIHNPNRLSGGIMASEPE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++ +KL      D  R      + +S+WDY + +W +++G RIDHI LS E  +   S 
Sbjct: 181 RKALRKLLGERLEDIFRIFEQGTNHWSWWDYRSGAWDRDRGWRIDHIYLSKELINHSKSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQD 272
            I  K RG  KPSDH PV+V +D P     ++ 
Sbjct: 241 VIHKKSRGNIKPSDHAPVLVEIDWPSQESNEEP 273


>gi|320007613|gb|ADW02463.1| exodeoxyribonuclease III Xth [Streptomyces flavogriseus ATCC 33331]
          Length = 260

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 129/260 (49%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++C+QETK   + FP + L+   Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCIQETKCTLEQFPTDALREAGYESAVNATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++VT LPG       +   A         R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVLSRVGLTDVVTGLPGGPEYDGVQEPRAVSATCGGA-RVWSVYVPNGREVAHEH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++      +       P    GDYNI P   D ++P ++E     T   R++ 
Sbjct: 120 YAYKLRWLEALREAVAADAAGTLPFAVLGDYNIAPTDEDVWDPAVFEGATHVTPAEREAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +         YS+WDY   ++ KN+G+RID +  +    + +  + +D 
Sbjct: 180 AALRGTGLSDVVPRPLKYDRPYSYWDYRQLAFPKNRGMRIDLVYGNAPFAAAVKDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDV 259


>gi|163851383|ref|YP_001639426.1| exodeoxyribonuclease III Xth [Methylobacterium extorquens PA1]
 gi|163662988|gb|ABY30355.1| exodeoxyribonuclease III Xth [Methylobacterium extorquens PA1]
          Length = 264

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 115/261 (44%), Positives = 162/261 (62%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNSI+ R+ +L  ++ E  PD++CLQE K +D +FP E +++  Y +ET GQK
Sbjct: 1   MRITTWNVNSIKQRVGHLLGFLDEAKPDVVCLQELKCQDASFPREEIEAAGYAVETLGQK 60

Query: 64  SYNGVAILSKYQPIEIV--THLPGDDLDVQARFIEATFTINTQ-TLRIGNLYLPHGNPIT 120
           +YNGVA+L +           LPGD  D QAR+IEA         +R+ ++YLP+GNP  
Sbjct: 61  AYNGVALLVRAPLQYTQLLRGLPGDAEDEQARYIEALVHGEGVAPVRVASIYLPNGNPAP 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             KY  K++++ R    A   +  EE L+ AGD+N+IP+P D  +P +W  DA F  E R
Sbjct: 121 GPKYSYKLAFMARLRSHARALMTTEEALVLAGDFNVIPEPEDAADPTVWTQDALFLPETR 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           ++F+ L   GFTD +RA   +  LY+FWDY A  W +N+GIRIDH++LSP+A   L SA 
Sbjct: 181 RAFRALLAEGFTDGLRACEPSAGLYTFWDYQAGCWPRNQGIRIDHLLLSPQAADRLVSAS 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           +    RG  KPSDH PV V L
Sbjct: 241 VQRHLRGLEKPSDHVPVTVEL 261


>gi|218530191|ref|YP_002421007.1| exodeoxyribonuclease III Xth [Methylobacterium chloromethanicum
           CM4]
 gi|218522494|gb|ACK83079.1| exodeoxyribonuclease III Xth [Methylobacterium chloromethanicum
           CM4]
          Length = 264

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 115/261 (44%), Positives = 162/261 (62%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNSI+ R+ +L  ++ E  PD++CLQE K +D +FP E +++  Y +ET GQK
Sbjct: 1   MRITTWNVNSIKQRVGHLLGFLDEAKPDVVCLQELKCQDASFPREEIEAAGYAVETLGQK 60

Query: 64  SYNGVAILSKYQPIEIV--THLPGDDLDVQARFIEATFTINTQ-TLRIGNLYLPHGNPIT 120
           +YNGVA+L +           LPGD  D QAR+IEA         +R+ ++YLP+GNP  
Sbjct: 61  AYNGVALLVRAPLQYTQLLRGLPGDAEDEQARYIEALVHGEGVAPVRVASIYLPNGNPAP 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             KY  K++++ R    A   +  EE L+ AGD+N+IP+P D  +P +W  DA F  E R
Sbjct: 121 GPKYSYKLAFMARLRAHARALMTTEEALVLAGDFNVIPEPEDAADPSVWTQDALFLPEPR 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           ++F+ L   GFTD +RA   +  LY+FWDY A  W +N+GIRIDH++LSP+A   L SA 
Sbjct: 181 RAFRALLAEGFTDGLRACEPSAGLYTFWDYQAGCWPRNQGIRIDHLLLSPQAADRLVSAS 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           +    RG  KPSDH PV V L
Sbjct: 241 VQRHLRGLEKPSDHVPVTVEL 261


>gi|238788459|ref|ZP_04632252.1| Exodeoxyribonuclease III [Yersinia frederiksenii ATCC 33641]
 gi|238723372|gb|EEQ15019.1| Exodeoxyribonuclease III [Yersinia frederiksenii ATCC 33641]
          Length = 271

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 86/271 (31%), Positives = 133/271 (49%), Gaps = 8/271 (2%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   
Sbjct: 1   MLTMKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSQHGYHVFYH 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQK + GVA+L+K +P+ +    P D+ D Q R I A       TL + N Y P G    
Sbjct: 61  GQKGHYGVALLTKQEPLAVRRGFPSDEEDAQRRIIMADIATPQGTLTVINGYFPQGESRD 120

Query: 121 ST-KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDA 173
              K+  K  +     ++  Q+L  +  ++  GD NI P         +     +     
Sbjct: 121 HPTKFPAKERFYADLQQYLEQQLSADAQILIMGDLNISPTDLDIGIGEESRKRWLRTGKC 180

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEA 232
            F  E R   ++LQ+ G  D  RA +   +  +S++DY +  + +N+G+RID ++ S   
Sbjct: 181 SFLPEERAWLERLQSWGLVDTFRAANPDCNDQFSWFDYRSRGFDENRGLRIDLLLASQPL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
            +   +  ID K RG  KPSDH PV     +
Sbjct: 241 AARCIATGIDYKIRGMEKPSDHAPVWSEFAL 271


>gi|260220884|emb|CBA28896.1| hypothetical protein Csp_A09430 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 257

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 83/258 (32%), Positives = 134/258 (51%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS+  R+  +  W+  N  D++ LQE K  D  FP +  +++ YH +  GQK
Sbjct: 1   MKLATWNINSLGVRLPQVLDWLAANPVDVLALQELKLTDDKFPADAFEAIGYHAQWFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LS+    +++ ++PG D D+         T     +R+   Y P+G    S K
Sbjct: 61  TYNGVALLSRTPASDVIKNIPGFDDDMSRVI-----TGTVDGVRVIGAYFPNGQEPGSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           ++ K+ W+    R+    L     L+  GDYNI     D ++P+  E     T E R   
Sbjct: 116 FEYKMEWLSALRRWVKDELATHPNLVLMGDYNITFDEDDVWDPVNLEGTIHCTEEERYHL 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L  +G  D+ R        +S+WDY    + +N+G+RIDHI++S      + +  ID 
Sbjct: 176 RALIALGLCDSYRLFPYPPKSFSWWDYRDAGFRRNRGLRIDHILVSNALKPQVTACTIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV+V +
Sbjct: 236 TPRKNERPSDHAPVVVDI 253


>gi|240138546|ref|YP_002963018.1| Exodeoxyribonuclease III (Exonuclease III) (EXO III) (AP
           endonuclease VI) [Methylobacterium extorquens AM1]
 gi|240008515|gb|ACS39741.1| Exodeoxyribonuclease III (Exonuclease III) (EXO III) (AP
           endonuclease VI) [Methylobacterium extorquens AM1]
          Length = 264

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 115/261 (44%), Positives = 162/261 (62%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNSI+ R+ +L  ++ E  PD++CLQE K +D +FP E +++  Y +ET GQK
Sbjct: 1   MRITTWNVNSIKQRVGHLLGFLDEAKPDVVCLQELKCQDASFPREEIEAAGYAVETLGQK 60

Query: 64  SYNGVAILSKYQPIEIV--THLPGDDLDVQARFIEATFTINTQ-TLRIGNLYLPHGNPIT 120
           +YNGVA+L +           LPGD  D QAR+IEA         +R+ ++YLP+GNP  
Sbjct: 61  AYNGVALLVRAPLQYTQLLRGLPGDAEDEQARYIEALVHGEGVAPVRVASIYLPNGNPAP 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             KY  K++++ R    A   +  EE L+ AGD+N+IP+P D  +P +W  DA F  E R
Sbjct: 121 GPKYSYKLAFMARLRSHARALMTTEEALVLAGDFNVIPEPEDAADPSVWTQDALFLPETR 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           ++F+ L   GFTD +RA   +  LY+FWDY A  W +N+GIRIDH++LSP+A   L SA 
Sbjct: 181 RAFRALLAEGFTDGLRACEPSAGLYTFWDYQAGCWPRNQGIRIDHLLLSPQAADRLVSAS 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           +    RG  KPSDH PV V L
Sbjct: 241 VQRHLRGLEKPSDHVPVTVEL 261


>gi|37680518|ref|NP_935127.1| exonuclease III [Vibrio vulnificus YJ016]
 gi|37199266|dbj|BAC95098.1| exodeoxyribonuclease III [Vibrio vulnificus YJ016]
          Length = 268

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 84/268 (31%), Positives = 138/268 (51%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKIVSFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPIEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PIEI    P D+ + Q R I  TF     + + + N Y P G+ I   
Sbjct: 61  AHYGVALLCKQEPIEIQKGFPTDNDEHQKRMIIGTFLDEKGEKVTVLNGYFPQGDNIAHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
           TK+  K  + +  + + +   +  E ++  GD NI P   D           +      F
Sbjct: 121 TKFPYKRQFYQDLMGYLTTHRDNGEQVVVMGDINISPIDADIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H +    +S++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLQTLLDWGLEDTFRKLHPSVDDKFSWFDYRSKGFDDNRGLRIDVILATPSLAT 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  + +
Sbjct: 241 KCRESDIDYELRGIEKPSDHAPIWATFE 268


>gi|288549534|ref|ZP_05967343.2| exodeoxyribonuclease III [Enterobacter cancerogenus ATCC 35316]
 gi|288318297|gb|EFC57235.1| exodeoxyribonuclease III [Enterobacter cancerogenus ATCC 35316]
          Length = 354

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 81/270 (30%), Positives = 126/270 (46%), Gaps = 8/270 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 85  ATMKFVSFNINGLRARPHQLEAIVEQHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 144

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  P+ +    PGDD + Q R I A        + + N Y P G     
Sbjct: 145 QKGHYGVALLTKETPVSVRRGFPGDDGEAQRRIIMAEIPSPLGNITVINGYFPQGESRDH 204

Query: 122 T-KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
             K+  K  + +    + +  L  E P++  GD NI P         +     +      
Sbjct: 205 PTKFPAKAKFYQDLQDYLTAELNKENPVLIMGDVNISPTDLDIGIGEESRKRWLRTGKCS 264

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L   G  D  RA +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 265 FLPEEREWMERLIGWGLVDTFRAANPDTQDRFSWFDYRSKGFDDNRGLRIDLLLASAPLA 324

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                  ID   RG  KPSDH PV     +
Sbjct: 325 ERCIETGIDYDIRGMEKPSDHAPVWAKFKL 354


>gi|53719925|ref|YP_108911.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia
           pseudomallei K96243]
 gi|167824992|ref|ZP_02456463.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia
           pseudomallei 9]
 gi|226195468|ref|ZP_03791056.1| exodeoxyribonuclease III [Burkholderia pseudomallei Pakistan 9]
 gi|52210339|emb|CAH36318.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia
           pseudomallei K96243]
 gi|225932428|gb|EEH28427.1| exodeoxyribonuclease III [Burkholderia pseudomallei Pakistan 9]
          Length = 258

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 134/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ +++ D++CLQE K  D+ FP E L++  Y     GQK
Sbjct: 1   MRIATWNVNSLNVRKQHVLDWLAQSDVDVLCLQELKIPDEKFPREALEAAGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       T +  +    +              +RI + Y P+G  + S K
Sbjct: 61  TYNGVAILARASLPFDETDIVRNIPGFEDAQQRLIAATIDG-VRIVSAYFPNGQALDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALRAWLKDELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 180 AQLVALGFVDAFRRFEQPEKTFTWWDYRMLAFRRNAGLRIDHILLSPALAETCTSCTVDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDHTPV+  L
Sbjct: 240 VPRTWEQPSDHTPVVAQL 257


>gi|254389480|ref|ZP_05004707.1| exonuclease [Streptomyces clavuligerus ATCC 27064]
 gi|326444199|ref|ZP_08218933.1| exodeoxyribonuclease III [Streptomyces clavuligerus ATCC 27064]
 gi|197703194|gb|EDY49006.1| exonuclease [Streptomyces clavuligerus ATCC 27064]
          Length = 259

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 77/260 (29%), Positives = 128/260 (49%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+ AR+  L AW++ +  D++C+QETK  ++ FP E L+ + Y        
Sbjct: 1   MRIATWNVNSVTARLPRLLAWLESSGTDVLCIQETKCAEEQFPAEELREIGYESAIHADG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA++S+    E+V  LPG      A+   A        +R+ ++Y+P+G  +T   
Sbjct: 61  RWNGVALVSRVGLDEVVKGLPGGPAYDGAQEPRAISATCGP-VRLWSVYVPNGREVTHDH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+       +       P    GDYNI P   D ++   +E     T   R + 
Sbjct: 120 YAYKLEWLAALKEAVAADAAGPRPFAVLGDYNIAPADEDVWDRAAFEGSTHVTEPERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +       H +++WDY    + KN+G+RID +  +      +  + +D 
Sbjct: 180 AALRETGLSDVVPRPLKYDHPFTYWDYRQLCFPKNRGMRIDLVYGNGPFAGAVKDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDV 259


>gi|256784140|ref|ZP_05522571.1| exonuclease [Streptomyces lividans TK24]
 gi|289768021|ref|ZP_06527399.1| exodeoxyribonuclease III [Streptomyces lividans TK24]
 gi|289698220|gb|EFD65649.1| exodeoxyribonuclease III [Streptomyces lividans TK24]
          Length = 259

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 77/260 (29%), Positives = 124/260 (47%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++CLQE K  +  FPF+ L+   Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCLQEAKVAEAQFPFDALREAGYEAAVHATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++V  LPGD      +   A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVLSRVGLEDVVKGLPGDPGYEGVQEPRAISATCGP-VRVWSVYVPNGREVDHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +              P    GDYN+ P   D Y+   +E     T   R + 
Sbjct: 120 YAYKLQWFEVLRAAVEGDAAGGRPFAVLGDYNVAPTDDDVYDRAAFEGATHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +       H +++WDY    + KN+G+RID +  +      +  + +D 
Sbjct: 180 ASLRGAGLSDVVPRPLKYDHPFTYWDYRQLCFPKNRGMRIDLVYGNEPFAKAVTDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDL 259


>gi|27365439|ref|NP_760967.1| exonuclease III [Vibrio vulnificus CMCP6]
 gi|27361587|gb|AAO10494.1| exodeoxyribonuclease III [Vibrio vulnificus CMCP6]
          Length = 268

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 138/268 (51%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKIVSFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPVEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PIEI    P D+ + Q R I  TF     + + + N Y P G+ I   
Sbjct: 61  AHYGVALLCKQEPIEIQKGFPTDNDEHQKRMIIGTFLDEKGEKVTVLNGYFPQGDNIAHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
           TK+  K  + K  + + +   +  E ++  GD NI P   D           +      F
Sbjct: 121 TKFPYKRQFYKDLMGYLTTHRDNGEQVVVMGDINISPIDADIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H +    +S++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLQTLLDWGLEDTFRKLHPSVDDKFSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  + +
Sbjct: 241 QCRESDIDYELRGIEKPSDHAPIWATFE 268


>gi|296165787|ref|ZP_06848295.1| exodeoxyribonuclease III [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295898860|gb|EFG78358.1| exodeoxyribonuclease III [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 322

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 76/267 (28%), Positives = 124/267 (46%), Gaps = 7/267 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           S + +ATWNVNSIR+R+  +  W+   + D++ +QETK  D  FP      L Y +   G
Sbjct: 53  SPLRLATWNVNSIRSRLPRVVDWLARADVDVLAMQETKCSDGQFPTLPFFELGYEVAHVG 112

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPHG 116
              +NGVAI S+    ++     G         + AT            +RI +LY+P+G
Sbjct: 113 FNQWNGVAIASRVGLDDVRVGFDGQPSWSSKPEVAATAEARALGATCDGVRIWSLYVPNG 172

Query: 117 NPITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDAC 174
             +    Y  K+ W+      A+  L  +    +  AGD+NI P   D ++   +     
Sbjct: 173 RALGDPHYTYKLEWLAALRDTAAGWLRDDPAAQIALAGDWNIAPTDDDVWSTEFYAGATH 232

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
            +   R++F  + +  FTD +R       +Y++WDY    + K +G+RID I+ SP    
Sbjct: 233 VSEPERRAFAAIVDAQFTDVVRPFAPGPGVYTYWDYTQLRFPKRQGMRIDFILASPALAD 292

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSL 261
            +  A+I  + R     SDH PV + +
Sbjct: 293 RVTDAQIVREERKGKAASDHAPVQIDI 319


>gi|186682991|ref|YP_001866187.1| exodeoxyribonuclease III [Nostoc punctiforme PCC 73102]
 gi|186465443|gb|ACC81244.1| exodeoxyribonuclease III [Nostoc punctiforme PCC 73102]
          Length = 260

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 93/260 (35%), Positives = 137/260 (52%), Gaps = 2/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  +  W+  N  D++CLQETK  D  FP    + L Y++   GQK
Sbjct: 1   MKIATWNVNSIRTRLEQVTDWLTNNPVDVLCLQETKVADAEFPRSPFEQLGYNLYISGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT--LRIGNLYLPHGNPITS 121
           SYNGVA++S+   + + +       D+   + E    I      +RI NLY+P+G  + +
Sbjct: 61  SYNGVALISRQPLLNVSSGFRAILPDLHHEWDEQKRVITGVIDGVRIVNLYVPNGAAVGT 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY+ K+ W+     +       E  +   GD+NI  +  D +  +  EN    T   RQ
Sbjct: 121 EKYEYKLRWLTALHEYLRVLALSEPAICVCGDFNIALEDKDIHEQVSTENHIMATETERQ 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           + +++  +GF DA R        YS+WDY A ++ +N G RIDH  L+P       S  I
Sbjct: 181 ALREILQLGFADAFRKFTTEGGNYSWWDYRAAAFRRNLGWRIDHHYLTPVLYERATSCII 240

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D +PR  T+PSDHTPVIV  
Sbjct: 241 DAEPRKSTQPSDHTPVIVEF 260


>gi|257069696|ref|YP_003155951.1| Exodeoxyribonuclease III [Brachybacterium faecium DSM 4810]
 gi|256560514|gb|ACU86361.1| Exodeoxyribonuclease III [Brachybacterium faecium DSM 4810]
          Length = 266

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 75/266 (28%), Positives = 136/266 (51%), Gaps = 6/266 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS+RAR+  + A+++ ++ D++ LQETK + +      LQ   Y +   G  
Sbjct: 1   MRIATWNINSLRARMDRVLAFLERHDVDVLALQETKAKPQQLDLTALQEAGYEVAAHGLN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT----INTQTLRIGNLYLPHGNPI 119
            +NGVA++S+    ++ T LP   L  +             +    LRI +LY+P+G  +
Sbjct: 61  QWNGVALISRVGLSDVRTELPALPLWPEDETGVVEARALGGLVGDGLRIWSLYIPNGREL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELE--EPLIFAGDYNIIPQPHDCYNPIIWENDACFTL 177
               YD K+ W++      ++ L  +    +   GD+N+ P   D ++   ++     + 
Sbjct: 121 DHPHYDYKLRWLEALRAEGARELAEDLSAKVALVGDFNVAPLDEDVWDMEFFDGKTHVSE 180

Query: 178 EVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLH 237
             R +F+ + + G+ D +R  H    +Y++WDY    + K +G+RID ++ SP   S + 
Sbjct: 181 PERAAFRAVVDAGYADVVRGDHPGPGVYTYWDYQQLRFPKRQGMRIDFVLGSPSVQSAVT 240

Query: 238 SARIDTKPRGWTKPSDHTPVIVSLDI 263
            + ID + R     SDH PV+V LD+
Sbjct: 241 GSFIDREERKGKGASDHAPVVVDLDL 266


>gi|124022407|ref|YP_001016714.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9303]
 gi|123962693|gb|ABM77449.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9303]
          Length = 279

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 90/272 (33%), Positives = 141/272 (51%), Gaps = 4/272 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  + AW+++  PD++CLQETK +D  FP E  ++  Y +   GQK
Sbjct: 1   MQIATWNVNSIRTRLDQVQAWLQDAQPDLLCLQETKVDDPLFPHEVFEAQGYQVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN----TQTLRIGNLYLPHGNPI 119
           +YNGVAI+S+    ++     G+  +                    +RI N+Y+P+G+ +
Sbjct: 61  AYNGVAIVSRQPLEDVRRGFTGELPEDAEALQLGEQKRVISALVNNIRIVNVYVPNGSAL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S KY  K+ W+    R+ S + + +EPL   GD+NI  +  D ++P         +   
Sbjct: 121 KSEKYPYKLEWLSCLNRYLSAQAKRDEPLCLVGDFNIALEARDIHHPERLTGGIMASELE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++  K+      D  R      + +S+WDY + +W +++G RIDHI L  E  S   S 
Sbjct: 181 REALLKVLGDRLHDVFRVFEPDANHWSWWDYRSGAWDRDQGWRIDHIYLCDELLSQARSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQ 271
            I    RG  KPSDH PV V L+ P     ++
Sbjct: 241 VIHKHLRGHEKPSDHAPVTVDLNWPPIDDDEE 272


>gi|30248054|ref|NP_840124.1| exodeoxyribonuclease III:exodeoxyribonuclease III xth [Nitrosomonas
           europaea ATCC 19718]
 gi|30179939|emb|CAD83934.1| Exodeoxyribonuclease III:Exodeoxyribonuclease III xth [Nitrosomonas
           europaea ATCC 19718]
          Length = 254

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 94/258 (36%), Positives = 139/258 (53%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+  N PDI+CLQETK +D+ FP + +    Y     GQK
Sbjct: 1   MKIATWNVNSLKVRLQQVIDWLNLNQPDILCLQETKLQDEFFPMDAIAQAGYRSIYIGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LSK    +I T LPG D   +              LR+   Y+P+G  + S K
Sbjct: 61  TYNGVALLSKETGEDICTALPGFDDMQKRLIAATYGD-----LRVICAYVPNGEHVDSEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+ +  RF  Q+      +   GD+NI P+  D Y+P  W      +   RQ+F
Sbjct: 116 YIYKLEWLSQLNRFLQQQRACYGKVALLGDFNIAPEDRDVYDPEAWRGQVLCSEPERQAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L + GF D+          Y++WDY   ++ +N+G+RIDHI+LS E        ++D 
Sbjct: 176 RGLLDTGFVDSFHLFEQPEKTYTWWDYRMMAFRRNRGLRIDHILLSHEMADRCTIWQVDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV+V L
Sbjct: 236 LPRKLERPSDHAPVLVEL 253


>gi|239927938|ref|ZP_04684891.1| exonuclease [Streptomyces ghanaensis ATCC 14672]
 gi|291436275|ref|ZP_06575665.1| exonuclease [Streptomyces ghanaensis ATCC 14672]
 gi|291339170|gb|EFE66126.1| exonuclease [Streptomyces ghanaensis ATCC 14672]
          Length = 259

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 80/260 (30%), Positives = 127/260 (48%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++CLQE K  +  FPFE L+ L Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCLQEAKVAEDRFPFEELRELGYESAVNATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++V  LPGD     +    A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVALLSRVGLEDVVKGLPGDPGYEGSEEPRAVSATCGP-VRVWSVYVPNGREVDHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +      +     E P    GDYN+ P   D Y+   +E     T   R + 
Sbjct: 120 YAYKLQWFEALKAAVAGDAAGERPFAVLGDYNVAPTDDDVYDRAAFEGLTHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +       H +++WDY    + KN+G+RID +  +      +  + +D 
Sbjct: 180 ASLRETGLSDIVPRPLKYEHPFTYWDYRQLCFPKNRGMRIDLVYGNAPFAKAVTDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDL 259


>gi|238797343|ref|ZP_04640843.1| Exodeoxyribonuclease III [Yersinia mollaretii ATCC 43969]
 gi|238718774|gb|EEQ10590.1| Exodeoxyribonuclease III [Yersinia mollaretii ATCC 43969]
          Length = 271

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 83/271 (30%), Positives = 131/271 (48%), Gaps = 8/271 (2%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   
Sbjct: 1   MLTMKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSQHGYHVFYH 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQK + GVA+L+K +P+ +    P D+ D Q R I A        L + N Y P G    
Sbjct: 61  GQKGHYGVALLTKEKPLAVRRGFPTDEEDAQRRIIMADIATPQGPLTVINGYFPQGESRD 120

Query: 121 STK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDA 173
               +  K  +     ++  Q+L  +  ++  GD NI P         +     +     
Sbjct: 121 HPIKFPAKERFYADLQQYLEQQLSADSQVLIMGDINISPTDLDIGIGEENRKRWLRTGKC 180

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEA 232
            F  E R   ++LQ+ G  D  RA +   +  +S++DY +  + +N+G+RID ++ S   
Sbjct: 181 SFLPEERAWLERLQSWGLVDTFRAANPDCNDQFSWFDYRSRGFDENRGLRIDLLLASQPL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
            +   +  ID + RG  KPSDH PV     +
Sbjct: 241 AARCIATGIDYEIRGMEKPSDHAPVWSEFAL 271


>gi|167837200|ref|ZP_02464083.1| exodeoxyribonuclease III [Burkholderia thailandensis MSMB43]
          Length = 258

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 85/258 (32%), Positives = 135/258 (52%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ +++ D++CLQE K  D+ FP E L++  Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLAQSDVDVLCLQELKIPDEKFPREALEAAGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++ +       +  +    +              +RI + Y P+G  + S K
Sbjct: 61  TYNGVAILARARLPFDEADVVRNIPGFEDSQQRLIAATIDG-VRIVSAYFPNGQALDSEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +  + L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLKRELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 180 AQLVALGFVDAFRRFDQPEKTFTWWDYRMLAFRRNAGLRIDHILLSPALAETCTSCTVDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDHTPV+  +
Sbjct: 240 VPRTWEQPSDHTPVVAQI 257


>gi|197285354|ref|YP_002151226.1| exodeoxyribonuclease III [Proteus mirabilis HI4320]
 gi|194682841|emb|CAR43141.1| exodeoxyribonuclease III [Proteus mirabilis HI4320]
          Length = 268

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 126/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP ET+ +L YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLETVSALGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P+ +    PGD  + Q R I A        L + N Y P G      T
Sbjct: 61  GHYGVALLTKAKPVAVRKGFPGDGEEAQRRMIMADIETPAGLLTVMNGYFPQGESRDHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACFT 176
           K+  K  +     ++ +  L    P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAKFYADLQQYLTTSLTPSSPVLIMGDLNISPTDKDIGIGENNMKRWLKMGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+    L   G TD  RA H      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWLATLMGWGLTDTYRAQHPEVEDQFSWFDYRSKGFDDNRGLRIDLLLASRCLADN 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             S  ID   R   KPSDH PV     +
Sbjct: 241 CISTGIDYDIRAMEKPSDHAPVWAEFKL 268


>gi|323135771|ref|ZP_08070854.1| exodeoxyribonuclease III [Methylocystis sp. ATCC 49242]
 gi|322398862|gb|EFY01381.1| exodeoxyribonuclease III [Methylocystis sp. ATCC 49242]
          Length = 269

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 114/259 (44%), Positives = 159/259 (61%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + VATWNVNS+R R+  L A++KE  PDI+CLQE K ED  FP   ++   Y++   GQK
Sbjct: 9   LRVATWNVNSVRQRLSPLLAFLKETAPDILCLQELKCEDHAFPRSEIEDAGYNVVVHGQK 68

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
           ++NGVAILS     E    LPG D + Q+R++EA         LR+ ++Y P+GNP  + 
Sbjct: 69  TFNGVAILSNRPIEETTIGLPGFDGEAQSRYVEAVISDGAGGVLRVASIYAPNGNPPDTP 128

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K+++++   R A+  L LEE  I AGDYN+IP+  D ++P  W  DA F  + R +
Sbjct: 129 KYTYKLAFMEALTRHAADLLRLEEVTILAGDYNVIPEARDVHDPAAWIGDALFMPQSRAA 188

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
            Q++ N+G+TDA+RA  D   LY+FWDY A +W KN+G+RIDH++LSP A   L    I 
Sbjct: 189 LQRVINLGYTDALRAVTDEPGLYTFWDYQAGAWQKNRGLRIDHLLLSPRAADRLAGVEIH 248

Query: 243 TKPRGWTKPSDHTPVIVSL 261
              R   KPSDH  +   L
Sbjct: 249 KSMRAGEKPSDHVAISAEL 267


>gi|320155825|ref|YP_004188204.1| exodeoxyribonuclease III [Vibrio vulnificus MO6-24/O]
 gi|319931137|gb|ADV86001.1| exodeoxyribonuclease III [Vibrio vulnificus MO6-24/O]
          Length = 268

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 138/268 (51%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKIVSFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPVEDVEAMGYKVYLHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PIEI    P D+ + Q R I  TF     + + + N Y P G+ I   
Sbjct: 61  AHYGVALLCKQEPIEIQKGFPTDNDEHQKRMIIGTFLDEKGEKVTVLNGYFPQGDNIAHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
           TK+  K  + K  + + +   +  E ++  GD NI P   D           +      F
Sbjct: 121 TKFPYKRQFYKDLMGYLTTHRDNGEQVVVMGDINISPIDADIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H +    +S++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLQTLLDWGLEDTFRKLHPSVDDKFSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  + +
Sbjct: 241 KCRESDIDYELRGIEKPSDHAPIWATFE 268


>gi|326317822|ref|YP_004235494.1| exodeoxyribonuclease III Xth [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323374658|gb|ADX46927.1| exodeoxyribonuclease III Xth [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 302

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 116/269 (43%), Positives = 163/269 (60%), Gaps = 6/269 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVNSIRAR+  L  W++E  P + CLQE K  D  FP E +++  Y     GQK
Sbjct: 1   MKIATFNVNSIRARLPALLQWLQETRPGVACLQELKCTDDAFPAEEIRAAGYGALWHGQK 60

Query: 64  SYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           ++NGVAIL++  +PIE+   LPGD  D Q+R++EA        + +  LYLP+GNP    
Sbjct: 61  AWNGVAILARGAEPIEVQRGLPGDAADTQSRYLEAAVDG----VLVACLYLPNGNPAPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K++W+ R  R A       EP++ AGD+NIIP   D Y P  W  DA F  EVR +
Sbjct: 117 KFDYKLAWLGRLARRADVLRSRPEPVVLAGDFNIIPTERDVYKPDAWVEDALFRTEVRDA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F+ L + G+TDA+RA H    +Y+FWDY    + +N G+RIDH++L+P A   L  A +D
Sbjct: 177 FRALVDSGWTDALRAVHPGETVYTFWDYLRQRFQRNAGLRIDHLLLNPAAARRLQDAGVD 236

Query: 243 TKPRGWTKPSDHTPVIVSLDIPEPRKKQQ 271
              RG  +PSDH P    L  PEP+K++ 
Sbjct: 237 RDVRGRARPSDHAPAWAVLA-PEPQKRRP 264


>gi|160900429|ref|YP_001566011.1| exodeoxyribonuclease III [Delftia acidovorans SPH-1]
 gi|160366013|gb|ABX37626.1| exodeoxyribonuclease III [Delftia acidovorans SPH-1]
          Length = 258

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 95/258 (36%), Positives = 144/258 (55%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  + AW++ N  D + LQE K  D  FP + LQ   YH  + GQK
Sbjct: 1   MQIATWNVNSLSVRLPQVLAWLQANPVDALALQELKLTDDKFPLQALQEAGYHAVSHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA L++    ++V ++PG D D QAR I AT       +R+ N Y  +G    + K
Sbjct: 61  TYNGVAWLTRTPVRDVVRNIPGLD-DEQARIIAATLDAEGGPVRLINGYFVNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++    +    + +   L+  GD+N+ P+  D Y+PI  ++    T+E R  F
Sbjct: 120 FAYKMRWLQALQDWVKSEMAIHPRLVLVGDFNVAPEDRDSYDPIGLKDTIHHTVEERTHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA R        YS+WDY    + KN+G+RIDHI++S      + +  +D 
Sbjct: 180 QALLQLGLTDAFRMFDQPEKSYSWWDYRMLGFQKNRGLRIDHILVSEALRPSVSACSVDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV+V+L
Sbjct: 240 APRKNPQPSDHAPVVVTL 257


>gi|120610134|ref|YP_969812.1| exodeoxyribonuclease III [Acidovorax citrulli AAC00-1]
 gi|120588598|gb|ABM32038.1| exodeoxyribonuclease III [Acidovorax citrulli AAC00-1]
          Length = 258

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 90/258 (34%), Positives = 139/258 (53%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  + AW+ +N  D I LQE K  D+ FP +  +S  YH  + GQK
Sbjct: 1   MKLATWNVNSLSIRLPQVLAWLADNPVDAIGLQELKLVDEKFPHDAFESAGYHAVSFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+    ++V ++PG +            T     LR  N Y  +G    + K
Sbjct: 61  TYNGVAILSRTPVRDVVRNIPGHEDTQARVIAATLDTPQGP-LRFINCYFVNGQAPGTEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+    R+  + L     L+  GD+N+ P+  D ++P+  ++    T+E R  F
Sbjct: 120 FAYKMLWLAALHRWVREELLAHPRLVLVGDFNVAPEDRDSFDPVGLKDTIHHTVEERTHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA R        +S+WDY    + KN+G+RIDHI++S      + +  ID 
Sbjct: 180 QSLLQLGLTDAYRMFEQPEKSFSWWDYRMLGFQKNRGLRIDHILVSEALRGQVTACTIDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PR   +PSDH PV+ +L
Sbjct: 240 QPRKNPQPSDHAPVVATL 257


>gi|253989463|ref|YP_003040819.1| exonuclease III [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253780913|emb|CAQ84075.1| exodeoxyribonuclease iii (exonuclease iii) (exo iii) (ap
           endonucleas vi) [Photorhabdus asymbiotica]
          Length = 268

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 127/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA ++ + PD+I LQETK  D+ FP E +  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLAAIVELHQPDVIGLQETKVHDELFPLEEVNKLGYHVFYYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           ++ GVA+L++  PI +    PGDD D Q R I A        L + N Y P G       
Sbjct: 61  AHYGVALLTRQAPIAVHRGFPGDDEDSQRRIIMADLETPHGLLTVINGYFPQGESRDHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWE------NDACFT 176
           K+  K  + +    +  Q L  +  ++  GD NI P   D       +          F 
Sbjct: 121 KFPAKEKFYQDLQSYLEQNLSPQSQVLIMGDMNISPTDLDIGIGDNNQKRWLKTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R    +L++ G  D  R  +   +  +S++DY +  +  N+G+RID +  S      
Sbjct: 181 PEERDWMDRLKDWGLVDTFRHLNPECNDQFSWFDYRSKGFDDNRGLRIDLLFASKPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID K R   KPSDH PV    +I
Sbjct: 241 CIATGIDYKIREMEKPSDHAPVWAEFEI 268


>gi|291615383|ref|YP_003525540.1| exodeoxyribonuclease III Xth [Sideroxydans lithotrophicus ES-1]
 gi|291585495|gb|ADE13153.1| exodeoxyribonuclease III Xth [Sideroxydans lithotrophicus ES-1]
          Length = 252

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 92/257 (35%), Positives = 141/257 (54%), Gaps = 7/257 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+ +L  W+  N  D++CLQETK+EDKNFP   LQ   Y +   GQK
Sbjct: 1   MKLATWNVNSLKVRLPHLLEWLAANPVDVVCLQETKSEDKNFPLAELQQAGYQVAFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+    ++   +PG + + +              +R+  +Y+P+G  + S K
Sbjct: 61  TYNGVAILSRQPIGDVQCGIPGFEDEQKRVIAATIDG-----VRVVCVYVPNGQEVGSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+     +  + L     L   GDYNI P+  D ++P+ W+ +   +   R +F
Sbjct: 116 YQYKLKWLAAITAWLKEELAKHPRLALLGDYNIAPEDRDVHDPVAWQGNVLVSAPERDAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L  +G  DA R        YS+WDY   ++ +N G+RIDHI++SP       +  ID 
Sbjct: 176 KALLQLGLRDAFRLFEQAEKSYSWWDYRMMAFRRNMGLRIDHILISPAL--QCSACHIDK 233

Query: 244 KPRGWTKPSDHTPVIVS 260
            PR   +PSDHTPV+  
Sbjct: 234 APRKLERPSDHTPVVAE 250


>gi|110638457|ref|YP_678666.1| exodeoxyribonuclease III (exonuclease III) [Cytophaga hutchinsonii
           ATCC 33406]
 gi|110281138|gb|ABG59324.1| exodeoxyribonuclease III (exonuclease III) [Cytophaga hutchinsonii
           ATCC 33406]
          Length = 255

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 102/258 (39%), Positives = 144/258 (55%), Gaps = 3/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN +  R+  L  W++E  PD++CLQE K   + FP E      YH    GQK
Sbjct: 1   MKIATYNVNGVNGRLPVLLRWLQEARPDVVCLQELKAPQEKFPEEAFLQAGYHAIWHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILS+   I  +  +   D +                + IG LYLP+GNP    K
Sbjct: 61  SWNGVAILSRSSDIRELRRVLPGDPEDNHS---RYIEAFVNGIVIGCLYLPNGNPAPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K+ W KR    A+  +E + P+   GD+N++P   D Y P  W +DA F  EVR +F
Sbjct: 118 FDYKLKWFKRLTAHAADLIEADMPIALIGDFNVMPTDLDVYKPESWIDDALFRPEVRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +KL   G+TDAIR  H    +Y+FWDY+ +++ +N G+RIDH +LSP   + L  A +D 
Sbjct: 178 KKLMKQGWTDAIRKLHPDEKIYTFWDYFRNAYGRNAGLRIDHFLLSPPLAAKLKKAGVDK 237

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RGW K SDH P  + L
Sbjct: 238 HVRGWEKSSDHAPTWIIL 255


>gi|302522772|ref|ZP_07275114.1| exodeoxyribonuclease III [Streptomyces sp. SPB78]
 gi|318058357|ref|ZP_07977080.1| exodeoxyribonuclease III [Streptomyces sp. SA3_actG]
 gi|302431667|gb|EFL03483.1| exodeoxyribonuclease III [Streptomyces sp. SPB78]
          Length = 262

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 79/263 (30%), Positives = 128/263 (48%), Gaps = 1/263 (0%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  + +ATWNVNSI AR+  L AW++ +  D++C+QETKT  + FP E L+   Y     
Sbjct: 1   MVGMRIATWNVNSITARLPRLLAWLESSGTDVLCVQETKTTAEGFPTEALREAGYESAVN 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
               +NGVA++S+    ++V+ LP            A        +R+ ++Y+P+G  + 
Sbjct: 61  ATGRWNGVAVISRAGLDDVVSGLPDQPAYDGVMEPRALGATCGP-VRVWSVYVPNGREVG 119

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
              Y  K+ W++      +       P    GDYN+ P   D Y+P ++E     T   R
Sbjct: 120 HPHYAYKLEWLEALRAAVAGDAAGTRPFAVMGDYNVAPGDEDVYDPAVFEGLTHVTPPER 179

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +  +L+  G  D +         Y++WDY   ++ KN+G+RID +  +    S    A 
Sbjct: 180 AALAELRATGLGDLVPRPLKYDRPYTYWDYRQLAFPKNRGMRIDLVYANAAFRSAAKDAY 239

Query: 241 IDTKPRGWTKPSDHTPVIVSLDI 263
           +D + R     SDH PV+V LD+
Sbjct: 240 VDREERKGKGASDHAPVVVDLDV 262


>gi|13471939|ref|NP_103506.1| exonuclease [Mesorhizobium loti MAFF303099]
 gi|14022683|dbj|BAB49292.1| probable exonuclease [Mesorhizobium loti MAFF303099]
          Length = 256

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 133/259 (51%), Gaps = 3/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N+I +R+ NL AW+    PD++CLQE K  D  FP   L    Y     G+ 
Sbjct: 1   MKLATFNINNINSRLENLLAWLAAAKPDVVCLQELKARDMQFPRTALADAGYGAVWKGEP 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVAIL++     +            A             + I  LY P+GNP    K
Sbjct: 61  TWNGVAILARGAEPVLTRDAL---PGDDADRQSRYIEAAVDGIVIACLYAPNGNPQPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W  R    A+Q L+   P++ AGDYNI+P+P D Y    ++++A    E R +F
Sbjct: 118 FQYKLAWHARLEAHAAQLLDTGLPVVLAGDYNIVPEPRDIYATRSYDDNALVQPESRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L   G+ DA+R  +    LY+FWDY  + W ++ G+R+DHI+LS      L  A ID 
Sbjct: 178 AALIEQGWVDALRKIYPKETLYTFWDYRRNRWPRDAGLRLDHILLSKTLARRLKGAGIDR 237

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RG    SDH PV V L 
Sbjct: 238 DVRGEDGASDHAPVWVELK 256


>gi|261381264|ref|ZP_05985837.1| exodeoxyribonuclease III [Neisseria subflava NJ9703]
 gi|284795738|gb|EFC51085.1| exodeoxyribonuclease III [Neisseria subflava NJ9703]
          Length = 256

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 92/259 (35%), Positives = 137/259 (52%), Gaps = 4/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+ ++  DI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKIATWNVNSLNVRLPQVQNWLADHQADILALQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+Y+P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRYEPQDVHCGLPALPDDPQRRVIAATING----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FQYKEQWFAALTEFVRTEMAAHPKLVLLGDFNIAPADADCYDPEKWHEKIHCSSIERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDHI+ SPE  + L    +D 
Sbjct: 177 KNLLDLGLTDSLRKIHPEDAFYTWFDYRGGMFQRKLGLRIDHILTSPELAATLTDVTVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + R   +PSDH PVI   D
Sbjct: 237 ETRAQERPSDHAPVIAEFD 255


>gi|156934327|ref|YP_001438243.1| exonuclease III [Cronobacter sakazakii ATCC BAA-894]
 gi|156532581|gb|ABU77407.1| hypothetical protein ESA_02158 [Cronobacter sakazakii ATCC BAA-894]
          Length = 268

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 81/268 (30%), Positives = 127/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFISFNINGLRARPHQLAALVEQHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  P+ +    PGD  + Q R I A    +   + + N Y P G       
Sbjct: 61  GHYGVALLTKATPVSVRRGFPGDGEEAQRRIIMAEIPSSIGDITVINGYFPQGESRDHEV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +    L  ++P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAKFYQDLQDYLETALSNDKPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L N G  D  R  +      YS++DY +  +  N+G+RID ++ S    + 
Sbjct: 181 PEEREWMGRLLNWGLKDTFRHANPETSDRYSWFDYRSKGFDDNRGLRIDLLLASDPLMAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           L    ID   R   KPSDH PV  +  +
Sbjct: 241 LAETGIDYDIRAMEKPSDHAPVWATFSL 268


>gi|238020687|ref|ZP_04601113.1| hypothetical protein GCWU000324_00577 [Kingella oralis ATCC 51147]
 gi|237867667|gb|EEP68673.1| hypothetical protein GCWU000324_00577 [Kingella oralis ATCC 51147]
          Length = 255

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 92/259 (35%), Positives = 138/259 (53%), Gaps = 4/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  ++ W+  + PDI+ LQE K E   +P    + + +H    GQK
Sbjct: 1   MKIATWNVNSLNVRLPQVSDWLAAHQPDILVLQELKLEQDKYPAAAFRMMGWHTAWAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S++   ++ T LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRHPLQDVQTGLPALPDDPQQRVIAATI----NDIRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      +   +L     L+  GD+NI P   D Y+P  W      + E RQ F
Sbjct: 117 FAYKRQWFAALTEYVRDQLAQHPKLVLLGDFNIAPADDDVYDPQRWHEKILCSGEERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L N+G  DA+R  + T   Y++WDY    ++K  G+RIDH+++SP     L S  ID+
Sbjct: 177 ANLLNLGLHDALRHIYPTGAHYTWWDYRGAMFAKGLGLRIDHLLISPALRDSLRSVNIDS 236

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + R   +PSDH PV+   D
Sbjct: 237 EARAQERPSDHAPVVAEWD 255


>gi|218245849|ref|YP_002371220.1| exodeoxyribonuclease III [Cyanothece sp. PCC 8801]
 gi|257058897|ref|YP_003136785.1| exodeoxyribonuclease III [Cyanothece sp. PCC 8802]
 gi|218166327|gb|ACK65064.1| exodeoxyribonuclease III [Cyanothece sp. PCC 8801]
 gi|256589063|gb|ACU99949.1| exodeoxyribonuclease III [Cyanothece sp. PCC 8802]
          Length = 262

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 96/262 (36%), Positives = 145/262 (55%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + VATWNVNSIR R  ++  W+K NN D++C+QETK  D++FP    + L YH+   GQK
Sbjct: 1   MKVATWNVNSIRTRQPHVIDWLKTNNIDVLCVQETKVIDQDFPKTPFEELGYHLYIYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTL---RIGNLYLPHGNPIT 120
           +YNGVAI S+    ++         +  A   +    + T      RI NLY+P+G+ + 
Sbjct: 61  AYNGVAIFSRQPLEDVTMGFTPIVGESLAEDFDEQKRVITGIFQGVRIVNLYVPNGSAVG 120

Query: 121 STKYDDKISWIKRFLRFASQRLEL-EEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           + KYD K+ W+K   ++ +Q LE  ++ L   GD+NI  +  D YN    E+    +   
Sbjct: 121 TEKYDYKLRWLKVLKQYLTQFLEKSKQELCICGDFNIALEDKDIYNSKSKEDHIMSSPLE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+S + + ++G  DA R        +S+WDY +  + +N+G RIDH  L+P+      S 
Sbjct: 181 RESLKDILDLGLKDAFRKFTSEGGQFSWWDYRSGGFQRNRGWRIDHHYLTPKLYEKAISC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            ID +PR  T+PSDH PVIV  
Sbjct: 241 TIDIEPRKLTQPSDHAPVIVEF 262


>gi|74318453|ref|YP_316193.1| exodeoxyribonuclease III [Thiobacillus denitrificans ATCC 25259]
 gi|74057948|gb|AAZ98388.1| exodeoxyribonuclease III xth [Thiobacillus denitrificans ATCC
           25259]
          Length = 255

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 84/258 (32%), Positives = 128/258 (49%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A WNVNS++ R+  L  ++    PD++CLQETK  D  FP   L +  Y     GQK
Sbjct: 1   MKIAAWNVNSLKVRLPQLLDFLATRRPDVVCLQETKVPDDAFPSVELSAAGYRAVFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+ Q  ++   +PG   + +               R+  +Y P+G    S K
Sbjct: 61  TYNGVAILSRSQATDVSVGIPGFGDEQKRVIAATVEGT-----RVVCVYCPNGQSPDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W      +  + L     L   GD+NI P+  D ++P  WE     +   R+ F
Sbjct: 116 YFYKLAWFDALSLWLMEELARHPRLAVLGDFNIAPEDRDVHDPKAWEGSVHVSPRERERF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G  D+ R        +S+WDY    + +N G+RIDHI+L+    +   S+ ID 
Sbjct: 176 QALLQLGLKDSFRLFEQPEKSFSWWDYRMMGFRRNHGLRIDHILLTDALAASCTSSTIDR 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R   +PSDH PV+  +
Sbjct: 236 DMRKLERPSDHAPVLAEI 253


>gi|21958993|gb|AAM85715.1|AE013819_1 exonuclease III [Yersinia pestis KIM 10]
 gi|45436631|gb|AAS62185.1| exodeoxyribonuclease III [Yersinia pestis biovar Microtus str.
           91001]
          Length = 271

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 88/271 (32%), Positives = 132/271 (48%), Gaps = 8/271 (2%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   
Sbjct: 1   MLTMKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSQHGYHVFYH 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQK + GVA+L+K QP+ +    P D+ D Q R I A       TL + N Y P G    
Sbjct: 61  GQKGHYGVALLTKEQPLAVRRGFPSDEEDAQRRIIMADLATPQGTLTVINGYFPQGESRD 120

Query: 121 STK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDA 173
               +  K  +     R+  ++L  E  ++  GD NI P         D     +     
Sbjct: 121 HPIKFPAKARFYADLQRYLEEQLSPEAQVLIMGDLNISPTDLDIGIGEDNRKRWLRTGKC 180

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEA 232
            F  E R+  ++LQN G  D  RA +   +  +S++DY +  + +N+G+RID ++ S   
Sbjct: 181 SFLPEEREWLERLQNWGLVDTFRAANPDCNDHFSWFDYRSRGFDENRGLRIDLLLASQPL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
            +   +  ID   RG  KPSDH PV     +
Sbjct: 241 AARCIATGIDYAIRGMEKPSDHAPVWSEFSL 271


>gi|227355788|ref|ZP_03840181.1| exodeoxyribonuclease III [Proteus mirabilis ATCC 29906]
 gi|227164107|gb|EEI49004.1| exodeoxyribonuclease III [Proteus mirabilis ATCC 29906]
          Length = 268

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 127/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP ET+ +L YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLETVSALGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P+ +    PGD  + Q R I A        L + N Y P G      T
Sbjct: 61  GHYGVALLTKAKPVAVRKGFPGDGEEAQRRMIMADIETPAGLLTVMNGYFPQGESRDHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACFT 176
           K+  K  +     ++ +  L    P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAKFYADLQQYLTTSLTPSSPVLIMGDLNISPTDKDIGIGENNMKRWLKMGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+    L   G TD  RA H    + +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWLATLMGWGLTDTYRAQHPEVENQFSWFDYRSKGFDDNRGLRIDLLLASRCLADN 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             S  ID   R   KPSDH PV     +
Sbjct: 241 CISTGIDYDIRAMEKPSDHAPVWAEFKL 268


>gi|260597606|ref|YP_003210177.1| exonuclease III [Cronobacter turicensis z3032]
 gi|260216783|emb|CBA30234.1| Exodeoxyribonuclease III [Cronobacter turicensis z3032]
          Length = 268

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 82/268 (30%), Positives = 127/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFISFNINGLRARPHQLAALVEQHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K  P+ +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKATPVSVRRGFPGDDEEAQRRIIMAEIPSAIGDITVINGYFPQGESRDHAV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +    L  ++P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAKFYQDLQDYLETALSNDKPVLIMGDMNISPGDLDIGIGEESRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L N G  D  R  +      YS++DY +  +  N+G+RID ++ S    + 
Sbjct: 181 PEEREWMGRLLNWGLKDTFRHANPDITDRYSWFDYRSKGFDDNRGLRIDLLLASDPLMAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           L    ID   R   KPSDH PV  +  +
Sbjct: 241 LVETGIDYDIRAMEKPSDHAPVWATFSL 268


>gi|221066056|ref|ZP_03542161.1| exodeoxyribonuclease III Xth [Comamonas testosteroni KF-1]
 gi|220711079|gb|EED66447.1| exodeoxyribonuclease III Xth [Comamonas testosteroni KF-1]
          Length = 258

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 92/259 (35%), Positives = 143/259 (55%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+  N  D + LQE K  D  FP    Q   Y   + GQK
Sbjct: 1   MKIATWNVNSLSVRLPQVLEWLAANPVDALGLQELKLTDDKFPHMAFQEAGYTAVSHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA +++    ++V ++PG D D QAR I  T       +R+ N Y  +G    S K
Sbjct: 61  TYNGVAWITRETGRDVVRNIPGLD-DEQARIIATTIDSPAGEVRLINGYFVNGQEPGSEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++    +  +++ L   L+  GD+N+ P+  D Y+P+  ++    T++ R  F
Sbjct: 120 FAYKMRWLQALQDWVKEQMALHPRLVLVGDFNVAPEDRDSYDPVGLKDTIHHTVQERDHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q+L  +G +DA R        YS+WDY    + KN+G+RIDHI++S    S + +  +D 
Sbjct: 180 QRLLQLGLSDAFRMFEQPEKSYSWWDYRMLGFQKNRGLRIDHILVSEALRSKVSACSVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR   +PSDH PVIV+LD
Sbjct: 240 APRKNKQPSDHAPVIVTLD 258


>gi|26989426|ref|NP_744851.1| exodeoxyribonuclease III, putative [Pseudomonas putida KT2440]
 gi|24984291|gb|AAN68315.1|AE016465_8 exodeoxyribonuclease III, putative [Pseudomonas putida KT2440]
          Length = 265

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 103/262 (39%), Positives = 152/262 (58%), Gaps = 5/262 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  + +AT+N+N IR+R+  L AW++   PDI CLQE K  D+ FP   L++  Y     
Sbjct: 1   MKALKIATFNINGIRSRLPALLAWLEREQPDIACLQELKAADQQFPRAELEAAGYGSLHH 60

Query: 61  GQKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ S+NGVAIL +   P+E+   LPG + D Q+R++EA        + +  LYLP+GNP+
Sbjct: 61  GQPSWNGVAILVRGSDPLEVRRGLPGLEEDSQSRYLEAA----AHGVLVACLYLPNGNPL 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K+D K+ W +  ++ A    E   P + AGD+N++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFDYKLHWFECLIQHARSLQESGHPTLLAGDFNVVPTDMDIYNPRSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R  +Q+L + G+ DAIR  +    +Y+FWDY+ + W++N G+RIDH++L+ E    L  A
Sbjct: 177 RACYQRLLDQGWLDAIRHLYPDERVYTFWDYFRNHWARNAGLRIDHLLLNRELAPYLKRA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            +D   R   K SDH PV + L
Sbjct: 237 GVDAWVRNQAKASDHAPVWIEL 258


>gi|253688361|ref|YP_003017551.1| exodeoxyribonuclease III [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754939|gb|ACT13015.1| exodeoxyribonuclease III [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 272

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 90/268 (33%), Positives = 127/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 5   MKVVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSQYGYHVYYHGQK 64

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L K QPI +    P D+ D Q R I A F     T  I N Y P G       
Sbjct: 65  GHYGVALLCKAQPIAVRRGFPTDEDDAQRRIIMADFATEHGTFTIVNGYFPQGESRDHPV 124

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q     +PLI  GD NI P         +     +      F 
Sbjct: 125 KFPAKTRFYQDLQTYLEQHHSATQPLIVMGDVNISPTDLDIGIGEENRKRWLRTGKCSFL 184

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +LQ  G  D  RA +   +  +S++DY +  +  N+G+RID I+ S      
Sbjct: 185 PEEREWMARLQGWGLIDTFRAANPESNDRFSWFDYRSAGFDDNRGLRIDLILASNFLADR 244

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   RG  KPSDH P+     +
Sbjct: 245 CVATGIDYDIRGMEKPSDHAPIWAQFAL 272


>gi|298493134|ref|YP_003723311.1| exodeoxyribonuclease III ['Nostoc azollae' 0708]
 gi|298235052|gb|ADI66188.1| exodeoxyribonuclease III ['Nostoc azollae' 0708]
          Length = 260

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 86/260 (33%), Positives = 144/260 (55%), Gaps = 2/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  +  W+ E+  D++CLQETK  DK+FP  + +++ YH    GQK
Sbjct: 1   MKIATWNVNSIRTRLEQVINWLSESPVDVLCLQETKVVDKDFPLISFENVGYHPYIYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT--LRIGNLYLPHGNPITS 121
           +YNGVA++S+     +         +++ ++ E    I      +RI N Y+P+G+ + S
Sbjct: 61  AYNGVALISRQPLENVSMGFCAILPELEPQWDEQKRVITGVIDGVRIVNTYVPNGSAVGS 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY+ K+ W+    ++    L  +  +   GD+NI  +  D ++ +  E+    +   RQ
Sbjct: 121 EKYEYKLGWLTVLRKYLQVLLLSDPAISMCGDFNIALEDIDIHDKVKIEDHIMASERERQ 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           + + + ++GF DA R  ++    YS+WDY   ++ +N G RIDH  ++P   +   S  I
Sbjct: 181 ALRDILSLGFADAFRKFNNEGGNYSWWDYRTAAFRRNLGWRIDHHYVTPVLCARAQSCII 240

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D  PR   +PSDHTPV+V  
Sbjct: 241 DVAPRKLEQPSDHTPVVVEF 260


>gi|318081282|ref|ZP_07988614.1| exodeoxyribonuclease III [Streptomyces sp. SA3_actF]
          Length = 259

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 127/260 (48%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++C+QETKT  + FP E L+   Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCVQETKTTAEGFPTEALREAGYESAVNATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA++S+    ++V+ LP            A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVISRAGLDDVVSGLPDQPAYDGVMEPRALGATCGP-VRVWSVYVPNGREVGHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++      +       P    GDYN+ P   D Y+P ++E     T   R + 
Sbjct: 120 YAYKLEWLEALRAAVAGDAAGTRPFAVMGDYNVAPGDEDVYDPAVFEGLTHVTPPERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L+  G  D +         Y++WDY   ++ KN+G+RID +  +    S    A +D 
Sbjct: 180 AELRATGLGDLVPRPLKYDRPYTYWDYRQLAFPKNRGMRIDLVYANAAFRSAAKDAYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDV 259


>gi|312141216|ref|YP_004008552.1| exodeoxyribonuclease iii [Rhodococcus equi 103S]
 gi|311890555|emb|CBH49873.1| exodeoxyribonuclease III [Rhodococcus equi 103S]
          Length = 266

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 77/265 (29%), Positives = 126/265 (47%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   +  W+   + D++ +QETK +D+ FP+E      Y +   G  
Sbjct: 1   MRIATWNVNSVRARTDRIVDWLARTDTDVLAMQETKCKDEQFPYERFTEAGYEVAHVGLS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQ-----TLRIGNLYLPHGNP 118
            +NGVAI S+    ++           +    EAT            +R+ +LY+P+G  
Sbjct: 61  QWNGVAIASRIGLEDVQVGFADQPGFNKDPEAEATREARAIGATVGGVRVWSLYVPNGRE 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRL--ELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           +T   Y  K+ W+ +    A   L    +  +   GD+N+ P   D ++P  +E     +
Sbjct: 121 LTDPHYVYKLEWLAKLRADAEGWLAGNPDAQIALVGDWNVAPTDEDVWDPAFFEGKTHTS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R +F      GF D +R       +Y++WDY    + K +G+RID+++ SP   + +
Sbjct: 181 QPERDAFDAFAEAGFADVVRPHTPGPGVYTYWDYTQLRFPKRQGMRIDYVLGSPAFAARV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
             A ID   R     SDH PV+V L
Sbjct: 241 TGAHIDRDERKGKGASDHAPVVVDL 265


>gi|193222381|emb|CAL62516.2| Putative exodeoxyribonuclease III [Herminiimonas arsenicoxydans]
          Length = 254

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 99/259 (38%), Positives = 146/259 (56%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+ +N  D++CLQETKT D+ FP   +++  Y +   GQK
Sbjct: 1   MKLATWNVNSLKVRLPQVQQWLVDNPVDVLCLQETKTVDEKFPVAEIEAAGYQVAFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS++   ++  + P  D + Q            Q +RI   Y+P+G    S K
Sbjct: 61  TYNGVAILSRHPITDVTKNNPLLDDEQQRII-----AGTIQGIRIVCAYVPNGQSPDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+K    + +Q  +    L   GDYNI P+  D ++P  W      +   R +F
Sbjct: 116 YIYKLNWLKALHEWLAQEQQQHPELALLGDYNIAPEDRDVHDPAAWAGQVLVSEPERAAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +LQ MGFTDA R       LYS+WDY    +  N+G+RIDHI+LS    +   +  ID 
Sbjct: 176 VRLQEMGFTDAFRMFEQPEKLYSWWDYRQMGFRLNRGLRIDHILLSAPLAARCSACVIDK 235

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR W +PSDHTPVI ++D
Sbjct: 236 VPRKWEQPSDHTPVIATID 254


>gi|261343612|ref|ZP_05971257.1| exodeoxyribonuclease III [Providencia rustigianii DSM 4541]
 gi|282567993|gb|EFB73528.1| exodeoxyribonuclease III [Providencia rustigianii DSM 4541]
          Length = 271

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 88/268 (32%), Positives = 130/268 (48%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ P++I LQETK  D  FP++ +  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLAAIIEKHQPEVIGLQETKVHDDMFPYDEVSKLGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           ++ GVA+L K +PI +    P DD D Q R I A    N   L + N Y P G       
Sbjct: 61  AHYGVALLLKNEPIAVRKGFPNDDEDAQRRIIMADIQTNQGLLTVVNGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACFT 176
           K+  K  + +    + +     E  L+  GD NI P   D           +      F 
Sbjct: 121 KFPAKQKFYQDLQDYVTSTQTPESQLLIMGDMNISPTDLDIGIGEVNRKRWLKTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  R  H      YS++DY +  +  N+G+RID ++ S +  S 
Sbjct: 181 PEEREWLARLLDWGLVDTYREQHPDTTDSYSWFDYRSKGFDDNRGLRIDLLLASKKLASR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID + RG  KPSDH PV    D+
Sbjct: 241 CTATGIDLEIRGMEKPSDHAPVWAEFDL 268


>gi|77459871|ref|YP_349378.1| exonuclease III [Pseudomonas fluorescens Pf0-1]
 gi|77383874|gb|ABA75387.1| exodeoxyribonuclease III [Pseudomonas fluorescens Pf0-1]
          Length = 270

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 89/269 (33%), Positives = 135/269 (50%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIEKHQPDVIGLQETKVHDDQFPLEEVRALGYHVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+ +PI +      D+ D Q RFI  TF   N   + I N Y P G      
Sbjct: 61  GHYGVALLSRQEPIAVHKGFATDEEDAQRRFIWGTFADANGVPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWE------NDACF 175
            K+  K  +          +   E+PL+  GD NI P+  D                  F
Sbjct: 121 TKFPAKQRFYSDLQALLESQFHNEQPLVVMGDVNISPEDCDIGIGPDNMKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+   +L+N G TD+ R  +      +S++DY +  +     +G+RID I+ S   
Sbjct: 181 LPEEREWMARLKNWGLTDSFRHLNPDVTDTFSWFDYRSRGFEDEPKRGLRIDVILASHGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D + RG  KPSDH P+ + L
Sbjct: 241 LPRVKAAGVDYELRGMEKPSDHAPIWLEL 269


>gi|239945332|ref|ZP_04697269.1| putative exonuclease [Streptomyces roseosporus NRRL 15998]
 gi|239991789|ref|ZP_04712453.1| putative exonuclease [Streptomyces roseosporus NRRL 11379]
 gi|291448794|ref|ZP_06588184.1| exonuclease [Streptomyces roseosporus NRRL 15998]
 gi|291351741|gb|EFE78645.1| exonuclease [Streptomyces roseosporus NRRL 15998]
          Length = 259

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 128/260 (49%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVNSI AR+  L AW++ +  D++C+QETK   + FP E L+   Y        
Sbjct: 1   MRIATYNVNSITARLPRLLAWLESSGTDVLCIQETKCTAEQFPAEALREAGYESAVNATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++VT LPG       +   A        LR+ ++Y+P+G  +    
Sbjct: 61  RWNGVALLSRVGLTDVVTGLPGGPEYDGVQEPRAISATCGP-LRLWSVYVPNGREVEHEH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++   +  +       P    GD+N+ P   D ++P ++E     T   R + 
Sbjct: 120 YAYKLRWLEALRKAVAADAAGSLPFAVLGDFNVAPTDEDVWDPALFEGATHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G ++           Y+FWDY    + KNKG+RID    +   T+ +  + +D 
Sbjct: 180 AALEAEGLSEVHPRPLKYDRAYTFWDYRELRFPKNKGMRIDLTFGNAPFTAAVKDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDL 259


>gi|33861041|ref|NP_892602.1| exodeoxyribonuclease III [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|33639773|emb|CAE18943.1| exodeoxyribonuclease III [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
          Length = 281

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 94/275 (34%), Positives = 142/275 (51%), Gaps = 4/275 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+  +  WIKE NPDI+CLQETK  D  FP    + L Y +   GQK
Sbjct: 1   MLIATWNVNSVRTRLSQIINWIKEVNPDILCLQETKVIDDAFPSSHFEELGYEVIIHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT----INTQTLRIGNLYLPHGNPI 119
           SYNGVAI+SK++   +      ++                      L+I N+Y+P+G+ I
Sbjct: 61  SYNGVAIISKFKIENVKKGFTNENKTGGISIDINEQKRLISAEINGLKIINVYVPNGSSI 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S KYD KI W+     F   +++ ++ +   GD+NI P   D + P  +E     +   
Sbjct: 121 DSEKYDYKIQWLNYLSAFLDDQVKNDDLVCLVGDFNIAPSEIDIHTPQKYEGGIMASKIE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++   +    F D+ R        +S+WDY  +++  NKG RIDHI +S   +S L S 
Sbjct: 181 REALNNVLKGRFIDSFRIFEKNTGHWSWWDYRNNAYELNKGWRIDHIYISKNLSSKLKSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDST 274
            I+   R   +PSDH PV+++L+I    +   D  
Sbjct: 241 VIERNQRENLQPSDHAPVLINLEIDSHYEDYLDVD 275


>gi|146282538|ref|YP_001172691.1| exonuclease III [Pseudomonas stutzeri A1501]
 gi|145570743|gb|ABP79849.1| exodeoxyribonuclease III [Pseudomonas stutzeri A1501]
          Length = 301

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 83/271 (30%), Positives = 134/271 (49%), Gaps = 11/271 (4%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           +++ + ++N+N +RAR H L+A I+++ PD+I LQETK  D+ FP   +++L YH+   G
Sbjct: 30  TLMKIVSFNINGLRARPHQLSAIIEKHQPDVIGLQETKVADEQFPQAEIEALGYHVHYHG 89

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPIT 120
           QK + GVA+LS+  P+E+    P D  + Q RFI   F   N Q + + N Y P G    
Sbjct: 90  QKGHYGVALLSRQAPLEVHKGFPSDGEESQKRFIWGRFADANGQPVTVMNGYFPQGESRA 149

Query: 121 ST-KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDA 173
              K+  K  +         QR   +E L   GD+NI PQ  D           +     
Sbjct: 150 HPVKFPAKTKFYADLQALLEQRFSPDESLALMGDFNISPQDCDIGIGEVNAKRWLRTGKC 209

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKN--KGIRIDHIMLSP 230
            F  E R+  ++++  G  D+ R  +      +S++DY +  +     +G+RID+I+ + 
Sbjct: 210 SFLPEEREWLERIKGWGLQDSFRTLNPEVVDRFSWFDYRSRGFEDEPRRGLRIDYILTTH 269

Query: 231 EATSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                +    +D   R   KPSDH PV + L
Sbjct: 270 ALHERVTDCGVDYDIRAMEKPSDHCPVWIEL 300


>gi|310767787|gb|ADP12737.1| hypothetical protein EJP617_30560 [Erwinia sp. Ejp617]
          Length = 303

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 82/268 (30%), Positives = 123/268 (45%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
            V+   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E + SL YH+   G
Sbjct: 34  RVMKFVSFNINGLRARPHQLQAIVEQHQPDVIGLQETKVHDDMFPLEEVASLGYHVFCHG 93

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L K QP+ +     GD+ D Q R I A        L + N Y P G     
Sbjct: 94  QKGHYGVALLCKQQPVAVRRGFAGDNEDAQRRIIMADILTPAGPLTVINGYFPQGESRDH 153

Query: 122 T-KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
             K+  K  + +    +  Q+ + +  L+  GD NI           +     +      
Sbjct: 154 PTKFPAKEKFYRDLQSYLEQQQKADNQLLIMGDMNISSSDLDIGIGEESRKRWLRTGKCS 213

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATH-DTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+    L N G  D  R  +   +  +S++DY +  +  N+G+RID I+ S    
Sbjct: 214 FLPEEREWMSTLMNWGLYDTWRTQNATVNDRFSWFDYRSKGFDDNRGLRIDLILASRPLA 273

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
               +  ID   R   KPSDH P+    
Sbjct: 274 DRCVATGIDYDIRAMEKPSDHAPIWAEF 301


>gi|239916752|ref|YP_002956310.1| Exodeoxyribonuclease III [Micrococcus luteus NCTC 2665]
 gi|281414790|ref|ZP_06246532.1| Exodeoxyribonuclease III [Micrococcus luteus NCTC 2665]
 gi|239837959|gb|ACS29756.1| Exodeoxyribonuclease III [Micrococcus luteus NCTC 2665]
          Length = 275

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 76/274 (27%), Positives = 131/274 (47%), Gaps = 16/274 (5%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   + A+++ ++ D++ +QETK  D+NFP+E  +   Y +   G  
Sbjct: 1   MKIATWNVNSLRARADRVEAFLERHDIDVLAIQETKCRDENFPWELFERAGYEVVHNGTS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT------------INTQTLRIGNL 111
            +NGVAI S+    ++    PG     +        +                 +R+ +L
Sbjct: 61  QWNGVAIASRVGLSDVQRGFPGQPHFGKGGVDPQEESRAIGATVGAEAADGVAPVRLWSL 120

Query: 112 YLPHGNPITSTKYDDKISWIKRFLRFASQRLELEEPLI--FAGDYNIIPQPHDCYNPIIW 169
           Y+P+G  +       K+ W++     A+  L  +       AGD+NI PQ  D ++  ++
Sbjct: 121 YVPNGRGLEDEHMGYKLEWLRVLQEHAAAHLAEDPDTRLALAGDWNIAPQDEDVWDIELF 180

Query: 170 E--NDACFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIM 227
           +       +   R +F   ++ G  D +R  H    +Y++WDY   ++ K KG+RID  +
Sbjct: 181 QREGYTHVSPAERAAFHAFEDAGLVDVVRPRHPGPGVYTYWDYTGLAFPKKKGMRIDFQL 240

Query: 228 LSPEATSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
            SP     +  A I+ + R     SDH PV+V L
Sbjct: 241 CSPALARTVTDAWIEREERKGKGASDHAPVVVEL 274


>gi|254382239|ref|ZP_04997600.1| exonuclease [Streptomyces sp. Mg1]
 gi|194341145|gb|EDX22111.1| exonuclease [Streptomyces sp. Mg1]
          Length = 261

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 77/260 (29%), Positives = 129/260 (49%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVNSI AR+  L AW++ +  D++C+QETK   + FP E L+ L Y        
Sbjct: 1   MRIATFNVNSITARLPRLLAWLESSGTDVVCIQETKCSAEQFPHEQLRELGYEAAVNATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA++SK    ++VT LPG       +   A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVALISKVGLEDVVTGLPGGPDYEGVQEPRAISATCGG-VRLWSVYVPNGREVEHDH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +      ++      P    GDYN+ P   D ++P ++E     T   R + 
Sbjct: 120 YGYKLEWFRALTAAVAEDAAGPRPFAVLGDYNVAPTDEDVFDPAVFEGLTHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L+  G +D +         Y++WDY   ++ KN+G+RID +  +      +  A +D 
Sbjct: 180 EALRAAGLSDVVPRPLKYDRPYTYWDYRQLAFPKNRGMRIDLVYGNEAFAKAVTDAYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V L +
Sbjct: 240 EERKGKGASDHAPVVVDLSL 259


>gi|212710738|ref|ZP_03318866.1| hypothetical protein PROVALCAL_01806 [Providencia alcalifaciens DSM
           30120]
 gi|212686435|gb|EEB45963.1| hypothetical protein PROVALCAL_01806 [Providencia alcalifaciens DSM
           30120]
          Length = 270

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 86/268 (32%), Positives = 128/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I+++ P++I LQETK  D  FP+E +  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKHQPEVIGLQETKVHDDMFPYEEVSKLGYHVYYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           ++ GVA+L K +PI +    P DD + Q R I A    N   L + N Y P G       
Sbjct: 61  AHYGVALLLKNEPIAVRKGFPTDDEEAQRRIIMADIQTNEGILTVVNGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACFT 176
           K+  K  + +    + +     +  L+  GD NI P   D           +      F 
Sbjct: 121 KFPAKEKFYRDLQDYVTSTQTADSQLLIMGDMNISPTDLDIGIGDVNRKRWLKTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L   G  D  R  H      YS++DY +  +  N+G+RID ++ S +  S 
Sbjct: 181 PEEREWLERLLGWGLVDTYREQHPDTTDRYSWFDYRSKGFDDNRGLRIDLLLASKKLASR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   RG  KPSDH PV    D+
Sbjct: 241 CRATGIDYDIRGMEKPSDHAPVWAEFDL 268


>gi|239983300|ref|ZP_04705824.1| exonuclease [Streptomyces albus J1074]
 gi|291455127|ref|ZP_06594517.1| exonuclease [Streptomyces albus J1074]
 gi|291358076|gb|EFE84978.1| exonuclease [Streptomyces albus J1074]
          Length = 259

 Score =  208 bits (529), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 76/258 (29%), Positives = 124/258 (48%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++C+QETKT ++ FP + L  L Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCIQETKTTEEAFPADALAELGYESAVRATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAI+S+    ++V  LPG           A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAIVSRAGLDDVVGGLPGGPEYDGVEEPRAISATCGP-VRVWSVYVPNGREVGHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+K      +       P    GDYNI P   D ++P  +      T E R++ 
Sbjct: 120 FAYKLQWLKALRDAVADDAAGGRPFAVLGDYNIAPHDTDVWDPTAFIGATHVTPEEREAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G  D +         +++WDY    + KN+G+RID +  +    + +  A +D 
Sbjct: 180 AALRATGLDDVVPRPLKYDQPFTYWDYRQLGFPKNRGMRIDLVYGNDPFRAAVSDAYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + R     SDH PV+  L
Sbjct: 240 EERKGKGASDHAPVVTDL 257


>gi|153876175|ref|ZP_02003628.1| Endonuclease/exonuclease/phosphatase [Beggiatoa sp. PS]
 gi|152067361|gb|EDN66372.1| Endonuclease/exonuclease/phosphatase [Beggiatoa sp. PS]
          Length = 253

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 135/259 (52%), Gaps = 7/259 (2%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           ++ +ATWNVNS+R R+ +L  W+  + PDII LQE K  D+ FP   +++  YH    GQ
Sbjct: 1   MLKIATWNVNSLRVRLPHLLDWLSNHQPDIIALQEIKVMDEQFPLAEIEAAGYHALFAGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVA+LS+    +I+T  P  +   +              LRI N+Y+P+G  + S 
Sbjct: 61  KTYNGVALLSRKPGNDIITDFPDFNDPQRRFLGATYDK-----LRILNVYVPNGASVDSD 115

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K+ W+ +   +    L+    LI  GD+NI P+  D Y+PI W      +   R +
Sbjct: 116 KYQYKLEWLTQLQNYICDNLKQYPRLIVLGDFNIAPEDQDVYDPIAWAGKILVSPPERTA 175

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
            Q L ++G  D  R        +S+WDY   ++ +N GIRID I+ S           ID
Sbjct: 176 LQNLLHLGLKDTFRLFEQPVASFSWWDYRRGAFLRNHGIRIDLILASTAL--HCTGCTID 233

Query: 243 TKPRGWTKPSDHTPVIVSL 261
           T PR   +PSDH PV+ + 
Sbjct: 234 TAPRRLERPSDHAPVVATF 252


>gi|229822126|ref|YP_002883652.1| exodeoxyribonuclease III Xth [Beutenbergia cavernae DSM 12333]
 gi|229568039|gb|ACQ81890.1| exodeoxyribonuclease III Xth [Beutenbergia cavernae DSM 12333]
          Length = 263

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 77/260 (29%), Positives = 131/260 (50%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIRAR   +AAW++ ++ D++ LQETK  D+ FP  +  ++ Y +   G  
Sbjct: 1   MRIATWNVNSIRARAERVAAWLERSDVDVLALQETKVPDEQFPVMSFAAVGYDVVHHGHS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQ-TLRIGNLYLPHGNPITST 122
            +NGVAI+S+    ++    PG          EA     T   +R+ +LY+P+G  +   
Sbjct: 61  QWNGVAIVSRVGIDDVELGFPGQPTWGDPAVAEARALGATCGGVRLWSLYVPNGRTLEDP 120

Query: 123 KYDDKISWIKRFLRFASQR-LELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            Y  K+ W++     A+    E    +  AGD+NI P   D ++  +++     +   R 
Sbjct: 121 HYAYKLDWLRALRDAAATWAAEPGAQVALAGDWNIAPLDEDVWDMSLFDGATHVSPAERA 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +F  L + GF +  R        Y++WDY    + +N+G+RID ++ +      + +  I
Sbjct: 181 AFAALDDAGFAEVTRLHVP--QAYTYWDYQRLRFPRNEGMRIDFVLATRALAERVAAVGI 238

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D + R     SDH PV+V +
Sbjct: 239 DREERKGKGASDHVPVVVEI 258


>gi|325497093|gb|EGC94952.1| exonuclease III [Escherichia fergusonii ECD227]
          Length = 329

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 77/268 (28%), Positives = 124/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 60  ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 119

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGD  + Q R I A        + + N Y P G     
Sbjct: 120 QKGHYGVALLTKETPIAVRRGFPGDGEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDH 179

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ + P++  GD NI P         +     +      
Sbjct: 180 PIKFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCS 239

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 240 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 299

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 300 ECCVETGIDYEIRSMEKPSDHAPVWATF 327


>gi|70731287|ref|YP_261028.1| exonuclease III [Pseudomonas fluorescens Pf-5]
 gi|68345586|gb|AAY93192.1| exodeoxyribonuclease III [Pseudomonas fluorescens Pf-5]
          Length = 270

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 90/269 (33%), Positives = 135/269 (50%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +Q+L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVADEQFPLADIQALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD D Q RFI  TF   N   + I N Y P G      
Sbjct: 61  GHYGVALLSRQAPLALHKGFEGDDEDAQRRFIWGTFADANGTPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+  K  + +        R   ++PL+  GD NI P+  D           +      F
Sbjct: 121 TKFPAKERFYQDLQHLLESRFSNDQPLVVMGDVNISPEDCDIGIGAENAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+   +L+N G  D+ R  +   +  +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMARLKNWGLVDSFRHLNPEVNDRFSWFDYRSRGFEDEPKRGLRIDLIMASQGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +  A +D + RG  KPSDH P+ + L
Sbjct: 241 LPRVKDAGVDYELRGMEKPSDHAPIWLEL 269


>gi|238786156|ref|ZP_04630108.1| Exodeoxyribonuclease III [Yersinia bercovieri ATCC 43970]
 gi|238712925|gb|EEQ04985.1| Exodeoxyribonuclease III [Yersinia bercovieri ATCC 43970]
          Length = 271

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 84/271 (30%), Positives = 129/271 (47%), Gaps = 8/271 (2%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   
Sbjct: 1   MLTMKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSQHGYHVFYH 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQK + GVA+L+K +P+ +    P D+ D Q R I A        L + N Y P G    
Sbjct: 61  GQKGHYGVALLTKEKPLAVRRGFPTDEEDAQRRIIMADIATPQGPLTVINGYFPQGESRD 120

Query: 121 STK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDA 173
               +  K  +     ++  Q+   +  L+  GD NI P         +     +     
Sbjct: 121 HPIKFPAKERFYADLQQYLEQQHSADSQLLIMGDINISPTDLDIGIGEENRKRWLRTGKC 180

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEA 232
            F  E R    +LQN G  D  RA +   +  +S++DY +  + +N+G+RID ++ S   
Sbjct: 181 SFLPEERAWLAQLQNWGLVDTFRAANPECNDQFSWFDYRSRGFDENRGLRIDLLLASHPL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
            +   +  ID + RG  KPSDH PV     +
Sbjct: 241 AARCIATGIDYEIRGMEKPSDHAPVWSEFAL 271


>gi|162148012|ref|YP_001602473.1| putative exodeoxyribonuclease III [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786589|emb|CAP56171.1| putative exodeoxyribonuclease III [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 259

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 98/260 (37%), Positives = 140/260 (53%), Gaps = 3/260 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           ++ +A+WNVNS+R R  ++  W++   PD++ LQE K ED +FP E  ++  Y     GQ
Sbjct: 1   MMKIASWNVNSVRQRQAHVLDWLEREKPDLLGLQEIKCEDASFPAEAFRAAGYDCVVVGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           KSYNGVAILS+                           I    L  GNLYLP+GN   S 
Sbjct: 61  KSYNGVAILSRLPFSVTAR---ALPFLDGEALQARYVEIEAGGLTFGNLYLPNGNSGGSA 117

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
            Y+ K+++++     A   LE     + AGDYN+ P   DC    +   DA    E R +
Sbjct: 118 GYEAKLAFMEALALHARALLEAGRDFVLAGDYNVCPTDEDCAPGALPPTDALVRPESRAA 177

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F++L  +G TDA+RA H     Y+FWDY A +W ++ G+RIDH +LSP     L SA+ D
Sbjct: 178 FRRLIWLGLTDALRALHPHGRYYTFWDYQAGAWPRDCGLRIDHALLSPRIAERLDSAQPD 237

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              RG  +PSDH P++++LD
Sbjct: 238 RDERGRAQPSDHVPLVITLD 257


>gi|330817688|ref|YP_004361393.1| Exodeoxyribonuclease III Xth [Burkholderia gladioli BSR3]
 gi|327370081|gb|AEA61437.1| Exodeoxyribonuclease III Xth [Burkholderia gladioli BSR3]
          Length = 258

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 87/259 (33%), Positives = 129/259 (49%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+  ++ D++CLQE K  D  FP   L++  Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLATSHADVLCLQELKLTDDKFPKADLEAAGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL +       T +  +    +              +RI + Y P+G    S K
Sbjct: 61  TYNGVAILVRDTLGVDETDVVKNIPGFEDPQQRV-IAATVNGVRIVSAYFPNGQAPDSEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L     L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKLQWLDALRAWLKDELTRHPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L  MGF DA R        +++WDY    + +N G+RIDHI+LSP     L +  +D 
Sbjct: 180 AALLEMGFVDAFRRFEQPEKTFTWWDYRMMGFRRNAGLRIDHILLSPALAGTLTACEVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR W +PSDHTPVI +++
Sbjct: 240 VPRTWEQPSDHTPVIATIE 258


>gi|319763690|ref|YP_004127627.1| exodeoxyribonuclease iii xth [Alicycliphilus denitrificans BC]
 gi|317118251|gb|ADV00740.1| exodeoxyribonuclease III Xth [Alicycliphilus denitrificans BC]
          Length = 258

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 92/258 (35%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS+  R+  + AW+  N  D I LQE K  D+ FP +  ++  YH    GQK
Sbjct: 1   MHLATWNINSLSVRLPQVLAWLAANPVDAIGLQELKLVDEKFPHDAFEAAGYHAVCFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++V ++PG D +       AT  +    LR+ N Y  +G    + K
Sbjct: 61  TYNGVAIVSRTPPRDVVRNIPGHDDEQARVI-AATLDVEGGPLRLVNCYFVNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L     L+  GD+N+ P+  D Y+P+  ++    T+E RQ F
Sbjct: 120 FAYKLQWLAALHDWLRAELAAHPRLVLVGDFNVAPEDRDSYDPVGLKDTIHHTVEERQHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L  +G TDA R        YS+WDY    + KN+G+RIDHI++S    + + + RID 
Sbjct: 180 RQLLELGLTDAFRMFEQPEKSYSWWDYRQLGFQKNRGLRIDHILVSEALRAGVTACRIDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV+ +L
Sbjct: 240 APRKNPQPSDHAPVVATL 257


>gi|322832771|ref|YP_004212798.1| exodeoxyribonuclease III [Rahnella sp. Y9602]
 gi|321167972|gb|ADW73671.1| exodeoxyribonuclease III [Rahnella sp. Y9602]
          Length = 269

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 84/268 (31%), Positives = 130/268 (48%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEEVSQHGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K +P+ +    PGDD + Q R I          L + N Y P G       
Sbjct: 61  GHYGVAMLTKQEPVAVRRGFPGDDEESQRRIIMTDIETPQGILTVINGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    + +  L +  P++  GD NI P         D     +      F 
Sbjct: 121 KFPAKEKFYRDLQDYLTTSLSVNNPVVVMGDVNISPTDLDIGIGEDSRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L+  G  D  RA +      +S++DY +  + +N+G+RID IM S    + 
Sbjct: 181 PEEREWMDRLKGWGLIDTFRAANPDTADKFSWFDYRSRGFDENRGLRIDLIMASTPLAAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   RG  +PSDH P+  + D+
Sbjct: 241 CIATGIDYDIRGMERPSDHAPIWATFDL 268


>gi|295096134|emb|CBK85224.1| Exodeoxyribonuclease III [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 268

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 81/268 (30%), Positives = 127/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEQHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K  P+ +    PGDD + Q R I A        + + N Y P G      T
Sbjct: 61  GHYGVALLTKDTPVSVRRGFPGDDEEAQRRIIMAEIPSALGNVTVINGYFPQGESRDHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    + +  L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAKFYQDLQNYLTTELKKENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L   G  D  R  +  T   +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLLGWGLVDTFRTANPATQDRFSWFDYRSKGFDDNRGLRIDLLLASAPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   R   KPSDH PV  +  +
Sbjct: 241 CIETGIDYDIRSMEKPSDHAPVWATFKL 268


>gi|283478229|emb|CAY74145.1| xthA [Erwinia pyrifoliae DSM 12163]
          Length = 300

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 82/268 (30%), Positives = 123/268 (45%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
            V+   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E + SL YH+   G
Sbjct: 31  RVMKFVSFNINGLRARPHQLQAIVEQHQPDVIGLQETKVHDDMFPLEEVASLGYHVFCHG 90

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L K QP+ +     GD+ D Q R I A        L + N Y P G     
Sbjct: 91  QKGHYGVALLCKQQPVAVRRGFAGDNEDAQRRIIMADILTPAGPLTVINGYFPQGESRDH 150

Query: 122 T-KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
             K+  K  + +    +  Q+ + +  L+  GD NI           +     +      
Sbjct: 151 PTKFPAKEKFYRDLQSYLEQQQKADNQLLIMGDMNISSSDLDIGIGEESRKRWLRTGKCS 210

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATH-DTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+    L N G  D  R  +   +  +S++DY +  +  N+G+RID I+ S    
Sbjct: 211 FLPEEREWMSTLMNWGLYDTWRTQNATVNDRFSWFDYRSKGFDDNRGLRIDLILASRPLA 270

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
               +  ID   R   KPSDH P+    
Sbjct: 271 DRCVATGIDYDIRAMEKPSDHAPIWAEF 298


>gi|37519709|ref|NP_923086.1| exodeoxyribonuclease III [Gloeobacter violaceus PCC 7421]
 gi|35210700|dbj|BAC88081.1| exodeoxyribonuclease III [Gloeobacter violaceus PCC 7421]
          Length = 258

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 93/261 (35%), Positives = 143/261 (54%), Gaps = 4/261 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           MS +TVATWNVNSI  R+  + AW+  + P+++CLQETK  D+ FP    ++L Y +   
Sbjct: 1   MSNLTVATWNVNSINVRLGGVCAWLSAHRPEVLCLQETKVPDERFPVAAFEALGYEVAFA 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQK+YNGVAI+S+     +   LPGD+ D   R I AT         I N+Y+P+G+   
Sbjct: 61  GQKAYNGVAIVSRKPVTVVRRGLPGDEADAPRRLIAATVEDTQ----IINVYVPNGSEAG 116

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           S K+  K+ W++R  ++     + +  ++  GD+NI P+  D ++P        F  +  
Sbjct: 117 SEKFAYKLLWLERLRQYLLADFDPKAAVLLCGDFNIAPEERDVWDPKAVAGKVLFHPDEH 176

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            + ++++  GF DA R        +S+WDY A ++ +N G+RIDHI +S        +  
Sbjct: 177 AALERIRTWGFIDAFRLHSPAAGQFSWWDYRAAAFRRNLGMRIDHIWVSSPLAERCSACW 236

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           ID +PR    PSDH PV  S 
Sbjct: 237 IDAQPRAQPSPSDHVPVAASF 257


>gi|85709819|ref|ZP_01040884.1| Probable exodeoxyribonuclease III [Erythrobacter sp. NAP1]
 gi|85688529|gb|EAQ28533.1| Probable exodeoxyribonuclease III [Erythrobacter sp. NAP1]
          Length = 272

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 97/269 (36%), Positives = 150/269 (55%), Gaps = 8/269 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           S + +AT+N+N I+AR+  L  W++E  P + CLQE K++DK+FP    + L Y     G
Sbjct: 3   SAMKIATYNINGIKARLPRLKEWLEETRPAVACLQEVKSQDKDFPASEFEELGYQAIWHG 62

Query: 62  QKSYNGVAILSKYQPIEIVT--------HLPGDDLDVQARFIEATFTINTQTLRIGNLYL 113
           QK++NGVAIL+  +                P +    QAR++E   T  + T RI  +YL
Sbjct: 63  QKAFNGVAILADTKAGYSAKEVQRGLGIDGPKEGEGEQARYLEVDVTRESSTCRIVCIYL 122

Query: 114 PHGNPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDA 173
           P+GNP    K+D K++W+++     +Q  E E P    GD+N+IP+  D ++     +DA
Sbjct: 123 PNGNPQPGPKFDYKLAWMEKLRGRMAQIWESEVPAAVLGDFNVIPEDDDVFSVKAMASDA 182

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
               E R ++ +L   G+TDA+R  +    ++++WDY A +W ++ G RIDHI+LSPE  
Sbjct: 183 LMQPESRAAYARLLADGWTDALRTHNPRGGVWTYWDYQAGAWQRDHGFRIDHILLSPELA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSLD 262
             L S  +D + RG  K SDH P    L+
Sbjct: 243 DRLVSVGVDREHRGREKASDHAPTWAKLN 271


>gi|157370955|ref|YP_001478944.1| exonuclease III [Serratia proteamaculans 568]
 gi|157322719|gb|ABV41816.1| exodeoxyribonuclease III [Serratia proteamaculans 568]
          Length = 268

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 133/268 (49%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEEVSQHGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K +P+ +    P DD D Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVALLTKEKPLAVRRGFPTDDEDAQRRIIMADLATPQGTLTVINGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDC------YNPIIWENDACFT 176
           K+  K  + +    +  Q++ ++ P++  GD NI P  +D           +      F 
Sbjct: 121 KFPAKTRFYQDLQNYLEQQMSVDSPVLVMGDVNISPSDYDIGIGEESRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L N G  D  R  +   +  +S++DY +  + +N+G+RID ++ S    + 
Sbjct: 181 PEEREWMDRLMNWGLVDTYRHANPERNDQFSWFDYRSRGFDENRGLRIDLLLASTPLAAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID + RG  KPSDH PV     +
Sbjct: 241 CTATGIDYQIRGMEKPSDHAPVWAEFSL 268


>gi|260463071|ref|ZP_05811274.1| exodeoxyribonuclease III Xth [Mesorhizobium opportunistum WSM2075]
 gi|259031192|gb|EEW32465.1| exodeoxyribonuclease III Xth [Mesorhizobium opportunistum WSM2075]
          Length = 256

 Score =  208 bits (528), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 132/257 (51%), Gaps = 3/257 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N+I +R+ NL AW+    PD++CLQE K  D  FP   L    Y     G+ 
Sbjct: 1   MKIATFNINNINSRLENLLAWLAAARPDVVCLQELKARDMQFPRTALADAGYGAVWKGEP 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVAIL++     +                          + I  LY P+GNP    K
Sbjct: 61  TWNGVAILARGAEPILTRDAL---PGDDGDKQSRYIEAAVNGIVIACLYAPNGNPRPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W +R    A Q ++   P++ AGDYNI+P+P D Y    ++++A    E R +F
Sbjct: 118 FQYKLAWHERLNAHAEQLIDTGLPVVLAGDYNIVPEPRDIYATRSYDDNALVQPESRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L   G+TDA+R  H    LY+FWDY  + W ++ G+R+DHI+LS      L  A ID 
Sbjct: 178 AALLEQGWTDALRKKHPNETLYTFWDYRRNRWPRDAGLRLDHILLSKTLARRLKGAGIDR 237

Query: 244 KPRGWTKPSDHTPVIVS 260
             RG    SDH PV V 
Sbjct: 238 DVRGQDGASDHAPVWVE 254


>gi|261821541|ref|YP_003259647.1| exonuclease III [Pectobacterium wasabiae WPP163]
 gi|261605554|gb|ACX88040.1| exodeoxyribonuclease III [Pectobacterium wasabiae WPP163]
          Length = 272

 Score =  208 bits (528), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 90/266 (33%), Positives = 127/266 (47%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 5   MKVVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSQYGYHVYYHGQK 64

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L K QPI +    P D+ D Q R I A F     TL + N Y P G       
Sbjct: 65  GHYGVALLCKEQPIAVRRGFPTDEDDAQRRIIMADFATEHGTLTVVNGYFPQGESRDHPV 124

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q     +PLI  GD NI P         +     +      F 
Sbjct: 125 KFPAKTRFYQDLQTYLEQHHSATQPLIVMGDVNISPTDLDIGIGEENRKRWLRTGKCSFL 184

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +LQ  G  D  RA +   +  +S++DY +  +  N+G+RID I+ S      
Sbjct: 185 PEEREWMARLQGWGLIDTFRAANPESNDRFSWFDYRSAGFDDNRGLRIDLILASTFLAER 244

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
             +  ID   RG  KPSDH P+    
Sbjct: 245 CVATGIDYDIRGMEKPSDHAPIWAEF 270


>gi|293395887|ref|ZP_06640169.1| exodeoxyribonuclease III [Serratia odorifera DSM 4582]
 gi|291421824|gb|EFE95071.1| exodeoxyribonuclease III [Serratia odorifera DSM 4582]
          Length = 268

 Score =  208 bits (528), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 88/268 (32%), Positives = 130/268 (48%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEEVSKHGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    P DD D Q R I A        L + N Y P G       
Sbjct: 61  GHYGVALLTKEAPIAVRRGFPTDDDDAQRRIIMADLETPQGMLTVINGYFPQGESRDHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACFT 176
           K+  K  + +    +  Q+L +E P++  GD NI P  +D           +      F 
Sbjct: 121 KFPAKTRFYQDLQDYLEQQLSVENPVLIMGDMNISPSDYDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L N G  D  R  +   +  +S++DY +  +  N+G+RID ++ S    + 
Sbjct: 181 PEEREWMGRLLNWGLVDTYRQANPERNDQFSWFDYRSKGFDDNRGLRIDLLLASTPLAAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID + R   KPSDH PV    DI
Sbjct: 241 CVATGIDYQTRSMEKPSDHAPVWAEFDI 268


>gi|183980766|ref|YP_001849057.1| exodeoxyribonuclease III protein XthA [Mycobacterium marinum M]
 gi|183174092|gb|ACC39202.1| exodeoxyribonuclease III protein XthA [Mycobacterium marinum M]
          Length = 276

 Score =  208 bits (528), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 124/266 (46%), Gaps = 7/266 (2%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
            + +ATWNVNSIR R+  +  W++  + D++ +QETK  D  FP   L  L Y +   G 
Sbjct: 5   TLRLATWNVNSIRTRLPRVLDWLERADVDVLAIQETKCSDTQFPALPLFELGYEVAHVGF 64

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT-----LRIGNLYLPHGN 117
             +NGVAI S+    ++     G         + A             +R+ +LY+P+G 
Sbjct: 65  NQWNGVAIASRVGIDDVQIGFDGQPAWSGKPEVAAAAEARAVGATCGGVRVWSLYVPNGR 124

Query: 118 PITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACF 175
            +    Y  K+ W+      A   L+ +   P+  AGD+NI P   D ++   +      
Sbjct: 125 ALEDPHYTYKLDWLAALRDTAQCWLKNDPGAPIALAGDFNIAPTDEDVWSTEFFTGATHV 184

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
           +   R++F  + +  FTD +R       +Y++WDY    + K +G+RID I+ SP     
Sbjct: 185 SEPERKAFNAIVDAQFTDLVRPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAGR 244

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
           +  A+I    R    PSDH PV V L
Sbjct: 245 VVDAQIVRDERKGKAPSDHAPVFVDL 270


>gi|225077187|ref|ZP_03720386.1| hypothetical protein NEIFLAOT_02242 [Neisseria flavescens
           NRL30031/H210]
 gi|224951478|gb|EEG32687.1| hypothetical protein NEIFLAOT_02242 [Neisseria flavescens
           NRL30031/H210]
          Length = 256

 Score =  208 bits (528), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 138/259 (53%), Gaps = 4/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+ ++  DI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKIATWNVNSLNVRLPQVQNWLADHQADILALQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+++P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRHEPQDVHCGLPALPDDPQRRVIAATING----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    + +   L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FQYKEQWFAALTEFVRTEMAVHPKLVLLGDFNIAPADADCYDPEKWHEKIHCSSIERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDHI+ SPE  + L    +D 
Sbjct: 177 KTLLDLGLTDSLRKVHPEGAFYTWFDYRGAMFQRKLGLRIDHILTSPELAATLTDVTVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + R   +PSDH PVI   D
Sbjct: 237 ETRAQERPSDHAPVIAEFD 255


>gi|319639504|ref|ZP_07994253.1| exodeoxyribonuclease III [Neisseria mucosa C102]
 gi|317399270|gb|EFV79942.1| exodeoxyribonuclease III [Neisseria mucosa C102]
          Length = 256

 Score =  208 bits (528), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 137/259 (52%), Gaps = 4/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+ ++  DI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKIATWNVNSLNVRLPQVQNWLADHQADILALQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+++P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRHEPQDVHCGLPALPDDPQRRVIAATING----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FQYKEQWFAALTEFVRAEMAAHPKLVLLGDFNIAPADADCYDPEKWHEKIHCSSIERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDHI+ SPE  + L    +D 
Sbjct: 177 KNLLDLGLTDSLRKVHPEGAFYTWFDYRGAMFQRKLGLRIDHILTSPELAANLTDVTVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + R   +PSDH PVI   D
Sbjct: 237 ETRAQERPSDHAPVIAEFD 255


>gi|146311351|ref|YP_001176425.1| exonuclease III [Enterobacter sp. 638]
 gi|145318227|gb|ABP60374.1| Exodeoxyribonuclease III [Enterobacter sp. 638]
          Length = 268

 Score =  208 bits (528), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 127/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEQHQPDVIGLQETKVHDDMFPLEDVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKQTPISVRRGFPGDDGEAQRRIIMAEIPSPLGNITVINGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    + +  L  E P++  GD NI P         D     +      F 
Sbjct: 121 KFPAKAKFYQDLQDYLTTELNKENPVLIMGDVNISPTDLDIGIGEDSRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  Q+LQ+ G  D  RA +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMQRLQSWGLVDTFRAANPDTQDRFSWFDYRSKGFDDNRGLRIDLLLASAPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   RG  KPSDH PV     +
Sbjct: 241 CIETGIDYDIRGMEKPSDHAPVWAKFKL 268


>gi|114330240|ref|YP_746462.1| exodeoxyribonuclease III Xth [Nitrosomonas eutropha C91]
 gi|114307254|gb|ABI58497.1| Exodeoxyribonuclease III [Nitrosomonas eutropha C91]
          Length = 254

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 91/258 (35%), Positives = 138/258 (53%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+  N PD++CLQETK +D+ FP + L    Y     GQK
Sbjct: 1   MKIATWNVNSLKVRLQQVIDWLNVNQPDVLCLQETKLQDEFFPVDELAQAGYQSIYAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LSK   +++   LP  D   +              LRI  +Y+P+G  + S K
Sbjct: 61  TYNGVALLSKVTGVDVCAALPDFDDPQKRLIAATYGD-----LRIICVYVPNGERVDSEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+     F  Q       +   GD+NI P+  D Y+P  W+     +   RQ+F
Sbjct: 116 YAYKLRWLSILNSFLQQERTRYGKVALLGDFNIAPEDRDVYDPEAWKGQVLCSEAERQAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L + GF D+         +Y++WDY   ++ +N+G+RIDHI+LS E      + ++D 
Sbjct: 176 RGLLDTGFVDSFHLFEQPEKIYTWWDYRMMAFRRNRGLRIDHILLSHETADSCATWQVDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV V L
Sbjct: 236 APRKLERPSDHAPVWVEL 253


>gi|188581164|ref|YP_001924609.1| exodeoxyribonuclease III Xth [Methylobacterium populi BJ001]
 gi|179344662|gb|ACB80074.1| exodeoxyribonuclease III Xth [Methylobacterium populi BJ001]
          Length = 264

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 115/261 (44%), Positives = 160/261 (61%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNSI+ R+ +L  ++ E  PD++CLQE K +D +FP E +++  Y +ET GQK
Sbjct: 1   MRITTWNVNSIKQRVGHLLGFLDEAKPDVVCLQELKCQDTSFPREEIEAAGYAVETLGQK 60

Query: 64  SYNGVAILSKYQPIEIV--THLPGDDLDVQARFIEATFTINTQ-TLRIGNLYLPHGNPIT 120
           +YNGVA+L +           LPGD  D QAR+IEA         +RI ++YLP+GNP  
Sbjct: 61  AYNGVALLVRAPLQYTQLLRGLPGDAEDEQARYIEALVHGEGVAPVRIASIYLPNGNPAP 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             KY  K++++ R    A   +  E+ L+ AGD+N+IP+P D  +P  W  DA F  E R
Sbjct: 121 GPKYSYKLAFMARLKAHARALMASEDALVLAGDFNVIPEPEDAADPAAWTQDALFLPETR 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           ++F+ L   GFTD +RA   +  LY+FWDY A  W +N GIRIDH++LSP+A   L SA 
Sbjct: 181 RAFRALLAEGFTDGLRACEPSAGLYTFWDYQAGCWPRNFGIRIDHLLLSPQAADRLVSAS 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           +    RG  KPSDH PV V L
Sbjct: 241 VQKHLRGLEKPSDHVPVTVEL 261


>gi|88813684|ref|ZP_01128912.1| exodeoxyribonuclease III [Nitrococcus mobilis Nb-231]
 gi|88789071|gb|EAR20210.1| exodeoxyribonuclease III [Nitrococcus mobilis Nb-231]
          Length = 256

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 93/258 (36%), Positives = 146/258 (56%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS++ R+  +  W+K   PD++ LQETK  D++FP E L++  Y +   GQK
Sbjct: 1   MKLASWNVNSLKVRLPQVLEWLKTAQPDLLGLQETKVPDEHFPSEALRAAGYEVVYSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LS++   E++T     +L   A        +    LR  NLY+P+G  + S K
Sbjct: 61  TYNGVAVLSRWSITEMLT-----ELPTLADPQRRVLAVTAAGLRFINLYVPNGQAVGSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+     + ++ LE     I  GD+NI PQ  D ++P  W      +   R++ 
Sbjct: 116 YAYKLDWLAHLRGWLAEELERWPRSIVVGDFNIAPQDQDVHDPQQWHEQVLCSTPEREAL 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +GF D+ R       ++S+WDY  +S+ +N+G+RID I+ S   T  L ++ +D 
Sbjct: 176 QALLALGFADSFRQFPQEPGIFSWWDYRMNSFRRNRGLRIDLILSSAALTRTLTASYVDR 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PRGW +PSDH PV+  L
Sbjct: 236 GPRGWPRPSDHAPVVAEL 253


>gi|251789807|ref|YP_003004528.1| exodeoxyribonuclease III [Dickeya zeae Ech1591]
 gi|247538428|gb|ACT07049.1| exodeoxyribonuclease III [Dickeya zeae Ech1591]
          Length = 268

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 89/268 (33%), Positives = 133/268 (49%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP + ++   YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLDEVKQFGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K +P+ +    P DD D Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVALLTKAEPLAVRRGFPTDDDDAQRRIIMADLATPLGTLTVVNGYFPQGESRDHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACFT 176
           K+  K  + +    +  Q  + E+P++  GD NI P   D           +      F 
Sbjct: 121 KFPAKTRFYQDLQHYLEQHHQSEQPVLIMGDMNISPADQDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L+N G  D  RA +      +S++DY +  +  N+G+RID IM +P   S 
Sbjct: 181 PEEREWMERLKNWGLVDTFRAANPECQDRFSWFDYRSAGFDDNRGLRIDLIMATPPLASR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   RG  KPSDH PV     +
Sbjct: 241 CAATGIDYAIRGMEKPSDHAPVWAEFTL 268


>gi|78212211|ref|YP_380990.1| exodeoxyribonuclease III [Synechococcus sp. CC9605]
 gi|78196670|gb|ABB34435.1| exodeoxyribonuclease III [Synechococcus sp. CC9605]
          Length = 288

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 91/276 (32%), Positives = 140/276 (50%), Gaps = 4/276 (1%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           S V +ATWNVNS+R R+  + +W+    PD++CLQETK +D  FP E  +S  +H+   G
Sbjct: 10  STVQIATWNVNSVRTRLDQVLSWLDREQPDLLCLQETKVDDSLFPVEAFKSAGWHVHIHG 69

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQAR----FIEATFTINTQTLRIGNLYLPHGN 117
           QK+YNGVA++S+    ++     G+  D          +   +     +R+ NLY+P+G+
Sbjct: 70  QKAYNGVALISREPLEDVRCGFVGELPDDAEADDLGAQKRVISALLSGVRVLNLYVPNGS 129

Query: 118 PITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTL 177
            + S KY  K++W+    R+   + +  EPL   GD+NI  +  D  +P         + 
Sbjct: 130 SLKSEKYPYKLTWLGCLKRYLDAQQQRGEPLCMVGDFNIGLEARDLPDPDRQTGGIMASD 189

Query: 178 EVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLH 237
             RQ+ +        D  R        +S+WDY + +W +++G RIDHI L  E   L  
Sbjct: 190 AERQALRDALGDRLQDVFRVFEPDSGHWSWWDYRSGAWDRDRGWRIDHIYLCDELLGLAR 249

Query: 238 SARIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDS 273
           S  I    RG  +PSDH PV V LD P   + + D 
Sbjct: 250 SCVIHKGMRGNQQPSDHAPVSVDLDWPPADEDEGDE 285


>gi|126657177|ref|ZP_01728343.1| Exodeoxyribonuclease III xth [Cyanothece sp. CCY0110]
 gi|126621448|gb|EAZ92159.1| Exodeoxyribonuclease III xth [Cyanothece sp. CCY0110]
          Length = 262

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 90/262 (34%), Positives = 142/262 (54%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R  ++  W+  N+ D++CLQETK  D++FP E  + L YH+   GQK
Sbjct: 1   MKIATWNVNSIRTRKPHVVDWLTNNSIDVLCLQETKVIDQDFPREPFEELGYHVYIYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT---QTLRIGNLYLPHGNPIT 120
           +YNGVAI S+    +++T       +  A+  +    + +     +RI NLY+P+G  + 
Sbjct: 61  AYNGVAIFSRQPMTDVITGFTPMVGEEIAQQFDEQKRVISGVIDGIRIINLYVPNGASVG 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPL-IFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           S KY+ K+ W K    +    ++ E       GD+NI  +  D YN    EN    +   
Sbjct: 121 SEKYEYKLQWFKVLKAYLDNLIKKESYELCICGDFNIALEDKDIYNSKGKENHIMSSPLE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++ +K+  +G  DA R        +S+WDY +    +N+G RIDH+ L+ +      + 
Sbjct: 181 REALEKILKIGLKDAFRKFTTEGGHFSWWDYRSGGLQRNRGWRIDHLYLTNKLYEKAVNC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            ID +PR   +PSDHTPVI+ +
Sbjct: 241 TIDIEPRKQERPSDHTPVILEI 262


>gi|221198450|ref|ZP_03571496.1| exodeoxyribonuclease III [Burkholderia multivorans CGD2M]
 gi|221208601|ref|ZP_03581602.1| exodeoxyribonuclease III [Burkholderia multivorans CGD2]
 gi|221171592|gb|EEE04038.1| exodeoxyribonuclease III [Burkholderia multivorans CGD2]
 gi|221182382|gb|EEE14783.1| exodeoxyribonuclease III [Burkholderia multivorans CGD2M]
          Length = 272

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 85/258 (32%), Positives = 134/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ FP   L++  Y     GQK
Sbjct: 15  MKIATWNVNSLNVRKQHVLDWLAQSAVDVLCLQELKLPDEKFPRADLEAAGYRSWFAGQK 74

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       + +  +    +         +    +RI + Y P+G  + S K
Sbjct: 75  TYNGVAILARDTLPFDESDVVRNIPGFEDTQQRV-IAVTIDGVRIVSAYFPNGQAVGSDK 133

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    ++    L   GDYNI P+  D ++P  WE +   + + R  F
Sbjct: 134 FLYKMQWLDALHAWLRAEMQRYPKLALLGDYNIAPEDRDVHDPAKWEGENLVSPQERAHF 193

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            KL  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 194 AKLIELGFVDAFRRFEQPEKTFTWWDYRMFAFRRNAGLRIDHILLSPALAGSCTSCEVDR 253

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDHTPV+  L
Sbjct: 254 VPRTWEQPSDHTPVVAVL 271


>gi|309379045|emb|CBX22347.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 256

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 133/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRNAPEDVHFGLPSLPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRYGKLVLLGDFNIAPADADCYDPKKWYEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP     L   R+D 
Sbjct: 177 QNLLDLGLTDSLRQVHPEGVFYTWFDYRGAMFQRKLGLRIDHILVSPAMAEALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R   +PSDH PV    D+
Sbjct: 237 DTRALERPSDHAPVTAEFDL 256


>gi|255066148|ref|ZP_05318003.1| exodeoxyribonuclease III [Neisseria sicca ATCC 29256]
 gi|255049693|gb|EET45157.1| exodeoxyribonuclease III [Neisseria sicca ATCC 29256]
          Length = 256

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 88/260 (33%), Positives = 138/260 (53%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +  W+ ++ PD++ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNWLADHQPDVLVLQELKLDQDKFPAAALQMMGWHSVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+ +P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRSEPQDVHVGLPTLPDDPQRRVIAATVNG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +   E L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FLYKEQWFAALTEFVRDEMTRYEKLVLLGDFNIAPADADCYDPEKWHEKIHCSSIERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDH ++SP  +++L    +D 
Sbjct: 177 KNLLDLGLTDSLRQIHPEGAFYTWFDYRGAMFQRKLGLRIDHQLISPALSAVLKDVYVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R   +PSDH PV+   D+
Sbjct: 237 DARAQERPSDHAPVVAEFDL 256


>gi|146299724|ref|YP_001194315.1| exodeoxyribonuclease III Xth [Flavobacterium johnsoniae UW101]
 gi|146154142|gb|ABQ04996.1| exodeoxyribonuclease III Xth [Flavobacterium johnsoniae UW101]
          Length = 258

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 147/259 (56%), Gaps = 3/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN I  R++ L  W+ E  PDI+CLQE K    NFP + +    Y+    GQK
Sbjct: 1   MKIATYNVNGINGRLNVLLRWLDEAAPDIVCLQELKAPQDNFPLKAINDAGYNAVWHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAIL++   IE +T                        + I  LYLP+GNP+   K
Sbjct: 61  QWNGVAILARNMKIEEITRTL---PGDDEDVQSRYIEALINGIVIACLYLPNGNPVPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           ++ K+ W  R    A+  L L+ P++  GDYN++P   D Y P  W NDA F  E+R++F
Sbjct: 118 FEYKLKWFDRLAERAAILLSLKVPVLLIGDYNVMPTELDVYKPEKWINDALFKPEIRKAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             + + G+TDAIR  +    +Y+FWDY+ +++ +N G+RIDH +LSP+  S LHS  +D 
Sbjct: 178 AAIVSQGWTDAIRTLYPDEKIYTFWDYFRNAYQRNAGLRIDHFLLSPQIASALHSGGVDR 237

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RGW K SDH PV + +D
Sbjct: 238 HVRGWEKTSDHAPVWIQID 256


>gi|119513165|ref|ZP_01632214.1| Exodeoxyribonuclease III xth [Nodularia spumigena CCY9414]
 gi|119462186|gb|EAW43174.1| Exodeoxyribonuclease III xth [Nodularia spumigena CCY9414]
          Length = 260

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 134/260 (51%), Gaps = 2/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  +  W+ EN  D++CLQETK  D +FP    + L YH+   GQK
Sbjct: 1   MKIATWNVNSIRTRLEQVIFWLSENPIDVLCLQETKVVDADFPRSPFEELGYHVYFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT--LRIGNLYLPHGNPITS 121
           +YNGVA++S+    ++         ++   + E    I      +RI NLY+P+G+ + S
Sbjct: 61  AYNGVALISRQPLTDVSPGFTPILPNIDPLWDEQKRVITGVIDGIRIVNLYVPNGSAVGS 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY+ K+ W+     +    L  +  +   GD+NI     D +     +N    +   RQ
Sbjct: 121 EKYEFKLRWLTVLREYLQTLLLSQPGICMCGDFNIALAAEDIHENANPDNHIMSSEPERQ 180

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
             + +  +GF DA R        YS+WDY A  + +N+G RIDH  L+P       S  I
Sbjct: 181 GLRDVLELGFADAFRKFTTEGGHYSWWDYRAAGFRRNRGWRIDHHYLTPTLYESAKSCII 240

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D  PR   +PSDHTPVIV  
Sbjct: 241 DITPRKLPQPSDHTPVIVEF 260


>gi|270262158|ref|ZP_06190430.1| exodeoxyribonuclease III [Serratia odorifera 4Rx13]
 gi|270044034|gb|EFA17126.1| exodeoxyribonuclease III [Serratia odorifera 4Rx13]
          Length = 268

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 87/268 (32%), Positives = 133/268 (49%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L+A I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLSAIIEQHQPDVIGLQETKVHDDMFPLEEVSQHGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K +PI +    P DD D Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVALLTKDEPIAVRRGFPTDDDDAQRRIIMADLATPQGTLTVINGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDC------YNPIIWENDACFT 176
           K+  K  + +    +  Q+L +E P++  GD NI P  +D           +      F 
Sbjct: 121 KFPAKSRFYQDLQNYLEQQLSVESPVLVMGDVNISPSDYDIGIGEESRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L N G  D  R  +   +  +S++DY +  + +N+G+RID ++ S    + 
Sbjct: 181 PEEREWMDRLLNWGLVDTYRHANPGRNDEFSWFDYRSRGFDENRGLRIDLLLASTPLAAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID + RG  KPSDH PV     +
Sbjct: 241 CTATGIDYQIRGMEKPSDHAPVWAEFSL 268


>gi|167570556|ref|ZP_02363430.1| exodeoxyribonuclease III [Burkholderia oklahomensis C6786]
          Length = 258

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 84/258 (32%), Positives = 133/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ +++ D++CLQE K  D+ FP   L++  Y     GQK
Sbjct: 1   MRIATWNVNSLNVRKQHVLDWLAQSDVDVLCLQELKVPDEKFPRADLEAAGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       T++  +    +              +RI + Y P+G    S K
Sbjct: 61  TYNGVAILARASLPFGETNVVRNIPGFEDAQQRLIAATIDG-VRIVSAYFPNGQAPDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    ++    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLKDEMQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 180 AQLLALGFVDAFRRFDQPEKTFTWWDYRMLAFRRNAGLRIDHILLSPALADTCTSCTVDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDHTPV+  +
Sbjct: 240 VPRTWEQPSDHTPVVAQI 257


>gi|253997905|ref|YP_003049968.1| exodeoxyribonuclease III Xth [Methylovorus sp. SIP3-4]
 gi|253984584|gb|ACT49441.1| exodeoxyribonuclease III Xth [Methylovorus sp. SIP3-4]
          Length = 255

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 89/258 (34%), Positives = 133/258 (51%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+ ++  W   N PD++CLQETK ED  FP+E L ++ Y+    GQK
Sbjct: 1   MKLATWNVNSLNVRLPHVLDWCTANQPDVLCLQETKQEDSKFPYEALTAIGYNAIHSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS++        +P    + +              +RI   Y+P+G  + S K
Sbjct: 61  TYNGVAILSRHVLEHPSYGIPDFADEQKRLIAATVKG-----IRIVCAYIPNGQSVDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+          L     L   GDYNI P+  D ++P  W      +   R +F
Sbjct: 116 YQYKLNWLASLTTHLQAELAAHPKLALLGDYNIAPEDRDVHDPAAWLGQVLVSEPERTAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G  D  R        +S+WDY    + +N G+RIDHI++S    +   ++ ID 
Sbjct: 176 QGLVGLGLHDTFRLFEQPEASFSWWDYRMAGFRRNLGLRIDHILVSTPLLAACKASWIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDHTPV++ L
Sbjct: 236 APRKLERPSDHTPVVLEL 253


>gi|238763171|ref|ZP_04624137.1| Exodeoxyribonuclease III [Yersinia kristensenii ATCC 33638]
 gi|238698670|gb|EEP91421.1| Exodeoxyribonuclease III [Yersinia kristensenii ATCC 33638]
          Length = 271

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 84/271 (30%), Positives = 129/271 (47%), Gaps = 8/271 (2%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   
Sbjct: 1   MLTMKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEEVSQHGYHVFYH 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           GQK + GVA+L+K +P+ +    P D+ D Q R I A        L + N Y P G    
Sbjct: 61  GQKGHYGVALLTKNEPLAVRRGFPTDEEDAQRRIIMADIATPQGPLTVINGYFPQGESRD 120

Query: 121 STK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDC------YNPIIWENDA 173
               +  K  +     ++  Q+L  +  ++  GD NI P   D           +     
Sbjct: 121 HPIKFPAKERFYADLQQYLEQQLSSDAQVLIMGDVNISPTDMDIGIGEESRKRWLRTGKC 180

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEA 232
            F  E R   ++LQN G  D  RA +   +  +S++DY +  + +N+G+RID ++ S   
Sbjct: 181 SFLPEERAWLERLQNWGLVDTFRAANPDCNDQFSWFDYRSRGFDENRGLRIDLLLASHPL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
            +   +  ID   R   KPSDH PV     +
Sbjct: 241 AARCIATGIDYDIRSMEKPSDHAPVWSEFAL 271


>gi|313499211|gb|ADR60577.1| Exodeoxyribonuclease III [Pseudomonas putida BIRD-1]
          Length = 265

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 103/262 (39%), Positives = 151/262 (57%), Gaps = 5/262 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  + +AT+N+N IR+R+  L AW++   PDI CLQE K  D+ FP   L++  Y     
Sbjct: 1   MKALKIATFNINGIRSRLPALLAWLEREQPDIACLQELKAADQQFPRAELEAAGYGSLHH 60

Query: 61  GQKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ S+NGVAIL +   P+E+   LPG + D Q+R++EA        + +  LYLP+GNP 
Sbjct: 61  GQPSWNGVAILVRGSDPLEVRRGLPGLEEDSQSRYLEAA----AHGVLVACLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K+D K+ W +  ++ A    E   P + AGD+N++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFDYKLHWFECLIQHARSLYESGHPTLLAGDFNVVPTDMDIYNPRSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R  +Q+L + G+ DAIR  +    +Y+FWDY+ + W++N G+RIDH++L+ E    L  A
Sbjct: 177 RACYQRLLDQGWLDAIRHLYPDERVYTFWDYFRNHWARNAGLRIDHLLLNHELAPYLKRA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            +D   R   K SDH PV + L
Sbjct: 237 GVDAWVRNEAKASDHAPVWIEL 258


>gi|313199970|ref|YP_004038628.1| exodeoxyribonuclease III xth [Methylovorus sp. MP688]
 gi|312439286|gb|ADQ83392.1| exodeoxyribonuclease III Xth [Methylovorus sp. MP688]
          Length = 255

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 89/258 (34%), Positives = 133/258 (51%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+ ++  W   N PD++CLQETK ED  FP+E L ++ Y+    GQK
Sbjct: 1   MKLATWNVNSLNVRLPHVLDWCTANQPDVLCLQETKQEDSKFPYEALTAIGYNAIHSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS++        +P    + +              +RI   Y+P+G  + S K
Sbjct: 61  TYNGVAILSRHVLEHPSYGIPDFADEQKRLIAATVKG-----IRIVCAYIPNGQSVDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+          L     L   GDYNI P+  D ++P  W      +   R +F
Sbjct: 116 YQYKLNWLASLTTHLQAELAAHPKLALLGDYNIAPEDRDVHDPAAWLGQVLVSEPERNAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G  D  R        +S+WDY    + +N G+RIDHI++S    +   ++ ID 
Sbjct: 176 QGLVGLGLHDTFRLFEQPEASFSWWDYRMAGFRRNLGLRIDHILVSTPLLAACKASWIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDHTPV++ L
Sbjct: 236 APRKLERPSDHTPVVLEL 253


>gi|227326084|ref|ZP_03830108.1| exonuclease III [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 268

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 90/268 (33%), Positives = 129/268 (48%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKVVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVGQYGYHVYYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L K QPI +    P D+ D Q R I A F     TL + N Y P G       
Sbjct: 61  GHYGVALLCKEQPIAVRRGFPTDEDDAQRRIIMADFATEHGTLTVVNGYFPQGESRDHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q     +PLI  GD NI P         +     +      F 
Sbjct: 121 KFPAKTRFYQDLQTYLEQHHSATQPLIVMGDVNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +LQ+ G  D  RA +   +  +S++DY +  +  N+G+RID I+ S      
Sbjct: 181 PEEREWMARLQDWGLIDTFRAANPDSNDRFSWFDYRSAGFDDNRGLRIDLILASTFLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   RG  KPSDH P+     +
Sbjct: 241 CVATGIDYDIRGMEKPSDHAPIWAQFSL 268


>gi|169631267|ref|YP_001704916.1| exodeoxyribonuclease III protein XthA [Mycobacterium abscessus ATCC
           19977]
 gi|169243234|emb|CAM64262.1| Probable exodeoxyribonuclease III protein XthA [Mycobacterium
           abscessus]
          Length = 266

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 130/266 (48%), Gaps = 7/266 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIRAR   + +W++ +  D++ +QETK  DK FP +      Y +   G  
Sbjct: 1   MRLATWNVNSIRARADRVISWLERSGTDVLAMQETKCSDKQFPMQAFTDAGYEVAHVGFS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPHGNP 118
            +NGVAI S+    ++     G      +  IE              +R+ +LY+P+G  
Sbjct: 61  QWNGVAIASRVGLEDVTVGFEGQPGWSSSEDIEEASEARALGATCNGVRVWSLYVPNGRT 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLE--LEEPLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           +    Y  K+ W+      A+  L    ++ +   GD+NI P   D ++   ++     +
Sbjct: 121 LEDPHYQYKLRWLSALRDTAAGWLADAPDQQVALVGDWNIAPTDDDIWSVEAYQGSTHVS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R +F  + + GF D +R       +Y++WDY   S+ K +G+RID ++ SPE    +
Sbjct: 181 EPERSAFTAMNDAGFADVVRPFTPGPGVYTYWDYTQLSFPKKRGMRIDFVLGSPEFAKRV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSLD 262
            +A ID + R     SDH PV+V LD
Sbjct: 241 GNAHIDREERKGKGASDHAPVVVDLD 266


>gi|187920658|ref|YP_001889690.1| exodeoxyribonuclease III Xth [Burkholderia phytofirmans PsJN]
 gi|187719096|gb|ACD20319.1| exodeoxyribonuclease III Xth [Burkholderia phytofirmans PsJN]
          Length = 270

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 106/272 (38%), Positives = 155/272 (56%), Gaps = 5/272 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M+ + +AT+N+N IR+R+  L  W++   PDI+CLQE K  D  FP E L+   Y     
Sbjct: 1   MARLRIATFNINGIRSRLPALLQWLEREAPDIVCLQELKAVDSAFPVEQLRDAGYGAIWQ 60

Query: 61  GQKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ ++NGVAILSK   P+E    LPG + D  +R+IEA        + +  LYLP+GNP 
Sbjct: 61  GQSAWNGVAILSKGEAPLESRRGLPGFEDDTHSRYIEAAVGG----VLVACLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K+D K++W   F+  A++  +   P++ AGD+N++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFDYKLAWFDHFIEHAAKLYKSAHPVVLAGDFNVVPTDEDIYNPRSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+ +Q+L   G+TDA+R       +Y+FWDY+   W  N G+RIDH++LS +    L  A
Sbjct: 177 RERYQRLLAQGWTDALRTHFGDERVYTFWDYFRRHWETNSGLRIDHLLLSADLAPRLRDA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQ 271
            +D   RG    SDH P  V L++   R+K+ 
Sbjct: 237 GVDRWVRGEPHASDHAPTWVELEMGATRRKKS 268


>gi|313667795|ref|YP_004048079.1| exodeoxyribonuclease III [Neisseria lactamica ST-640]
 gi|313005257|emb|CBN86690.1| exodeoxyribonuclease III [Neisseria lactamica 020-06]
          Length = 256

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 89/260 (34%), Positives = 133/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PD++ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDVLVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRSAPEDVYIGLPALPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRYGKLVLLGDFNIAPADADCYDPEKWYEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP     L   R+D 
Sbjct: 177 KNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAEALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R   +PSDH PV    D+
Sbjct: 237 DTRALERPSDHAPVTAEFDL 256


>gi|237800675|ref|ZP_04589136.1| exonuclease III [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331023534|gb|EGI03591.1| exonuclease III [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 270

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 89/269 (33%), Positives = 137/269 (50%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIEKHQPDVIGLQETKVSDEQFPHADIEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+++     GDD + Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNPPLDLHKGFEGDDEESQKRFIRGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +            E+PLI  GD NI P+        D     +      F
Sbjct: 121 TKFPAKQRFYENLQSLLESHFSNEQPLIVMGDVNISPEDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRYLNPEVSDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D   RG  KPSDH P+ + L
Sbjct: 241 QPRIKAAGVDYDLRGMEKPSDHAPIWLEL 269


>gi|295835706|ref|ZP_06822639.1| exodeoxyribonuclease III [Streptomyces sp. SPB74]
 gi|295825643|gb|EDY45706.2| exodeoxyribonuclease III [Streptomyces sp. SPB74]
          Length = 262

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 79/263 (30%), Positives = 130/263 (49%), Gaps = 1/263 (0%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  + +ATWNVNSI AR+  L AW++ +  D++C+QETKT  + FP E L+   Y     
Sbjct: 1   MVDMRIATWNVNSITARLPRLLAWLESSGTDVLCVQETKTTAEGFPTEALREAGYESAVN 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
               +NGVA++S+    ++V+ LPG           A        +R+ ++Y+P+G  + 
Sbjct: 61  ATGRWNGVAVISRAGLDDVVSGLPGQPAYDGVMEPRALGATCGP-VRVWSVYVPNGREVG 119

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
              Y  K+ W++      +       P    GDYN+ P   D Y+P ++E     T   R
Sbjct: 120 HPHYAYKLEWLEALRTAVADDAAGARPFAVLGDYNVAPGDEDVYDPAVFEGLTHVTPPER 179

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           ++  KL+  G  D +         Y++WDY   ++ KN+G+RID +  +    +    A 
Sbjct: 180 EALAKLRATGLGDLVPRPLKYDRPYTYWDYRQLAFPKNRGMRIDLVYANAAFRTAAKGAY 239

Query: 241 IDTKPRGWTKPSDHTPVIVSLDI 263
           +D + R     SDH PV+V L++
Sbjct: 240 VDREERKGKGASDHAPVVVDLEV 262


>gi|108797547|ref|YP_637744.1| exodeoxyribonuclease III [Mycobacterium sp. MCS]
 gi|119866633|ref|YP_936585.1| exodeoxyribonuclease III [Mycobacterium sp. KMS]
 gi|108767966|gb|ABG06688.1| Exodeoxyribonuclease III [Mycobacterium sp. MCS]
 gi|119692722|gb|ABL89795.1| Exodeoxyribonuclease III [Mycobacterium sp. KMS]
          Length = 267

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 81/265 (30%), Positives = 133/265 (50%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIRAR+  +  W++  + D++ +QETK  D+ FP     +L Y +  CG  
Sbjct: 1   MRLATWNVNSIRARVDRVTDWLERADVDVLAMQETKCNDEQFPTMPFAALGYDVVHCGFN 60

Query: 64  SYNGVAILSKYQPIEIVTHL-----PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNP 118
            +NGVAI S+    ++          GD  D++A             +R+ +LY+P+G  
Sbjct: 61  QWNGVAIASRVGLDDVAVGFDGQPTWGDKPDIEAAAEARALGATCAGVRVWSLYVPNGRF 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           + S  Y  K+ W+    + A   L      P+   GD+NI P   D ++   +++    T
Sbjct: 121 VGSPHYAYKLEWLAALRKTAHGWLTENPALPIAMVGDWNIAPTDDDVWSVEAYQDSTHVT 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              RQ+F ++ + G+ D +R       +Y++WDY   ++ K +G+RID I+ SP     +
Sbjct: 181 PPERQAFTEIVDAGYADVVRPFTPGPGVYTYWDYTRLAFQKRRGMRIDFILGSPAFADRV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
             A I  + R     SDH PV+V L
Sbjct: 241 THAEIVREERKGKGASDHAPVLVDL 265


>gi|126433169|ref|YP_001068860.1| exodeoxyribonuclease III [Mycobacterium sp. JLS]
 gi|126232969|gb|ABN96369.1| Exodeoxyribonuclease III [Mycobacterium sp. JLS]
          Length = 267

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 81/265 (30%), Positives = 131/265 (49%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIRAR+  +  W++  + D++ +QETK  D+ FP     +L Y +  CG  
Sbjct: 1   MRLATWNVNSIRARVDRVTDWLERADVDVLAMQETKCNDEQFPTMPFAALGYDVVHCGFN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT-----LRIGNLYLPHGNP 118
            +NGVAI S+    ++     G         IEA             +R+ +LY+P+G  
Sbjct: 61  QWNGVAIASRVGLDDVAVGFDGQPTWCDKPDIEAAAEARALGATCAGVRVWSLYVPNGRF 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           + S  Y  K+ W+    + A   L      P+   GD+NI P   D ++   +++    T
Sbjct: 121 VGSPHYAYKLEWLAALRKTAHGWLTENPALPIAMVGDWNIAPTDDDVWSVEAYQDSTHVT 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              RQ+F ++ + G+ D +R       +Y++WDY   ++ K +G+RID I+ SP     +
Sbjct: 181 PPERQAFTEIVDAGYADVVRPFTPGPGVYTYWDYTRLAFQKRRGMRIDFILGSPAFADRV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
             A I  + R     SDH PV+V L
Sbjct: 241 THAEIVREERKGKGASDHAPVLVDL 265


>gi|167563395|ref|ZP_02356311.1| exodeoxyribonuclease III [Burkholderia oklahomensis EO147]
          Length = 258

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 84/258 (32%), Positives = 133/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ +++ D++CLQE K  D+ FP   L++  Y     GQK
Sbjct: 1   MRIATWNVNSLNVRKQHVLDWLAQSDVDVLCLQELKVPDEKFPRADLEAAGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       T++  +    +              +RI + Y P+G    S K
Sbjct: 61  TYNGVAILARASLPFDETNVVRNIPGFEDAQQRLIAATIDG-VRIVSAYFPNGQAPDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    ++    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLKDEMQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 180 AQLLALGFVDAFRRFDQPEKTFTWWDYRMLAFRRNAGLRIDHILLSPALADTCTSCMVDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDHTPV+  +
Sbjct: 240 VPRTWEQPSDHTPVVAQI 257


>gi|312885637|ref|ZP_07745272.1| exodeoxyribonuclease III [Mucilaginibacter paludis DSM 18603]
 gi|311301844|gb|EFQ78878.1| exodeoxyribonuclease III [Mucilaginibacter paludis DSM 18603]
          Length = 257

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 95/258 (36%), Positives = 141/258 (54%), Gaps = 3/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN +  R+  L  W+ +  PD++CLQE K   + FP + +    Y     GQK
Sbjct: 1   MKIATYNVNGVNGRLPVLLRWLNQTTPDVVCLQELKAPQEKFPEQAIADAGYQAIWHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAIL++   I     +                      + IG LYLP+GNP    K
Sbjct: 61  SWNGVAILTRNLQI---KEIGRALPGDPEDMHSRYIEAVVNGIHIGCLYLPNGNPAPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K+ W +R    A+  L    P++  GDYN++P   D Y P  W +DA F  E R +F
Sbjct: 118 FDYKLQWFERLKSHAASLLAAGTPVVLTGDYNVMPTELDVYKPERWLDDALFRPETRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L + G+TDAIR  + +  +Y+FWDY+ D++ ++ G+RIDH +LSP+    L +A +D 
Sbjct: 178 KDLVDQGWTDAIRKLYPSQKIYTFWDYFRDAYGRDAGLRIDHFLLSPQLDGRLLAAGVDR 237

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RGW K SDH PV + L
Sbjct: 238 NVRGWEKTSDHAPVWIEL 255


>gi|319782509|ref|YP_004141985.1| exodeoxyribonuclease III Xth [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168397|gb|ADV11935.1| exodeoxyribonuclease III Xth [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 256

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 90/259 (34%), Positives = 138/259 (53%), Gaps = 3/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N+I +R+ NL  W+    PD++CLQE K  D  FP   L +  Y     G+ 
Sbjct: 1   MKIASFNINNINSRLENLLTWLAVAKPDVVCLQELKARDMQFPRSALAAAGYGAVWKGEP 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVAIL++     +           +A             + +  LY P+GNP    K
Sbjct: 61  TWNGVAILARSAEPVLTRDAL---PGDEADRQSRYIEAAVNGIVVACLYAPNGNPQPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W  R    A Q L+   P++ AGDYNI+P+P D Y    ++++A    E R SF
Sbjct: 118 FAYKLAWHARLEAHAEQLLDTGLPVVLAGDYNIVPEPRDIYATRSYDDNALVQPESRASF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L + G+ DA+R  H    LY+FWDY  + W ++ G+R+DHI+LS +    L +A ID 
Sbjct: 178 RRLLDQGWLDALRKKHPKETLYTFWDYRRNRWPRDAGLRLDHILLSKKLARRLTAAGIDR 237

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RG    SDH PV V L 
Sbjct: 238 DVRGEDGASDHAPVWVELK 256


>gi|145630665|ref|ZP_01786444.1| exodeoxyribonuclease III [Haemophilus influenzae R3021]
 gi|260582045|ref|ZP_05849840.1| exodeoxyribonuclease III [Haemophilus influenzae NT127]
 gi|144983791|gb|EDJ91241.1| exodeoxyribonuclease III [Haemophilus influenzae R3021]
 gi|260094935|gb|EEW78828.1| exodeoxyribonuclease III [Haemophilus influenzae NT127]
          Length = 267

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 82/267 (30%), Positives = 130/267 (48%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  +    P D+ DVQ R I A        L + N Y P G      T
Sbjct: 61  GHYGVALLTKQEPKAVRRGFPTDNEDVQKRIIMADLETEFGLLTVINGYFPQGESRAHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+ +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEEREWYQRLYDYGLEDSFRKMNPTANDKFSWFDYRSKGFDDNRGLRIDHILVSQKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|49082844|gb|AAT50822.1| PA2545 [synthetic construct]
          Length = 271

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 87/269 (32%), Positives = 129/269 (47%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+ + PD+I LQETK  D  FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIERHQPDVIGLQETKVADDQFPQAEIEALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+E+    P D  + Q RFI  TF       + + N Y P G      
Sbjct: 61  GHYGVALLSRQAPLELHRGFPSDGEESQRRFIWGTFSDAQGNPITVMNGYFPQGENREHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+  K  +            + E+ L+  GD NI P   D           +      F
Sbjct: 121 TKFPAKQRFYADLQSLLENSFKPEQALVVMGDINISPGDCDIGIGEENRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKN--KGIRIDHIMLSPEA 232
             E R+    L+N G  D+ RA +   +  +S++DY +  +  N  +G+RID I+ S   
Sbjct: 181 LPEEREWLATLKNWGLVDSFRALNPEVNDRFSWFDYRSRGFEDNPKRGLRIDVILASRVL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                 A ID   RG  KPSDH P+ + L
Sbjct: 241 QPRFKDAGIDYDLRGMEKPSDHAPIWLEL 269


>gi|187924588|ref|YP_001896230.1| exodeoxyribonuclease III Xth [Burkholderia phytofirmans PsJN]
 gi|187715782|gb|ACD17006.1| exodeoxyribonuclease III Xth [Burkholderia phytofirmans PsJN]
          Length = 258

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 83/258 (32%), Positives = 131/258 (50%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R  ++  W++ +  D++CLQE K  D+ FP   L+   Y     GQK
Sbjct: 1   MKIATWNVNSLKVRQQHVIDWLETSGTDVLCLQELKLPDEKFPRAELEEKGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGV IL +   + +       ++       +       + +RI + Y P+G    + K
Sbjct: 61  TYNGVGILVRGG-LTVDEGSIVRNIPGFEDPQQRVIAATIEGVRIISAYFPNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     + +  + L   L   GDYNI P   D ++P  WE     + E R +F
Sbjct: 120 FAYKLRWLAALHDWIASEMALHPKLALLGDYNIAPDDRDVHDPKAWEGQNLVSPEERAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +G  DA R       +YS+WDY   ++ +N G+RIDHI+LS     +  S  +D 
Sbjct: 180 VRLIELGLLDAFRQFEQPEKIYSWWDYRMMAFRRNAGLRIDHILLSKALADVCSSCDVDK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDH PV+  L
Sbjct: 240 VPRKWDQPSDHAPVVAQL 257


>gi|103487661|ref|YP_617222.1| exodeoxyribonuclease III (xth) [Sphingopyxis alaskensis RB2256]
 gi|98977738|gb|ABF53889.1| Exodeoxyribonuclease III [Sphingopyxis alaskensis RB2256]
          Length = 256

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 152/259 (58%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR+  L  W++E  PD+ CLQE K+ D+  P + +++  Y     GQK
Sbjct: 1   MKIATFNINGIKARLPRLIEWLEERQPDVACLQELKSSDETMPTKEIEAAGYGFLYHGQK 60

Query: 64  SYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
            +NGVAIL+K   P+E+   L G+  D Q+R++EA        +R+ ++YLP+GNP    
Sbjct: 61  GFNGVAILAKGADPVEVQRGLAGEAEDEQSRYLEAD----AHGIRVASIYLPNGNPQPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W+ R    A   L  E P + AGDYN+IP   D ++P     DA    E R +
Sbjct: 117 KFDYKLRWMARLRERARMLLAAEIPTVLAGDYNVIPHDDDVWDPRAMATDALMQPESRDA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           + +L   G+TDA+R+ H   H++++WDY A +W ++ G RIDH++LSP     L  A +D
Sbjct: 177 WFRLLGDGWTDALRSRHPAGHVWTYWDYQAGAWQRDHGFRIDHLLLSPALADRLVDAGVD 236

Query: 243 TKPRGWTKPSDHTPVIVSL 261
              RG  K SDH P  V L
Sbjct: 237 KDHRGREKASDHAPTWVVL 255


>gi|329847835|ref|ZP_08262863.1| exodeoxyribonuclease III [Asticcacaulis biprosthecum C19]
 gi|328842898|gb|EGF92467.1| exodeoxyribonuclease III [Asticcacaulis biprosthecum C19]
          Length = 258

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 156/261 (59%), Gaps = 5/261 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           +  +AT+NVN +  R+  L  W+ E  PD++CLQE K  D+ FP + L++  Y     GQ
Sbjct: 1   MTKIATFNVNGVNGRLPVLLRWLAEARPDVVCLQELKAPDEKFPVKALEAAGYGAIWHGQ 60

Query: 63  KSYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           KS+NGVAIL+   +P+E    LPGD  D  +R+IEA        + IG LYLP+GNP   
Sbjct: 61  KSWNGVAILAHGAEPVETRRGLPGDPDDTHSRYIEAAVNG----VLIGGLYLPNGNPWPG 116

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            K++ K+ W +R    A++ L    P++ AGDYN++P   D Y P  W++DA F +EVR+
Sbjct: 117 KKFEYKLRWFERLKAHAAELLTTGAPVVLAGDYNVMPTDIDVYAPDRWQDDALFRIEVRE 176

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           ++  L   G+TDA+R  H    +++FWDY    W +N G+RIDH++LSP     L  A +
Sbjct: 177 AYAALMAQGWTDALRELHPGEQIFTFWDYLRARWPRNAGLRIDHLLLSPSMAPRLRQAEV 236

Query: 242 DTKPRGWTKPSDHTPVIVSLD 262
           D   RGW K SDH PV + LD
Sbjct: 237 DRHVRGWEKASDHAPVWIVLD 257


>gi|94495762|ref|ZP_01302342.1| exodeoxyribonuclease III [Sphingomonas sp. SKA58]
 gi|94425150|gb|EAT10171.1| exodeoxyribonuclease III [Sphingomonas sp. SKA58]
          Length = 262

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 103/259 (39%), Positives = 156/259 (60%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR+  L  W+ E  PD+ CLQE KT D+ FP + ++   Y     GQK
Sbjct: 5   MRIATFNINGIKARLPRLLEWLDETRPDVACLQEIKTSDETFPIKDIEDAGYGAIWHGQK 64

Query: 64  SYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
            +NGVAIL++   P+E+   L G+  D  +R++EA        +R+ ++YLP+GNP    
Sbjct: 65  GFNGVAILARGDAPVEVRRGLEGEPEDEHSRYLEADVKG----VRVASIYLPNGNPQPGP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W+ R  R A++    E P + AGDYN+IP+  D ++     +DA    E R +
Sbjct: 121 KFDYKLRWMDRLRRRAAEIWTEEVPAVLAGDYNVIPRDVDTFSVKAMADDALMQPESRAA 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           ++++ N G+TDAI + H    +++FWDY A+SW ++ G RIDH++LSP A   L  AR+D
Sbjct: 181 YRRMLNDGWTDAILSRHPAGGVWTFWDYQANSWPRDAGFRIDHLLLSPAAADRLIDARVD 240

Query: 243 TKPRGWTKPSDHTPVIVSL 261
              RG  K SDH P  V L
Sbjct: 241 RDFRGREKASDHAPTWVEL 259


>gi|294635923|ref|ZP_06714368.1| exodeoxyribonuclease III [Edwardsiella tarda ATCC 23685]
 gi|291090755|gb|EFE23316.1| exodeoxyribonuclease III [Edwardsiella tarda ATCC 23685]
          Length = 269

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 82/269 (30%), Positives = 124/269 (46%), Gaps = 8/269 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA ++++NPD+I LQETK  D  FP + L  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLAAIVEKHNPDVIGLQETKVHDDMFPLQDLAPLGYHLHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L++  P+ +    PGD  D Q R I A        L + N Y P G       
Sbjct: 61  GHYGVALLTRMAPLAVRKGFPGDAEDAQRRIIMADIPTEQGVLTVINGYFPQGESRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDC------YNPIIWENDACFT 176
           K+  K  +      +  Q L  ++ ++  GD NI P   D           +      F 
Sbjct: 121 KFPAKSKFYADLQDYLQQSLTPQDQVLIMGDMNISPADIDIGIGDESRRRWLRSGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R    +L + G  D  R  H      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEERAWMDRLLSWGLVDTYRQAHPERDDRFSWFDYRSKGFDDNRGLRIDLLLASQPLAQR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDIP 264
              + ID + R   KPSDH P+     + 
Sbjct: 241 CVDSGIDYEIRAMEKPSDHAPIWAEFTLS 269


>gi|254777166|ref|ZP_05218682.1| exodeoxyribonuclease III [Mycobacterium avium subsp. avium ATCC
           25291]
          Length = 272

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 79/271 (29%), Positives = 126/271 (46%), Gaps = 7/271 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR+R+  +  W+   + D++ +QETK  D  FP      L Y +   G  
Sbjct: 1   MRLATWNVNSIRSRLPRVLDWLARTDVDVLAMQETKCADGQFPTLPFFELGYEVAHVGFN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQAR-----FIEATFTINTQTLRIGNLYLPHGNP 118
            +NGVAI S+    ++     G                         +RI +LY+P+G  
Sbjct: 61  QWNGVAIASRVGLDDVRVGFEGQPSWSGKPEVAAAAEARALAATCAGVRIWSLYVPNGRA 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           +    Y  K+ W+      A+  L  +    +  AGD+NI PQ  D ++  I+      +
Sbjct: 121 VGDPHYAYKLDWLAALRDSAAGWLREDPAAQIALAGDWNIAPQDDDVWSMEIFAGATHVS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R++F  + +  F D +R       +Y++WDY A  + K +G+RID I+ SP     +
Sbjct: 181 EPERRAFNAILDAQFADLVRPFAPGPGVYTYWDYTALRFPKRQGMRIDFILGSPALARRV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSLDIPEPR 267
             A+ID + R     SDH PV+V +   EP 
Sbjct: 241 THAQIDREERKGKGASDHAPVLVDVSRDEPP 271


>gi|297203458|ref|ZP_06920855.1| exodeoxyribonuclease III [Streptomyces sviceus ATCC 29083]
 gi|197716336|gb|EDY60370.1| exodeoxyribonuclease III [Streptomyces sviceus ATCC 29083]
          Length = 259

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 78/260 (30%), Positives = 123/260 (47%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++    D++CLQE K  +  FPF+ L+   Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESTGTDVLCLQEAKVAEAQFPFDQLREAGYEAAVHATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA++S+    ++V  LPGD     A    A         R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVISRVGLDDVVKGLPGDPGYDGAPEPRAISATCGPA-RVWSVYVPNGREVDHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +      +       P    GDYN+ P   D Y+   +E     T   R + 
Sbjct: 120 YAYKLQWFEALKAAVAGDAAGSRPFAVLGDYNVAPTDDDVYDVAAFEGLTHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +       H +++WDY    + KN+G+RID +  +      +  A +D 
Sbjct: 180 ASLREAGLSDVVPRPLKYDHPFTYWDYRQLCFPKNRGMRIDLVYGNESFAKAVTDAYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDV 259


>gi|319774993|ref|YP_004137481.1| exodeoxyribonuclease III [Haemophilus influenzae F3047]
 gi|329123105|ref|ZP_08251675.1| exodeoxyribonuclease III [Haemophilus aegyptius ATCC 11116]
 gi|317449584|emb|CBY85789.1| exodeoxyribonuclease III [Haemophilus influenzae F3047]
 gi|327471660|gb|EGF17102.1| exodeoxyribonuclease III [Haemophilus aegyptius ATCC 11116]
          Length = 267

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 82/267 (30%), Positives = 129/267 (48%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  +    P D+ D Q R I A        L + N Y P G   T  T
Sbjct: 61  GHYGVALLTKQEPKVVRRGFPTDNEDAQKRIIMADLETEFGLLTVINGYFPQGESRTHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGIGDENRKRWLSTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R  +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDDNRGLRIDHILVSQKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|121593606|ref|YP_985502.1| exodeoxyribonuclease III Xth [Acidovorax sp. JS42]
 gi|120605686|gb|ABM41426.1| exodeoxyribonuclease III Xth [Acidovorax sp. JS42]
          Length = 258

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 93/258 (36%), Positives = 141/258 (54%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS+  R+  + AW++ N  D I LQE K  D+ FP +  ++  YH    GQK
Sbjct: 1   MQIATWNINSLSVRLPQVLAWLEANPVDAIGLQELKLVDEKFPHDAFEAAGYHAVCFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+    ++V ++PG   +       AT       LR+ N Y  +G    + K
Sbjct: 61  TYNGVAILSRTPLRDVVRNIPGHGDEQARVI-AATLDTPEGPLRLVNCYFVNGQAPGTEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++    +    L     L+  GD+N+ P+  D ++P+  ++    T+E RQ F
Sbjct: 120 FSYKLLWLEALRDWLRTELAAHPRLVLVGDFNVAPEDRDSFDPVGLKDTIHHTVEERQHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA R        YS+WDY    + KN+G+RIDHI++S      + + RID 
Sbjct: 180 QDLLGLGLTDAFRLFDQPEKSYSWWDYRMLGFQKNRGLRIDHILVSAALRPSVTACRIDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV+VSL
Sbjct: 240 APRKNPQPSDHAPVVVSL 257


>gi|83645532|ref|YP_433967.1| exonuclease III [Hahella chejuensis KCTC 2396]
 gi|83633575|gb|ABC29542.1| exodeoxyribonuclease III [Hahella chejuensis KCTC 2396]
          Length = 270

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 74/269 (27%), Positives = 117/269 (43%), Gaps = 9/269 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++NVN +R+R+H L   I +  PDII LQETK  D+ FP E +  + Y  E  GQK
Sbjct: 1   MRIVSFNVNGVRSRLHQLKELISQYQPDIIGLQETKVIDELFPLEAINEMGYQAEYYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+LSK   +       GD  +   R+I   + +  QTL + N Y P G   +   
Sbjct: 61  GHYGVALLSKQPALRCFKGFEGDGEEAHKRWIVGEYAVGGQTLVVCNGYFPQGENRSHPD 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACFTL 177
                           Q+   ++P++  GD N+     D           +      F  
Sbjct: 121 KFPNKQRFYAGTLDFLQQRSPDQPIVVMGDMNVSHTDSDIGIGEENRKRWLRTGKCSFLP 180

Query: 178 EVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKN--KGIRIDHIMLSPEATS 234
           E R+   +L + G  D  R         YS++DY +  +  N  +G+RID I+ +    +
Sbjct: 181 EEREWLNRLLDWGLVDTFRQHFPDVKDRYSWFDYRSRGFEDNPKRGLRIDLILATQPLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
               A +  + R   K SDH P+    D+
Sbjct: 241 RCVDAGVSYEIRSMEKASDHCPIWADFDL 269


>gi|104781211|ref|YP_607709.1| exonuclease III [Pseudomonas entomophila L48]
 gi|95110198|emb|CAK14905.1| exonuclease III [Pseudomonas entomophila L48]
          Length = 270

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 84/269 (31%), Positives = 134/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D  FP + +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDDQFPLKDVEALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+ +P+ +      D+ D Q RFI  TF   +   + + N Y P G      
Sbjct: 61  GHYGVALLSREKPLSLHKGFASDEEDAQRRFIWGTFADRDGTPVTVMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  +          + +  +P++  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYSDLQALLEGQFQNGQPVLVMGDMNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+  G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKGWGLVDSFRHLNPEVADRFSWFDYRSRGFEDEPKRGLRIDLIMASQGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              L +A +D + RG  KPSDH P+ + L
Sbjct: 241 LPRLKAAGVDYELRGMEKPSDHAPIWLEL 269


>gi|184199810|ref|YP_001854017.1| exodeoxyribonuclease III [Kocuria rhizophila DC2201]
 gi|183580040|dbj|BAG28511.1| exodeoxyribonuclease III [Kocuria rhizophila DC2201]
          Length = 268

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 74/268 (27%), Positives = 128/268 (47%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIRAR   + AW+  ++ D++ +QETK +D+NFP+E  +   Y +   G  
Sbjct: 1   MRIATWNVNSIRARADRIEAWLDRSDVDVLAIQETKAKDENFPWELFEFAGYEVAHFGVN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDD----LDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
            +NGVAI S+    ++    P          +              +R+ +LY+P+G  +
Sbjct: 61  QWNGVAIASRVGLTDVQRTFPDQPTFGKPGQEPAQEARAIGATCGGVRVWSLYVPNGRGL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIF--AGDYNIIPQPHDCYNPIIWENDACFT- 176
                  K+ W++     A Q L+ +        GD+N+ PQ  D ++  +++       
Sbjct: 121 DDPHMPYKLEWLRVLEGHAKQWLQEDPDAQIALVGDWNVAPQDDDVWDIQLFKEGGYTHV 180

Query: 177 --LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
              E       +++ G+ D +R  H    +Y++WDY    + K +G+RID  + SP   +
Sbjct: 181 SEPERAAFHAFIEDAGYQDVVRPRHPGPGVYTYWDYKQLRFPKKEGMRIDFQLCSPALAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            +  A ID   R     SDH PV++ +D
Sbjct: 241 RVQDAWIDRDERKGKGASDHAPVVIEID 268


>gi|50121263|ref|YP_050430.1| exonuclease III [Pectobacterium atrosepticum SCRI1043]
 gi|49611789|emb|CAG75238.1| exodeoxyribonuclease III [Pectobacterium atrosepticum SCRI1043]
          Length = 268

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 88/268 (32%), Positives = 128/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKVVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSKYGYHVYYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L K +P+E+    P D+ D Q R I A F     TL + N Y P G       
Sbjct: 61  GHYGVALLCKEKPLEVRLGFPTDEEDAQRRIIMADFATEHGTLTVVNGYFPQGENRDHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q     +PLI  GD NI           +     +      F 
Sbjct: 121 KFPAKTRFYQDLQTYLEQHHSATQPLIVMGDVNISATDLDIGIGEESRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +LQ  G  D  RA +   +  +S++DY +  +  N+G+RID I+ S      
Sbjct: 181 PEEREWMARLQGWGLIDTFRAANPEGNDRFSWFDYRSSGFDDNRGLRIDLILASTFLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   RG  KPSDH P+     +
Sbjct: 241 CVATGIDYDIRGMEKPSDHAPIWAEFTL 268


>gi|319896463|ref|YP_004134656.1| exodeoxyribonuclease iii [Haemophilus influenzae F3031]
 gi|317431965|emb|CBY80313.1| exodeoxyribonuclease III [Haemophilus influenzae F3031]
          Length = 267

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 80/267 (29%), Positives = 127/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  +    P D+   Q R I A        L + N Y P G      T
Sbjct: 61  GHYGVALLTKQEPKVVRRGFPTDNEGAQKRIIMADLETEFGLLTVINGYFPQGESRAHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R  +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDDNRGLRIDHILVSRKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|145629100|ref|ZP_01784899.1| exodeoxyribonuclease III [Haemophilus influenzae 22.1-21]
 gi|145639670|ref|ZP_01795273.1| exodeoxyribonuclease III [Haemophilus influenzae PittII]
 gi|144978603|gb|EDJ88326.1| exodeoxyribonuclease III [Haemophilus influenzae 22.1-21]
 gi|145271227|gb|EDK11141.1| exodeoxyribonuclease III [Haemophilus influenzae PittII]
 gi|309750640|gb|ADO80624.1| Exodeoxyribonuclease III [Haemophilus influenzae R2866]
          Length = 267

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 128/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  +    P D+ D Q R I A        L + N Y P G      T
Sbjct: 61  GHYGVALLTKQKPKVVRRGFPTDNEDAQKRIIMADLETEFGLLTVINGYFPQGESRAHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R  +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDDNRGLRIDHILVSQKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|330875089|gb|EGH09238.1| exonuclease III [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 270

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 89/269 (33%), Positives = 135/269 (50%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPLADVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD + Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNPPLALHKGFEGDDEESQKRFIRGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +            ++PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQALLEGHFSNDQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRYLYPEVSDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D   RG  KPSDH P+ + L
Sbjct: 241 QPRIKAAGVDYDLRGMEKPSDHAPIWLEL 269


>gi|319791365|ref|YP_004153005.1| exodeoxyribonuclease iii xth [Variovorax paradoxus EPS]
 gi|315593828|gb|ADU34894.1| exodeoxyribonuclease III Xth [Variovorax paradoxus EPS]
          Length = 263

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 107/265 (40%), Positives = 159/265 (60%), Gaps = 5/265 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M ++ +AT+NVN I +R+  L  W+ E+ PD+ CLQE K+ D   P + ++   Y I   
Sbjct: 1   MPLMKIATFNVNGINSRLARLLEWLDESKPDVACLQELKSPDAALPVDAIRGAGYGIVAH 60

Query: 61  GQKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ+++NGVAIL++  +PI+    LPG + D Q+R+IEA        + +G LYLP+GNP 
Sbjct: 61  GQRAWNGVAILARGREPIDTGRGLPGMEADTQSRYIEAVVGG----VLVGCLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K+D K+ W + F R A +      P++ AGDYN++P   D YNP  W +DA    E 
Sbjct: 117 PGPKFDYKLQWFEAFNRHAKKLFSSGMPVVLAGDYNVVPTDADIYNPASWRDDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R +F +L   G+TDAIRATH     ++FW Y+ + + ++ G+RIDH++L+ E   +L SA
Sbjct: 177 RAAFAQLLKQGWTDAIRATHPDRVPFTFWTYWRNRYPRDAGLRIDHLLLNAELAPMLRSA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIP 264
            +D   RG T  SDH P  + LDI 
Sbjct: 237 GVDRDVRGRTGASDHAPAWIELDIS 261


>gi|158338364|ref|YP_001519541.1| exodeoxyribonuclease III [Acaryochloris marina MBIC11017]
 gi|158308605|gb|ABW30222.1| exodeoxyribonuclease III [Acaryochloris marina MBIC11017]
          Length = 268

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 88/264 (33%), Positives = 139/264 (52%), Gaps = 5/264 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNSIR R+ ++  W+   + D++CLQETK  D++FP  + +   Y +   GQK
Sbjct: 1   MKIASWNVNSIRTRLEHVLDWLYTQSIDVLCLQETKVIDEDFPKASFEEEGYQVYVSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTL----RIGNLYLPHGNPI 119
           +YNGVA++S+    E+ +           +  +    + T  +    RI NLY+P+G+ I
Sbjct: 61  AYNGVALISRTTLSEVSSGFTPLLGPDLTQHYDQQKRLITGIISPGVRILNLYVPNGSEI 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLI-FAGDYNIIPQPHDCYNPIIWENDACFTLE 178
            S KY  K+ W++    +  + L  +   +   GD+NI     D ++P   E     T  
Sbjct: 121 DSDKYVYKLEWLELLHHYVEKLLSQDPQHLLICGDFNIALDDRDMHDPSKREAHIMSTDR 180

Query: 179 VRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHS 238
            RQ+ QK+  +G  D  R  +     +S+W+Y A S+ +NKG RIDH  L+P       +
Sbjct: 181 ERQALQKVLALGLEDVFRKFNSKSEQFSWWNYRAGSFQRNKGWRIDHHYLTPTLYEQATA 240

Query: 239 ARIDTKPRGWTKPSDHTPVIVSLD 262
             ID  PR   KPSDH PV+V +D
Sbjct: 241 CTIDAAPRRLPKPSDHAPVVVEID 264


>gi|148825679|ref|YP_001290432.1| exonuclease III [Haemophilus influenzae PittEE]
 gi|148715839|gb|ABQ98049.1| exodeoxyribonuclease III [Haemophilus influenzae PittEE]
          Length = 267

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 128/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  +      D+ D Q R I A        L + N Y P G   T  T
Sbjct: 61  GHYGVALLTKQEPKAVRRGFSTDNEDAQKRIIMADLETEFGLLTVINGYFPQGESRTHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R  +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDDNRGLRIDHILVSQKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|227111460|ref|ZP_03825116.1| exonuclease III [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 268

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 90/268 (33%), Positives = 128/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKVVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSQYGYHVYYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L K QPI +    P D+ D Q R I A F     TL + N Y P G       
Sbjct: 61  GHYGVALLCKTQPIAVRRGFPTDEDDAQRRIIMADFATEHGTLTVVNGYFPQGESRDHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q     +PLI  GD NI P         +     +      F 
Sbjct: 121 KFPAKTRFYQDLQTYLEQHHSATQPLIVMGDVNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +LQ  G  D  RA +   +  +S++DY +  +  N+G+RID I+ S      
Sbjct: 181 PEEREWMARLQRWGLIDTFRAANPDSNDRFSWFDYRSAGFDDNRGLRIDLILASTFLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   RG  KPSDH P+     +
Sbjct: 241 CVATGIDYDIRGMEKPSDHAPIWAQFSL 268


>gi|145633402|ref|ZP_01789132.1| exodeoxyribonuclease III [Haemophilus influenzae 3655]
 gi|145635225|ref|ZP_01790929.1| exodeoxyribonuclease III [Haemophilus influenzae PittAA]
 gi|229845387|ref|ZP_04465518.1| exonuclease III [Haemophilus influenzae 6P18H1]
 gi|229846960|ref|ZP_04467066.1| exonuclease III [Haemophilus influenzae 7P49H1]
 gi|144985965|gb|EDJ92567.1| exodeoxyribonuclease III [Haemophilus influenzae 3655]
 gi|145267504|gb|EDK07504.1| exodeoxyribonuclease III [Haemophilus influenzae PittAA]
 gi|229810044|gb|EEP45764.1| exonuclease III [Haemophilus influenzae 7P49H1]
 gi|229811695|gb|EEP47393.1| exonuclease III [Haemophilus influenzae 6P18H1]
 gi|309972825|gb|ADO96026.1| Exodeoxyribonuclease III [Haemophilus influenzae R2846]
          Length = 267

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 128/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  +    P D+ D Q R I A        L + N Y P G      T
Sbjct: 61  GHYGVALLTKQEPKVVRRGFPTDNEDAQKRIIMADLETEFGLLTVINGYFPQGESRAHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R  +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDDNRGLRIDHILVSQKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|254251949|ref|ZP_04945267.1| Exonuclease III [Burkholderia dolosa AUO158]
 gi|124894558|gb|EAY68438.1| Exonuclease III [Burkholderia dolosa AUO158]
          Length = 281

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 82/257 (31%), Positives = 137/257 (53%), Gaps = 1/257 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ +P   L+++ Y     GQK
Sbjct: 24  MKIATWNVNSLNVRKQHVLDWLAQSGADVLCLQELKLPDEKYPRADLEAVGYRSWFTGQK 83

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++   + +       ++       +    +  + +RI + Y P+G  + S K
Sbjct: 84  TYNGVAILARNT-LTVDESDVVRNIPGFDDPQQRVVAVTVEGVRIVSAYFPNGQAVDSDK 142

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     + +  ++    L   GD+NI P+  D ++P  WE     + + R  F
Sbjct: 143 FVYKMQWLDALHAWLAAEMQRYPKLALLGDFNIAPEDRDVHDPAKWEGQNLVSPQERAHF 202

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            KL  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 203 AKLIELGFVDAFRRFEQPEKTFTWWDYRMFAFRRNAGLRIDHILLSPALADTCTSCVVDR 262

Query: 244 KPRGWTKPSDHTPVIVS 260
            PR W +PSDHTPV+ +
Sbjct: 263 APRTWEQPSDHTPVVAT 279


>gi|330965345|gb|EGH65605.1| exonuclease III [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 270

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 89/269 (33%), Positives = 135/269 (50%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPLADVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD + Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRSPPLALHKGFEGDDEESQKRFIRGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +            ++PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQALLEGHFSNDQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRYLYPEVSDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D   RG  KPSDH P+ + L
Sbjct: 241 QPRIKAAGVDYDLRGMEKPSDHAPIWLEL 269


>gi|148827197|ref|YP_001291950.1| exonuclease III [Haemophilus influenzae PittGG]
 gi|148718439|gb|ABQ99566.1| exodeoxyribonuclease III [Haemophilus influenzae PittGG]
          Length = 267

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 128/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  +    P D+ D Q R I A        L + N Y P G      T
Sbjct: 61  GHYGVALLTKQEPKVVRRGFPTDNEDAQKRIIMADLETEFGLLTVINGYFPQGESRAHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R  +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEERAWYQRLYDYGLEDSFRNLNPTANDKFSWFDYRSKGFDDNRGLRIDHILVSQKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|317506931|ref|ZP_07964703.1| exodeoxyribonuclease III [Segniliparus rugosus ATCC BAA-974]
 gi|316254859|gb|EFV14157.1| exodeoxyribonuclease III [Segniliparus rugosus ATCC BAA-974]
          Length = 267

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 76/265 (28%), Positives = 126/265 (47%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NSIRAR+    +W++ +  D++ LQETK  D  FP E  +   Y +   G  
Sbjct: 1   MRIATWNINSIRARVDRAVSWLERSQVDVLALQETKCADAQFPEEPFREAGYAVAHTGNG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIE-----ATFTINTQTLRIGNLYLPHGNP 118
            +NGVAI+S+    ++     G     +    E              +RI +LY+P+G  
Sbjct: 61  QWNGVAIVSRLGLADVQVGFDGQPGFHKDPEAEALPEPRAIAATCGGVRIWSLYVPNGRD 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRL--ELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           +    Y  K+ W+      A   L  + +  +   GD+NI P   D ++P  ++     +
Sbjct: 121 LADRHYGYKLEWLAALRGQAEGWLAADADAKIALTGDWNIAPFDEDVWDPSFFDGKTHTS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R +F   +  GFTD  R       +Y++WDY    + + +G+RID ++ SP   + +
Sbjct: 181 GPERDAFFAFEKSGFTDVARPHTPGPGVYTYWDYTQLRFPRREGMRIDFVLGSPALAASV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
             A +D + R     SDH PV+V L
Sbjct: 241 TGASVDREERKGKGASDHAPVVVEL 265


>gi|222110327|ref|YP_002552591.1| exodeoxyribonuclease iii xth [Acidovorax ebreus TPSY]
 gi|221729771|gb|ACM32591.1| exodeoxyribonuclease III Xth [Acidovorax ebreus TPSY]
          Length = 258

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 93/258 (36%), Positives = 141/258 (54%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS+  R+  + AW++ N  D I LQE K  D+ FP +  ++  YH    GQK
Sbjct: 1   MQIATWNINSLSVRLPQVLAWLEANPVDAIGLQELKLVDEKFPHDAFEAAGYHAVCFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+    ++V ++PG   +       AT       LR+ N Y  +G    + K
Sbjct: 61  TYNGVAILSRTPLRDVVRNIPGHGDEQARVI-AATLDTPEGPLRLVNCYFVNGQAPGTEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++    +    L     L+  GD+N+ P+  D ++P+  ++    T+E RQ F
Sbjct: 120 FSYKLLWLEALRDWLRTELAAHPRLVLVGDFNVAPEDRDSFDPVGLKDTIHHTVEERQHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G TDA R        YS+WDY    + KN+G+RIDHI++S      + + RID 
Sbjct: 180 QDLLGLGLTDAFRLFDQPEKSYSWWDYRMLGFQKNRGLRIDHILVSTALRPSVTACRIDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV+VSL
Sbjct: 240 APRKNPQPSDHAPVVVSL 257


>gi|15597741|ref|NP_251235.1| exonuclease III [Pseudomonas aeruginosa PAO1]
 gi|218891476|ref|YP_002440343.1| exonuclease III [Pseudomonas aeruginosa LESB58]
 gi|9948603|gb|AAG05933.1|AE004682_5 exodeoxyribonuclease III [Pseudomonas aeruginosa PAO1]
 gi|218771702|emb|CAW27476.1| exodeoxyribonuclease III [Pseudomonas aeruginosa LESB58]
          Length = 270

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 88/269 (32%), Positives = 131/269 (48%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+ + PD+I LQETK  D  FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIERHQPDVIGLQETKVADDQFPQAEIEALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+E+    P D  + Q RFI  TF       + + N Y P G      
Sbjct: 61  GHYGVALLSRQAPLELHRGFPSDGEESQRRFIWGTFSDAQGNPITVMNGYFPQGENREHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+  K  +            + E+ L+  GD NI P+  D           +      F
Sbjct: 121 TKFPAKQRFYADLQSLLENSFKPEQALVVMGDINISPEDCDIGIGEENRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKN--KGIRIDHIMLSPEA 232
             E R+    L+N G  D+ RA +   +  +S++DY +  +  N  +G+RID I+ S   
Sbjct: 181 LPEEREWLATLKNWGLVDSFRALNPEVNDRFSWFDYRSRGFEDNPKRGLRIDVILASRVL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
            S    A ID   RG  KPSDH P+ + L
Sbjct: 241 QSRFKDAGIDYDLRGMEKPSDHAPIWLEL 269


>gi|84516350|ref|ZP_01003710.1| exodeoxyribonuclease III [Loktanella vestfoldensis SKA53]
 gi|84510046|gb|EAQ06503.1| exodeoxyribonuclease III [Loktanella vestfoldensis SKA53]
          Length = 259

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 119/258 (46%), Positives = 162/258 (62%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N ++ARI  L  W+ ++ PD+  LQE K+ D  FP + ++   Y +ET GQK
Sbjct: 1   MKIATFNINGVKARIETLCDWLDDSAPDVAILQEIKSVDDGFPRQLIEDRGYTLETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK    ++   LPGDD D QAR+IEAT  +    +RI  LYLP+GNP    K
Sbjct: 61  GFNGVAILSKLPLEDVTRGLPGDDADEQARWIEAT-VVGDVAVRICGLYLPNGNPAPGPK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W++R L  A+  L  E P + AGDYNIIPQ  D   P +W +DA F  E R ++
Sbjct: 120 FDYKLAWMERLLARATALLADEMPALMAGDYNIIPQGMDAARPQVWRDDALFRPESRAAY 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GFT+A R        YSFWDY A +W KN GIRIDH +L+P+   LL  A I+ 
Sbjct: 180 RRILNLGFTEAFRTLEPGAGHYSFWDYQAGAWEKNNGIRIDHFLLTPQCADLLAGAWIEK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R   KPSDH PV V L
Sbjct: 240 DLRARDKPSDHVPVWVEL 257


>gi|90417808|ref|ZP_01225720.1| exodeoxyribonuclease III [Aurantimonas manganoxydans SI85-9A1]
 gi|90337480|gb|EAS51131.1| exodeoxyribonuclease III [Aurantimonas manganoxydans SI85-9A1]
          Length = 276

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 107/259 (41%), Positives = 159/259 (61%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N +  R+  L  W+ E  PD +CLQE K+ D+ FP + ++   Y     GQK
Sbjct: 1   MKIASFNINGVNGRLPVLLRWLAEAEPDAVCLQELKSPDEKFPIDAIREAGYGAIWHGQK 60

Query: 64  SYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           S+NGVAIL++   P+E    LPGDD D Q+R++EA        + IG LYLP+GNP    
Sbjct: 61  SWNGVAILARGTDPLETRRGLPGDDDDHQSRYLEAAVKG----VLIGCLYLPNGNPAPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W+ RF   A+  +    P++ AGDYN+IP   D Y P  W +DA F  EVR++
Sbjct: 117 KFDYKLRWLGRFANHAADLMATGAPVVLAGDYNVIPTELDVYKPEHWVDDALFRPEVREA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F +L + G+TDAIR+ H    +Y+FWDY  ++W ++ G+R+DH++LSP     L +A + 
Sbjct: 177 FHRLLDAGWTDAIRSLHPEASIYTFWDYLRNAWGRDAGLRLDHLLLSPTLAPRLLAAGVH 236

Query: 243 TKPRGWTKPSDHTPVIVSL 261
              RGW K SDH PV + +
Sbjct: 237 RDVRGWEKASDHAPVWIEI 255


>gi|311112410|ref|YP_003983632.1| exodeoxyribonuclease III [Rothia dentocariosa ATCC 17931]
 gi|310943904|gb|ADP40198.1| exodeoxyribonuclease III [Rothia dentocariosa ATCC 17931]
          Length = 335

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 75/265 (28%), Positives = 123/265 (46%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIRAR   +  W+ +   D++ LQETKT+D+ FPFE  + L Y +   G  
Sbjct: 69  MKIATWNVNSIRARADRIEDWLDKTEVDVLALQETKTKDETFPFELFEFLGYEVAHYGLN 128

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLD----VQARFIEATFTINTQTLRIGNLYLPHGNPI 119
            +NGVAI S+     +    P           A             +RI +LY+P+G  +
Sbjct: 129 QWNGVAIASRVGLDSVERTFPNQPAFGKPGDPAEIEARAIGATCNGVRIWSLYVPNGRGL 188

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACFTL 177
           T      K+ W+++     +  L  +        GD+N+ P+  D ++   +  +    +
Sbjct: 189 TDPHMAYKMEWMRQLRTNVNGWLHADPAAQFALVGDWNVAPEDTDVWDIDFFRENDLTHV 248

Query: 178 EVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              +       +     +          Y++WDY A  +SKN+G+RID  + SP   + +
Sbjct: 249 SAPEREAFYALLNDEGLVDPVRPYTQGEYTYWDYQAGRFSKNEGMRIDFQLCSPALAARV 308

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
            +A ID + R     SDHTPV++ L
Sbjct: 309 ENAWIDREEREGDGASDHTPVVIEL 333


>gi|290512900|ref|ZP_06552264.1| exodeoxyribonuclease III [Klebsiella sp. 1_1_55]
 gi|289774513|gb|EFD82517.1| exodeoxyribonuclease III [Klebsiella sp. 1_1_55]
          Length = 301

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 81/268 (30%), Positives = 125/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H LAA ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 32  ATMKFVSFNINGLRARPHQLAAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 91

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G     
Sbjct: 92  QKGHYGVALLTKDTPIAVRRGFPDDGEEAQRRIIMAEIPSPFGNVTVINGYFPQGESRDH 151

Query: 122 -TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
            TK+  K ++ +    +    L  E P++  GD NI P         +     +      
Sbjct: 152 ETKFPAKAAFYQNLQNYLETELNKENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCS 211

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 212 FLPEEREWMDRLLGWGLVDTWRQANPDNQEHFSWFDYRSKGFDDNRGLRIDLLLASQPLA 271

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + RG  KPSDH PV  + 
Sbjct: 272 QRCVETGIDYEIRGMEKPSDHAPVWATF 299


>gi|302382037|ref|YP_003817860.1| exodeoxyribonuclease III Xth [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192665|gb|ADL00237.1| exodeoxyribonuclease III Xth [Brevundimonas subvibrioides ATCC
           15264]
          Length = 257

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 91/258 (35%), Positives = 139/258 (53%), Gaps = 3/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I +R+ NL  W+    PD+ CLQE K     FP   ++   YH    G+ 
Sbjct: 1   MRIATFNINGINSRLPNLLEWLAGTQPDVACLQELKAPQDRFPEGAIEEAGYHAAWVGEA 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILS++ P  +           +              + +G LYLP+GNP    K
Sbjct: 61  RWNGVAILSRHGPPVVTRRAL---PGDRKDVQSRYLEAAVNGVLVGCLYLPNGNPQPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W +R +  A    + E P++ AGDYN++P   D Y+   W+ +A    E R +F
Sbjct: 118 FDYKLAWFERLIAHAGTLFDTEAPVVLAGDYNVVPTEADIYDSRSWKKNALLQPESRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            ++ + G+TDA+R       +Y+FWDY  D WS+N G+RIDH++L+P+A   L  A +D 
Sbjct: 178 ARMLDDGWTDALRERFPHEAVYTFWDYLRDGWSRNAGLRIDHLLLNPQAAGRLVDAGVDA 237

Query: 244 KPRGWTKPSDHTPVIVSL 261
             RG  K SDH P  + L
Sbjct: 238 GVRGREKASDHAPAWIEL 255


>gi|28869934|ref|NP_792553.1| exodeoxyribonuclease III [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28853179|gb|AAO56248.1| exodeoxyribonuclease III [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 270

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 90/269 (33%), Positives = 135/269 (50%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPLADVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD + Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNPPLALHKGFEGDDEESQKRFIRGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +            E+PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQALLEGHFSNEQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRYLYPEVSDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D   RG  KPSDH P+ + L
Sbjct: 241 QPRIRAAGVDYDLRGMEKPSDHAPIWLEL 269


>gi|56460559|ref|YP_155840.1| exonuclease III [Idiomarina loihiensis L2TR]
 gi|56179569|gb|AAV82291.1| Exonuclease III [Idiomarina loihiensis L2TR]
          Length = 269

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 84/268 (31%), Positives = 132/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N IRAR+H L A I ++ PD+I LQETK  D  FP + ++++ YH+   GQK
Sbjct: 1   MKIISFNINGIRARLHQLQAVIDKHQPDVIGLQETKVHDDQFPLKDVEAMGYHVIYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTI-NTQTLRIGNLYLPHGNPITST 122
            + GVA+LSK          P DD + Q R I   + + +   +RI N Y P G      
Sbjct: 61  GHYGVAMLSKKPLENPQFGFPTDDDEAQRRMIMGDYPLADGGHVRILNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
            K+  K  + +  + +    L  E+P+I  GD NI           +     +      F
Sbjct: 121 TKFPAKEKFYQDLMSYLDNDLSPEQPVIVMGDVNISRIDLDIGIGENNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q+L + GFTD  R  +    + +S++DY +  +  N+G+RID I+ +     
Sbjct: 181 LPEEREWIQRLMDWGFTDTYRQLNPDVDNQFSWFDYRSRGFDDNRGLRIDLILATKALAK 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH PV  +  
Sbjct: 241 QCEDSGIDYELRGIEKPSDHAPVWSTFK 268


>gi|182678385|ref|YP_001832531.1| exodeoxyribonuclease III [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182634268|gb|ACB95042.1| exodeoxyribonuclease III [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 258

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 127/258 (49%), Positives = 165/258 (63%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NSIR R  +L  ++ E  PDI+CLQE K  D  FPF  +++  YH    GQK
Sbjct: 1   MQIATWNINSIRQRTEHLLRYLDEVAPDIVCLQELKCTDDAFPFAAIEAKGYHAAVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK   IE+   LPGD  D  AR++E         LRI +LYLP+GNP  + K
Sbjct: 61  GFNGVAILSKQP-IEVKCGLPGDSTDEHARYVEGVIDSEIGRLRIVSLYLPNGNPPDTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+ R +  AS  L+ EE L+ AGDYN+IP P DCY+P +W  DA F    R  F
Sbjct: 120 YTYKLAWMDRLIAHASTLLQCEELLVLAGDYNVIPMPGDCYDPAVWATDALFLPPTRARF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L N+GFT+A+RA  D   LY+FWDY A +W +NKGI IDH++LSP+A   L    ID 
Sbjct: 180 RSLLNLGFTNALRAVSDEPGLYTFWDYQAGAWQRNKGICIDHLLLSPQAVDHLQHVVIDK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + RG  KPSDH PV V+L
Sbjct: 240 ERRGEDKPSDHVPVRVTL 257


>gi|182435048|ref|YP_001822767.1| putative exonuclease [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|178463564|dbj|BAG18084.1| putative exonuclease [Streptomyces griseus subsp. griseus NBRC
           13350]
          Length = 259

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 77/260 (29%), Positives = 127/260 (48%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVNSI AR+  L AW++ +  D++C+QETK   + FP E L+   Y        
Sbjct: 1   MRIATYNVNSITARLPRLLAWLESSGTDVLCVQETKCTAEQFPAEALREAGYASAVNATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++VT LP        +   A        LR+ ++Y+P+G  +    
Sbjct: 61  RWNGVALLSRVGLSDVVTGLPDGPEYEGVQEPRAISATCGP-LRLWSVYVPNGREVEHAH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++   +  +       P    GD+N+ P   D ++P ++E     T   R + 
Sbjct: 120 YAYKLRWLEALRKAVAADAAKALPFAVLGDFNVAPTDEDVWDPALFEGATHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G ++           Y+FWDY    + KNKG+RID    +   T+ +  + +D 
Sbjct: 180 AALEAEGLSEVHPRPLKYDRAYTFWDYRELRFPKNKGMRIDLTFGNAPFTAAVKDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDL 259


>gi|331673295|ref|ZP_08374063.1| exodeoxyribonuclease III [Escherichia coli TA280]
 gi|331069493|gb|EGI40880.1| exodeoxyribonuclease III [Escherichia coli TA280]
          Length = 272

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 125/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPITVRRGFPGDDEEAQRRIIMAEIPSTLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ E P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|271500687|ref|YP_003333712.1| exodeoxyribonuclease III [Dickeya dadantii Ech586]
 gi|270344242|gb|ACZ77007.1| exodeoxyribonuclease III [Dickeya dadantii Ech586]
          Length = 268

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 87/268 (32%), Positives = 132/268 (49%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP + ++   YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAVIEQHQPDVIGLQETKVHDDMFPLDDVKQFGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K +P+ +    P DD D Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVALLTKAEPLAVRRGFPTDDEDAQRRIIMADLATPLGTLTVVNGYFPQGESRDHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q  + ++P++  GD NI P         D     +      F 
Sbjct: 121 KFPAKTRFYQDLQHYLEQHHQADQPVLIMGDMNISPTDLDIGIGEDNRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L+N G  D  RA +      +S++DY +  +  N+G+RID IM +    S 
Sbjct: 181 PEEREWMERLKNWGLVDTFRAANPECQDKFSWFDYRSSGFDDNRGLRIDLIMATSPLASR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   RG  KPSDH PV     +
Sbjct: 241 CTATGIDYAIRGMEKPSDHAPVWAEFTL 268


>gi|94969020|ref|YP_591068.1| exodeoxyribonuclease III (xth) [Candidatus Koribacter versatilis
           Ellin345]
 gi|94551070|gb|ABF40994.1| exodeoxyribonuclease III (xth) [Candidatus Koribacter versatilis
           Ellin345]
          Length = 260

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 108/257 (42%), Positives = 157/257 (61%), Gaps = 7/257 (2%)

Query: 6   VATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQKSY 65
           +A+WNVNSIRAR+  ++ WI +N+PD++ +QE K  +  FP E   +L Y      QK+Y
Sbjct: 9   IASWNVNSIRARLGIVSDWIAKNHPDVLLMQELKATE--FPAEAFHALGYQAAAVTQKAY 66

Query: 66  NGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTKYD 125
           NGVA+LS+     + T L GD+ D  AR++E         LR+ N+Y P+GNPI + K+ 
Sbjct: 67  NGVAVLSRLPVETVRTALRGDEADSHARYLETRIDG----LRVVNIYAPNGNPIGTEKFS 122

Query: 126 DKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSFQK 185
            K++W+ R ++     L+ + P + AGDYNIIP+  DC+ P  W  DA F  E R+ ++ 
Sbjct: 123 YKLAWLDRLIQEMQSWLKDDIPTVVAGDYNIIPEDIDCHKPSSWIRDALFQPEPRERYRA 182

Query: 186 LQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDTK 244
           L  MG+TDA R  H      ++FWDY+  ++  N+GIRIDH +LSP     L    IDT+
Sbjct: 183 LLAMGYTDAFRTLHPGETGQFTFWDYFRKAFETNRGIRIDHFLLSPSLKPRLAKCHIDTE 242

Query: 245 PRGWTKPSDHTPVIVSL 261
           PR   KPSDHTP+++ L
Sbjct: 243 PRKLEKPSDHTPIVLEL 259


>gi|330960959|gb|EGH61219.1| exonuclease III [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 270

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 92/269 (34%), Positives = 138/269 (51%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIEKHQPDVIGLQETKVSDEQFPHADIEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+E+     GD+ D Q RFI   +   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNPPLELHKGFEGDNEDAQKRFIRGAYADSNGQPIIIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +   +    R   E+PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYEDLQQLLESRFSNEQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  H      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGMVDSFRYLHPEVSDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D   RG  KPSDH P+ + L
Sbjct: 241 QPRIKAAGVDYDLRGMEKPSDHAPIWLEL 269


>gi|167034007|ref|YP_001669238.1| exodeoxyribonuclease III Xth [Pseudomonas putida GB-1]
 gi|166860495|gb|ABY98902.1| exodeoxyribonuclease III Xth [Pseudomonas putida GB-1]
          Length = 265

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 100/262 (38%), Positives = 152/262 (58%), Gaps = 5/262 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  + +AT+N+N IR+R+  L AW++   PDI CLQE K  ++ FP E +++  Y     
Sbjct: 1   MKALKIATFNINGIRSRLPALLAWLEREQPDIACLQELKAANQQFPREAIEAAGYGCLYQ 60

Query: 61  GQKSYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ S+NGVAIL++  +P+E+   LPG   D Q+R++EA        + +G LYLP+GNP 
Sbjct: 61  GQPSWNGVAILARDSEPLEVRRGLPGMQDDQQSRYLEAAV----HGVLVGCLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K+D K+ W +  ++ A        P + AGD+N++P   D Y+P  W  DA    E 
Sbjct: 117 PGPKFDYKLRWFECLIKHAQTLHVSRHPTVLAGDFNVVPTDLDIYSPRSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R  F+ L   G+ DA+R  +    +Y+FWDY+ + W++N G+RIDH++L+P  +  L  A
Sbjct: 177 RACFEALLAQGWVDAVRHLYPEQRIYTFWDYFRNHWARNAGLRIDHLLLNPGLSPYLKGA 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            +D   R   K SDH PV + L
Sbjct: 237 GVDAWVRNEAKASDHAPVWIQL 258


>gi|187478127|ref|YP_786151.1| exodeoxyribonuclease III [Bordetella avium 197N]
 gi|115422713|emb|CAJ49240.1| exodeoxyribonuclease III [Bordetella avium 197N]
          Length = 261

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 94/261 (36%), Positives = 134/261 (51%), Gaps = 1/261 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+  N  D +CLQE K  D  FP E    + YH    GQK
Sbjct: 1   MQLATWNVNSLKVRLPQVIDWLNANPVDALCLQELKLADDKFPLEAFTEIGYHAAWAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+     +  ++PG +   Q      T       +R+ + Y P+G  + S K
Sbjct: 61  TYNGVAILSREPGFALTRNIPGYEDPQQRVI-AVTLPSPAGDVRVISAYCPNGQSLDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W      +  + L     L   GDYN+ P   D +NP  WE     +   RQ+F
Sbjct: 120 YPYKLEWFGALRHWLEEELRTYPRLAILGDYNVAPADEDVHNPEKWEGQVLVSAPERQAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TDA R        +S+WDY    + +N G+RIDHI+LS        +  ID 
Sbjct: 180 QALLDLGLTDAFRLFAQPEKSFSWWDYRMFGFRRNAGLRIDHILLSDALKPTCVACIIDK 239

Query: 244 KPRGWTKPSDHTPVIVSLDIP 264
            PRG  +PSDHTPV+ +L + 
Sbjct: 240 GPRGNEQPSDHTPVVTTLKLS 260


>gi|330824047|ref|YP_004387350.1| exodeoxyribonuclease III Xth [Alicycliphilus denitrificans K601]
 gi|329309419|gb|AEB83834.1| exodeoxyribonuclease III Xth [Alicycliphilus denitrificans K601]
          Length = 258

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 92/258 (35%), Positives = 143/258 (55%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS+  R+  + AW+  N  D I LQE K  D+ FP +  ++  YH    GQK
Sbjct: 1   MHLATWNINSLSVRLPQVLAWLVANPVDAIGLQELKLVDEKFPHDAFEAAGYHAVCFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++V ++PG D +       AT  +    LR+ N Y  +G    + K
Sbjct: 61  TYNGVAIVSRTPPRDVVRNIPGHDDEQARVI-AATLDVEGGPLRLVNCYFVNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L     L+  GD+N+ P+  D Y+P+  ++    T+E RQ F
Sbjct: 120 FAYKLQWLAALHDWLRAELAAHPRLVLVGDFNVAPEDRDSYDPVGLKDTIHHTVEERQHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L  +G TDA R        YS+WDY    + KN+G+RIDHI++S    + + + RID 
Sbjct: 180 RQLLELGLTDAFRMFEQPEKSYSWWDYRQLGFQKNRGLRIDHILVSEALRAGVTACRIDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV+ +L
Sbjct: 240 APRKNPQPSDHAPVVATL 257


>gi|161524301|ref|YP_001579313.1| exodeoxyribonuclease III Xth [Burkholderia multivorans ATCC 17616]
 gi|221214798|ref|ZP_03587767.1| exodeoxyribonuclease III [Burkholderia multivorans CGD1]
 gi|160341730|gb|ABX14816.1| exodeoxyribonuclease III Xth [Burkholderia multivorans ATCC 17616]
 gi|221165337|gb|EED97814.1| exodeoxyribonuclease III [Burkholderia multivorans CGD1]
          Length = 272

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 84/256 (32%), Positives = 133/256 (51%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ FP   L++  Y     GQK
Sbjct: 15  MKIATWNVNSLNVRKQHVLDWLAQSAVDVLCLQELKLPDEKFPRADLEAAGYRSWFAGQK 74

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       + +  +    +         +    +RI + Y P+G  + S K
Sbjct: 75  TYNGVAILARDTLPFDESDVVRNIPGFEDTQQRV-IAVTIDGVRIVSAYFPNGQAVGSDK 133

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    ++    L   GDYNI P+  D ++P  WE +   + + R  F
Sbjct: 134 FLYKMQWLDALHAWLRTEMQRYPKLALLGDYNIAPEDRDVHDPAKWEGENLVSPQERAHF 193

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            KL  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 194 AKLIELGFVDAFRRFEQPEKTFTWWDYRMFAFRRNAGLRIDHILLSPALAGSCTSCEVDR 253

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDHTPV+ 
Sbjct: 254 VPRTWEQPSDHTPVVA 269


>gi|308050255|ref|YP_003913821.1| exodeoxyribonuclease III [Ferrimonas balearica DSM 9799]
 gi|307632445|gb|ADN76747.1| Exodeoxyribonuclease III [Ferrimonas balearica DSM 9799]
          Length = 268

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 80/267 (29%), Positives = 131/267 (49%), Gaps = 9/267 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR+H L A I ++ PD+I LQETK +D  FP E ++++ YH+   GQK
Sbjct: 1   MKFVSFNINGLRARLHQLQALIDKHQPDVIGLQETKVDDPQFPLEAVEAMGYHVAFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHL-PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
            + GVA+L+K  P+ +       ++   +   +      N Q + + N Y P G      
Sbjct: 61  GHYGVAMLTKQVPLAVQKGFATDEEDAQRRMIMVTVADANGQPVHVLNGYFPQGENRDHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  +    +   +   + +E ++  GD NI P               +      F
Sbjct: 121 TKFPAKRRFYADLMSHLNTHRQADEQVVVMGDINISPTDLDIGIGEPNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTHHL-YSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+    L N G TD+ R  +      YS++DY +  +  N+G+RID I+ S   T+
Sbjct: 181 LPEEREWLATLLNWGLTDSFRHLNPEEAQTYSWFDYRSRGFDDNRGLRIDVILTSAPLTA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSL 261
            L SA +D + RG  KPSDH P+  ++
Sbjct: 241 RLDSAGVDYELRGIEKPSDHAPIWTTI 267


>gi|290956326|ref|YP_003487508.1| exonuclease [Streptomyces scabiei 87.22]
 gi|260645852|emb|CBG68943.1| putative exonuclease [Streptomyces scabiei 87.22]
          Length = 259

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 75/260 (28%), Positives = 124/260 (47%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++CLQE K  +  FP + L+   Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCLQEAKIAEDGFPLDALREAGYEAAVHATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA++S+    ++V  LPGD     +    A        +R+ ++Y+P+G  +    
Sbjct: 61  RWNGVAVISRVGIEDVVKGLPGDPGYDGSVEPRAISATCGP-VRVWSVYVPNGREVDHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W +      +       P    GDYN+ P   D Y+   +E     T   R + 
Sbjct: 120 YAYKLQWFEALKAAVAGDAAGSRPFAVMGDYNVAPTDDDVYDVAAFEGLTHVTPAERAAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G TD +       H +++WDY    + KN+G+RID +  +      +  + +D 
Sbjct: 180 ASLREAGLTDVVPRPLKYEHPFTYWDYRQLCFPKNRGMRIDLVYGNETFAKAVTDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V L++
Sbjct: 240 EERKGKGASDHAPVVVDLEV 259


>gi|209542628|ref|YP_002274857.1| exodeoxyribonuclease III Xth [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209530305|gb|ACI50242.1| exodeoxyribonuclease III Xth [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 258

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 98/259 (37%), Positives = 138/259 (53%), Gaps = 3/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+R R  ++  W++   PD++ LQE K ED  FP E  ++  Y     GQK
Sbjct: 1   MKIASWNVNSVRQRQAHVLDWLEREKPDLLGLQEIKCEDAAFPAEAFRAAGYDCVVVGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAILS+                           I    L  GNLYLP+GN   S  
Sbjct: 61  SYNGVAILSRLPFSVTAR---ALPFLDGEALQARYVEIEAGGLTFGNLYLPNGNSGGSAG 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y+ K+++++     A   LE     + AGDYN+ P   DC    +   DA    E R +F
Sbjct: 118 YEAKLAFMEALALHARALLEAGRDFVLAGDYNVCPTDEDCAPGALPPTDALVRPESRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L  +G TDA+RA H     Y+FWDY A +W ++ G+RIDH +LSP     L SA+ D 
Sbjct: 178 RRLIWLGLTDALRALHPHGRYYTFWDYQAGAWPRDCGLRIDHALLSPRIAERLDSAQPDR 237

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             RG  +PSDH P++++LD
Sbjct: 238 DERGRAQPSDHVPLVITLD 256


>gi|300898982|ref|ZP_07117271.1| exodeoxyribonuclease III [Escherichia coli MS 198-1]
 gi|300357379|gb|EFJ73249.1| exodeoxyribonuclease III [Escherichia coli MS 198-1]
          Length = 272

 Score =  206 bits (523), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 125/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSTLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ E P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|117623921|ref|YP_852834.1| exonuclease III [Escherichia coli APEC O1]
 gi|237705700|ref|ZP_04536181.1| exonuclease III [Escherichia sp. 3_2_53FAA]
 gi|301026483|ref|ZP_07189913.1| exodeoxyribonuclease III [Escherichia coli MS 69-1]
 gi|91072540|gb|ABE07421.1| exodeoxyribonuclease III [Escherichia coli UTI89]
 gi|115513045|gb|ABJ01120.1| exodeoxyribonuclease III [Escherichia coli APEC O1]
 gi|226900457|gb|EEH86716.1| exonuclease III [Escherichia sp. 3_2_53FAA]
 gi|300395501|gb|EFJ79039.1| exodeoxyribonuclease III [Escherichia coli MS 69-1]
 gi|315286456|gb|EFU45891.1| exodeoxyribonuclease III [Escherichia coli MS 110-3]
 gi|315299863|gb|EFU59103.1| exodeoxyribonuclease III [Escherichia coli MS 16-3]
          Length = 272

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 125/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ E P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|145641817|ref|ZP_01797392.1| exodeoxyribonuclease III [Haemophilus influenzae R3021]
 gi|145273439|gb|EDK13310.1| exodeoxyribonuclease III [Haemophilus influenzae 22.4-21]
          Length = 267

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 83/267 (31%), Positives = 128/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  I    P D+ D Q R I A        L I N Y P G      T
Sbjct: 61  GHYGVALLTKQEPKVIRRGFPTDNEDAQKRIIMADLETEFGLLTIINGYFPQGESRAHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R  +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDDNRGLRIDHILVSQKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|251773491|gb|EES54039.1| Exodeoxyribonuclease III [Leptospirillum ferrodiazotrophum]
          Length = 259

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 134/259 (51%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + VATWNVNS+  R+  +  WI   +PDI+CLQETK  D  FP E  +   Y +   GQ 
Sbjct: 1   MRVATWNVNSLPVRLPQVLDWIDRKSPDILCLQETKVPDSRFPAEPFRERGYDLLFRGQP 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+    + +   PG+                   LR+ NLY+P+G  + + K
Sbjct: 61  TYNGVAILSRRPLSDPLRDFPGEPDPECRLLAAT-----AGPLRLFNLYVPNGQDLDTPK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+ R              L+  GD+NI+P+  D Y+P+        +   R++ 
Sbjct: 116 YRYKLAWLDRLAALLDDERRRHPFLVLTGDFNIVPEDRDAYDPVALRGQIFLSPPEREAL 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            ++ N+GF DA RA H     +S+WDY    + +N G+RID I+++      L SA ID 
Sbjct: 176 ARIMNLGFRDAFRALHPDPGHFSWWDYRQGMFRRNMGLRIDLILMASSLEPALTSAEIDR 235

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + R   +PSDH PV V  D
Sbjct: 236 EVRKNERPSDHAPVFVDFD 254


>gi|95930349|ref|ZP_01313086.1| exodeoxyribonuclease III [Desulfuromonas acetoxidans DSM 684]
 gi|95133601|gb|EAT15263.1| exodeoxyribonuclease III [Desulfuromonas acetoxidans DSM 684]
          Length = 270

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 77/270 (28%), Positives = 124/270 (45%), Gaps = 10/270 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++NVN +RAR H + A I    PD++ LQETK  D  FP   ++SL Y +   GQK
Sbjct: 1   MKIISFNVNGLRARHHQVKAVIDTYQPDVLALQETKVHDDQFPLAEVESLGYEVRYYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+LS+  P+++      DD + Q R I   +    Q + + N Y P G   +   
Sbjct: 61  GHYGVALLSRQAPVDVQYGFVDDDDEAQRRLIVGRYAFGDQMVTVVNGYFPQGENRSHAV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIW------ENDACFT 176
           K+  K  + +   +         + L+  GD N+ P   D             +  +CF 
Sbjct: 121 KFPAKEKFYRDLRQMLENYEAKNDALLVVGDMNVAPLAEDIGIGPDNEKRWLAQGKSCFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKN--KGIRIDHIMLSPEAT 233
            E R   Q + + G  D+ R  +      +S++DY +  + ++  +G+RID I+ S    
Sbjct: 181 PEERAWLQSVMDWGLHDSFRHCYPDVDDRFSWFDYRSRGFERDPKRGLRIDLILASQALI 240

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           S    A ID   R   KPSDH P+     +
Sbjct: 241 SRCQDAGIDYDIRAMEKPSDHCPIWAEFSL 270


>gi|331647243|ref|ZP_08348337.1| exodeoxyribonuclease III [Escherichia coli M605]
 gi|331044026|gb|EGI16162.1| exodeoxyribonuclease III [Escherichia coli M605]
          Length = 272

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 125/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPISVRRGFPGDDEEAQRRIIMAEIPSPLGNITVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ E P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|311279891|ref|YP_003942122.1| exodeoxyribonuclease III [Enterobacter cloacae SCF1]
 gi|308749086|gb|ADO48838.1| exodeoxyribonuclease III [Enterobacter cloacae SCF1]
          Length = 268

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 123/267 (46%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEDVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  P+ +    PGD  D Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKATPVSVRRGFPGDGEDAQRRIIMAEIPSAFGNVTVINGYFPQGESRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    + +  L  E P++  GD NI P         D     +      F 
Sbjct: 121 KFPAKELFYQNLQNYLNTELNNENPVLIMGDMNISPTDLDIGIGDDNRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  R  H      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMARLLDWGLVDTFRHAHPDTQDKFSWFDYRSKGFDDNRGLRIDLLLASSPLAQR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                ID + R   KPSDH PV  +  
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATFK 267


>gi|149278560|ref|ZP_01884696.1| exodeoxyribonuclease III (exonuclease III) [Pedobacter sp. BAL39]
 gi|149230555|gb|EDM35938.1| exodeoxyribonuclease III (exonuclease III) [Pedobacter sp. BAL39]
          Length = 260

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 96/261 (36%), Positives = 144/261 (55%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N +  R+  L  W+ +  PD++CLQE K E   FP   +    Y     G+K
Sbjct: 1   MKIATYNINGVNGRLPVLLRWLAKAQPDVVCLQELKCESYRFPVTAINDAGYQAIWRGEK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK +  E+ T LPG+D   Q           T  + IG +YLP+GNP    K
Sbjct: 61  SWNGVAILSKSEIRELRTDLPGEDASYQHS---RYIEGFTFGMVIGCIYLPNGNPYPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K+ W  R        L    P++  GDYN++P   D Y P  + ++A F  E R+++
Sbjct: 118 FDYKLRWFSRLADHGRTLLNTGLPVMLVGDYNVMPTELDTYKPEKYLDNALFREESRKAY 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L   G+ DAIR  +    +Y+FWDY  +++ +N G+R+DH +L+P     L  A++D 
Sbjct: 178 ADLVAQGWIDAIRELYPGERIYTFWDYMRNAYGRNAGLRLDHFLLNPVLAGRLKVAKVDK 237

Query: 244 KPRGWTKPSDHTPVIVSLDIP 264
           + RGW K SDH PV + L +P
Sbjct: 238 EVRGWEKASDHAPVWIELSMP 258


>gi|237731238|ref|ZP_04561719.1| exonuclease III [Citrobacter sp. 30_2]
 gi|226906777|gb|EEH92695.1| exonuclease III [Citrobacter sp. 30_2]
          Length = 272

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 81/270 (30%), Positives = 129/270 (47%), Gaps = 8/270 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H LAA ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLAAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A       ++ + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGSITVINGYFPQGESRDH 122

Query: 122 -TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
            TK+  K ++ +    +    L+ + P++  GD NI P         +     +      
Sbjct: 123 ETKFPAKAAFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L   G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLLGWGLVDTYRHANPEKNDQFSWFDYRSKGFDDNRGLRIDLLLASNPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                  ID + R   KPSDH PV     +
Sbjct: 243 ERCEETGIDYEIRSMEKPSDHAPVWAKFRV 272


>gi|261210504|ref|ZP_05924797.1| exodeoxyribonuclease III [Vibrio sp. RC341]
 gi|260840289|gb|EEX66860.1| exodeoxyribonuclease III [Vibrio sp. RC341]
          Length = 268

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 77/268 (28%), Positives = 127/268 (47%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR+H L A I ++ PD+I LQE K  D  FP E ++++ Y +   GQK
Sbjct: 1   MKIISFNINGLRARLHQLQAIIDKHQPDVIGLQEIKVHDDAFPREEVEAMGYQVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVAIL K  P+E++   P  ++   +   +            + N Y P G+ +   
Sbjct: 61  AHYGVAILCKQTPLEVIKGFPTDNEEHQKRMIMATFADQEGNKTTVLNGYFPQGDNVEHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + +  + +  +     E L+  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYRDLMTYLREHRSNTERLVVMGDINISPIDLDIGIGEANRKRWLQTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H   +  +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLQTLLDWGLVDTFRQLHPNVNDQFSWFDYRSRGFEDNRGLRIDVILATPSLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + RG  KPSDH P+  +  
Sbjct: 241 TCQEAGIDYELRGIDKPSDHAPIWATFK 268


>gi|87123786|ref|ZP_01079636.1| Exodeoxyribonuclease III xth [Synechococcus sp. RS9917]
 gi|86168355|gb|EAQ69612.1| Exodeoxyribonuclease III xth [Synechococcus sp. RS9917]
          Length = 276

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 85/278 (30%), Positives = 138/278 (49%), Gaps = 5/278 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+R R+ ++  W+    PD++CLQETK  D  FP E   S  +     GQK
Sbjct: 1   MRIASWNVNSLRTRLDHVLNWLNAAQPDLLCLQETKVADPQFPLEAFTSRGWQATVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT---QTLRIGNLYLPHGNPIT 120
           +YNGVA++S+    ++     G+  D +A  +     + +     +R+ NLY+P+G+ + 
Sbjct: 61  AYNGVALVSRTPLEDVRLGFSGELADEEAEELGTQKRVISALLDGVRVVNLYVPNGSSLK 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             KY  K+ W+    R+  +  E  EPL   GD+NI  +  D ++P         +   R
Sbjct: 121 LEKYPYKLRWLACLQRYLQRPQERGEPLCVVGDFNIALESRDMHDPDRLTGGIMASEPER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            + +        D  R        +S+WDY + +W +++G RIDHI L  E  +      
Sbjct: 181 AALKAALGDTLHDVFRVFEPDTGHWSWWDYRSGAWDRDRGWRIDHIYLCDELLARARGCL 240

Query: 241 IDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDSTSQNM 278
           I  + RG  +PSDH PV+  L  P   ++  DS   N+
Sbjct: 241 IHKQERGRDQPSDHAPVVADLCWP--PEEDGDSDEWNL 276


>gi|324007120|gb|EGB76339.1| exodeoxyribonuclease III [Escherichia coli MS 57-2]
          Length = 272

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 124/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVTKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGD  + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDGEEAQRRIIMAEIPSPLGNITVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ E P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|16272016|ref|NP_438214.1| exonuclease III [Haemophilus influenzae Rd KW20]
 gi|145636755|ref|ZP_01792421.1| exodeoxyribonuclease III [Haemophilus influenzae PittHH]
 gi|260580655|ref|ZP_05848482.1| exodeoxyribonuclease III [Haemophilus influenzae RdAW]
 gi|1169570|sp|P44318|EX3_HAEIN RecName: Full=Exodeoxyribonuclease III; Short=EXO III;
           Short=Exonuclease III
 gi|1572987|gb|AAC21719.1| exodeoxyribonuclease III (xthA) [Haemophilus influenzae Rd KW20]
 gi|145270053|gb|EDK09990.1| exodeoxyribonuclease III [Haemophilus influenzae PittHH]
 gi|260092717|gb|EEW76653.1| exodeoxyribonuclease III [Haemophilus influenzae RdAW]
          Length = 267

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 82/267 (30%), Positives = 128/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  I    P D+ D Q R I A        L + N Y P G      T
Sbjct: 61  GHYGVALLTKQEPKVIRRGFPTDNEDAQKRIIMADLETEFGLLTVINGYFPQGESRAHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R  +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDDNRGLRIDHILVSQKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|331014335|gb|EGH94391.1| exonuclease III [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 270

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 90/269 (33%), Positives = 136/269 (50%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPLADVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD + Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNPPLALHKGFEGDDEESQKRFIWGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +        +   E+PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQALLEGQFSNEQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRYLYPEVSDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D   RG  KPSDH P+ + L
Sbjct: 241 QPRIKAAGVDYDLRGMEKPSDHAPIWLEL 269


>gi|297537413|ref|YP_003673182.1| exodeoxyribonuclease III Xth [Methylotenera sp. 301]
 gi|297256760|gb|ADI28605.1| exodeoxyribonuclease III Xth [Methylotenera sp. 301]
          Length = 260

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 90/259 (34%), Positives = 140/259 (54%), Gaps = 5/259 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
              +ATWNVNS+  R+ ++  W+++N  D++CLQETK ED  FP+  L+   Y+    GQ
Sbjct: 5   TFKLATWNVNSLNVRLQHVLDWLRDNPIDVLCLQETKQEDSKFPYTELKEAGYNAIHSGQ 64

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVAILS +   E+   +   +   +              +R+  +Y+ +G  + S 
Sbjct: 65  KTYNGVAILSTHDMTEVEHGIADFEDGQKRVISATING-----VRVVCVYIVNGQAVDSE 119

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY+ K+ W+     + +  L+    L+  GDYNI P+  DC++P  W      + + R+ 
Sbjct: 120 KYEYKMRWLTALNTWLAGELKKYPKLVVLGDYNIAPEDRDCHDPAAWLGQILVSPQEREH 179

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           FQKL  +G  D+ R        +S+WDY    + +N G+RIDHI++S    S   +A ID
Sbjct: 180 FQKLLQLGLHDSFRLFEQAEKSFSWWDYRMMGFRRNFGMRIDHILVSDALKSACIAATID 239

Query: 243 TKPRGWTKPSDHTPVIVSL 261
             PR   +PSDHTPVI+ L
Sbjct: 240 KAPRKLERPSDHTPVILEL 258


>gi|326775686|ref|ZP_08234951.1| exodeoxyribonuclease III Xth [Streptomyces cf. griseus XylebKG-1]
 gi|326656019|gb|EGE40865.1| exodeoxyribonuclease III Xth [Streptomyces cf. griseus XylebKG-1]
          Length = 259

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 77/260 (29%), Positives = 127/260 (48%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVNSI AR+  L AW++ +  D++C+QETK   + FP E L+   Y        
Sbjct: 1   MRIATYNVNSITARLPRLLAWLESSGTDVLCVQETKCTAEQFPAEALREAGYASAVNATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA+LS+    ++VT LP        +   A        LR+ ++Y+P+G  +    
Sbjct: 61  RWNGVALLSRVGLSDVVTGLPDGPEYEGVQEPRAISATCGP-LRLWSVYVPNGREVEHAH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++   +  +       P    GD+N+ P   D ++P ++E     T   R + 
Sbjct: 120 YAYKLRWLEALRKAVAADAAKALPFAVLGDFNVAPTDEDVWDPALFEGATHVTPAERVAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G ++           Y+FWDY    + KNKG+RID    +   T+ +  + +D 
Sbjct: 180 AALEAEGLSEVHPRPLKYDRAYTFWDYRELRFPKNKGMRIDLTFGNAPFTAAVKDSYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V LD+
Sbjct: 240 EERKGKGASDHAPVVVDLDL 259


>gi|312796736|ref|YP_004029658.1| Exodeoxyribonuclease III [Burkholderia rhizoxinica HKI 454]
 gi|312168511|emb|CBW75514.1| Exodeoxyribonuclease III (EC 3.1.11.2) [Burkholderia rhizoxinica
           HKI 454]
          Length = 259

 Score =  205 bits (522), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 81/259 (31%), Positives = 133/259 (51%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS++ R+ ++  W+  +  D++CLQE K  D  +P   L++  Y     GQK
Sbjct: 1   MKIATWNINSLKVRLQHVIDWLAMSRVDVLCLQELKLPDDKYPRAALEAAGYRSWFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL +   + +   +   ++       +         +R+ + Y P+G    + K
Sbjct: 61  TYNGVAILVRDG-LPVDEAVVIRNIPGFDDLQQRLIAATIDGVRVVSAYFPNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+SW+     + +  +         GDYNI P+  D ++P  WE     + E R +F
Sbjct: 120 FAYKLSWLAALREWVAAEMRAHPQFALTGDYNIAPEDRDVHDPQAWEGQNLVSPEERDAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L  +G  DA R        +S+WDY   ++ +N G+RIDHI+LSP       +  ID 
Sbjct: 180 RSLVELGLVDAFRCFEQPDKSFSWWDYRMLAFRRNAGLRIDHILLSPSLAQCCSACEIDK 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR W +PSDH PVI +L+
Sbjct: 240 TPRRWDQPSDHAPVIATLE 258


>gi|307294591|ref|ZP_07574433.1| exodeoxyribonuclease III Xth [Sphingobium chlorophenolicum L-1]
 gi|306879065|gb|EFN10283.1| exodeoxyribonuclease III Xth [Sphingobium chlorophenolicum L-1]
          Length = 256

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 103/259 (39%), Positives = 155/259 (59%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR+  L  W+ E  PDI CLQE KT D+ FP + ++ + Y     GQK
Sbjct: 1   MRIATFNINGIKARLPRLLEWLDETRPDIACLQEIKTSDETFPVKDIEDVGYGAIWHGQK 60

Query: 64  SYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
            +NGVAIL++   P+E+   L G+  D  +R++EA        LR+ ++YLP+GNP    
Sbjct: 61  GFNGVAILARGETPVEVRRGLEGEPEDEHSRYLEADVKG----LRVASIYLPNGNPQPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W+KR    A++    E P I AGDYN+IP+  D Y+     +DA    E R +
Sbjct: 117 KFDYKLRWMKRLRARATEIWAEEVPAILAGDYNVIPRDKDVYSVKAMADDALMQPESRAA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           +++L   G+TDAI + H    ++++WDY  ++W ++ G RIDH++LSP A   L  A++D
Sbjct: 177 YRRLLGDGWTDAIASRHPAGGVWTYWDYQMNAWPRDAGFRIDHLLLSPAAADRLIDAQVD 236

Query: 243 TKPRGWTKPSDHTPVIVSL 261
              RG  K SDH P  V L
Sbjct: 237 KDFRGREKASDHAPTWVEL 255


>gi|331653152|ref|ZP_08354157.1| exodeoxyribonuclease III [Escherichia coli M718]
 gi|331049250|gb|EGI21322.1| exodeoxyribonuclease III [Escherichia coli M718]
          Length = 272

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 125/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMADIPSPLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ E P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|118464012|ref|YP_883854.1| exodeoxyribonuclease III [Mycobacterium avium 104]
 gi|118165299|gb|ABK66196.1| exodeoxyribonuclease III [Mycobacterium avium 104]
          Length = 272

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 76/264 (28%), Positives = 122/264 (46%), Gaps = 7/264 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR+R+  +  W+   + D++ +QETK  D  FP      L Y +   G  
Sbjct: 1   MRLATWNVNSIRSRLPRVLDWLARTDVDVLAMQETKCADGQFPTLPFFELGYEVAHVGFN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQAR-----FIEATFTINTQTLRIGNLYLPHGNP 118
            +NGVAI S+    ++     G                         +RI +LY+P+G  
Sbjct: 61  QWNGVAIASRVGLDDVRVGFEGQPSWSGKPEVAAAAEARALAATCAGVRIWSLYVPNGRA 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           +    Y  K+ W+      A+  L  +    +  AGD+NI PQ  D ++   +      +
Sbjct: 121 VGDPHYAYKLDWLAALRDSAAGWLREDPAAQIALAGDWNIAPQDDDVWSMEFFAGATHVS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R++F  + +  F D +R       +Y++WDY A  + K +G+RID I+ SP     +
Sbjct: 181 EPERRAFNAILDAQFADLVRPFAPGPGVYTYWDYTALRFPKRQGMRIDFILGSPALARRV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVS 260
             A+ID + R     SDH PV+V 
Sbjct: 241 THAQIDREERKGKGASDHAPVLVD 264


>gi|119715318|ref|YP_922283.1| exodeoxyribonuclease III [Nocardioides sp. JS614]
 gi|119535979|gb|ABL80596.1| Exodeoxyribonuclease III [Nocardioides sp. JS614]
          Length = 262

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 75/263 (28%), Positives = 128/263 (48%), Gaps = 7/263 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R+RI  + A++  +  D++ LQETK  +   P   +++  Y +   G  
Sbjct: 1   MRIATWNVNSLRSRIDRVEAFLDRHEVDVLALQETKAREDQLPLMGIEARGYEVAVAGAN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPHGNP 118
            +NGVA++S+    ++    PG     +     A             +RI +LY+P+G  
Sbjct: 61  QWNGVAVISRVGLSDVAVGFPGQPGWAKDVQRAAETESRAIGATCGGVRIWSLYVPNGRK 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLE 178
                Y  K+ W+ R     + +   ++ +   GD+NI P   D ++   +      T  
Sbjct: 121 PDDPHYVYKLDWLAR--LRDAAQAWRDQDVALVGDWNIAPTDEDVFDMAQFARSTHVTPP 178

Query: 179 VRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHS 238
            R +FQ     G+ D +R       +Y++WDYY   + +N+G+RID ++ SP   + +  
Sbjct: 179 ERAAFQAFLEDGYVDVVRPHAPGPEVYTYWDYYRQRYERNRGMRIDFVLGSPSLAARVTG 238

Query: 239 ARIDTKPRGWTKPSDHTPVIVSL 261
           A ID + R  T  SDH PV+V L
Sbjct: 239 AFIDREERAGTGASDHAPVVVDL 261


>gi|290475444|ref|YP_003468332.1| exonuclease III [Xenorhabdus bovienii SS-2004]
 gi|289174765|emb|CBJ81566.1| exonuclease III [Xenorhabdus bovienii SS-2004]
          Length = 268

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 86/266 (32%), Positives = 128/266 (48%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA ++++ PD+I LQETK  D+ FP E +  L YHI   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIVEQHQPDVIGLQETKVHDEMFPLEEVSKLGYHIFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           S+ GVA+L++ QP+ +    P DD D Q R I A        + I N Y P G       
Sbjct: 61  SHYGVALLTRQQPVTVRKGFPTDDDDAQRRIIMADIETPQGLMTIINGYFPQGESREHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWE------NDACFT 176
           K+  K  + +   R+  +    +  ++  GD NI P   D       +          F 
Sbjct: 121 KFPAKEKFYQDLNRYLEKNQSPDSHILIMGDMNISPTDLDIGIGENNQKRWLKTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L++ G  D  RA H      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMGRLKDWGLIDTFRAQHPEASDQFSWFDYRSKGFDDNRGLRIDLLLASRPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
             S+ ID   R   KPSDH PV    
Sbjct: 241 CLSSGIDYAIRSMEKPSDHAPVWAEF 266


>gi|167856041|ref|ZP_02478785.1| exodeoxyribonuclease III [Haemophilus parasuis 29755]
 gi|219870568|ref|YP_002474943.1| exonuclease III [Haemophilus parasuis SH0165]
 gi|167852836|gb|EDS24106.1| exodeoxyribonuclease III [Haemophilus parasuis 29755]
 gi|219690772|gb|ACL31995.1| exonuclease III [Haemophilus parasuis SH0165]
          Length = 267

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 86/267 (32%), Positives = 130/267 (48%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I+++ PD+I LQE K  D++FP++ +  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEALIEKHQPDVIGLQEIKVADEDFPYDLVNHLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K QP+ +    P D+ D Q R I A       TL + N Y P G   +  T
Sbjct: 61  GHYGVALLTKNQPLAVRKGFPTDNADAQKRMIMADLETPFGTLTVLNGYFPQGENRSHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACFT 176
           K+  K  +     R+    L+ E P++  GD NI P   D           + +    F 
Sbjct: 121 KFPAKEKFYADLQRYLETELKPENPIVIMGDMNISPTDLDIGLGEVNRKRWLRDGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  RA + T    +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWLGRLHGYGLVDTFRAMNPTAEDKFSWFDYRSKGFDDNRGLRIDLVLASTPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                ID + R   KPSDH PV     
Sbjct: 241 CVETGIDLEIRAMDKPSDHAPVWAVFK 267


>gi|332039522|gb|EGI75929.1| exodeoxyribonuclease III Xth [Hylemonella gracilis ATCC 19624]
          Length = 268

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 91/265 (34%), Positives = 126/265 (47%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNP-----DIICLQETKTEDKNFPFETLQSLNYHIE 58
           + +ATWNVNS+  R+  +  W+          D++ LQE K  D  FP    ++  Y  E
Sbjct: 1   MKLATWNVNSLGVRLPQVLDWLAAQAAGGAPIDVLALQELKLTDDKFPHAEFEAAGYRAE 60

Query: 59  TCGQKSYNGVAILSKY--QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHG 116
             GQK+YNGVA++S+     +  VT       D QAR I AT       LRI N Y  +G
Sbjct: 61  AYGQKTYNGVALISRLSLPALRDVTRNITGFEDEQARVIVATLDTPQGPLRIVNGYFVNG 120

Query: 117 NPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
               S K+  K+ W+          L     L+  GDYNI P   D Y+P         T
Sbjct: 121 QEPGSEKFAYKMRWMDALRAQVQAELATHARLVLLGDYNITPDDRDSYDPEGLRETIHHT 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
            + R+ F+ L  +G  DA R        YS+WDY    + KN+G+RIDHI++S      +
Sbjct: 181 TQEREQFKALLALGLHDAYRMFEQPEKSYSWWDYRMLGFQKNRGLRIDHILVSEALKPAV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
               ID  PR   +PSDH PV++ L
Sbjct: 241 QGCTIDRLPRKNKQPSDHAPVLLEL 265


>gi|300716986|ref|YP_003741789.1| Exodeoxyribonuclease III [Erwinia billingiae Eb661]
 gi|299062822|emb|CAX59942.1| Exodeoxyribonuclease III [Erwinia billingiae Eb661]
          Length = 272

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 82/272 (30%), Positives = 129/272 (47%), Gaps = 8/272 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +  L YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEEVSKLGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K +P+ +     GDD + Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVALLTKDEPLAVRRGFAGDDEESQRRMIMADIATPVGTLTVLNGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +     +   P++  GD NI           D     +      F 
Sbjct: 121 KFPAKEKFYRDLQSYLENDQKPTNPVVIMGDMNISATDLDIGIGEDNRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATH-DTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  RA + + +  +S++DY +  +  N+G+RID ++ S    + 
Sbjct: 181 PEEREWMDRLMGWGLVDTWRAENAEANDRFSWFDYRSKGFDDNRGLRIDLVLASQPLAAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDIPEPR 267
             +  ID   R   KPSDH P+    ++ E +
Sbjct: 241 CVATGIDYDIRSMEKPSDHAPIWAQFNLDEAK 272


>gi|148240155|ref|YP_001225542.1| exodeoxyribonuclease III [Synechococcus sp. WH 7803]
 gi|147848694|emb|CAK24245.1| Exodeoxyribonuclease III [Synechococcus sp. WH 7803]
          Length = 276

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 86/264 (32%), Positives = 137/264 (51%), Gaps = 4/264 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+R R+ ++  W+  N  D++ LQETK +D  FP +  Q   YH+   GQK
Sbjct: 1   MRIASWNVNSVRTRLEHVLGWLDRNTIDVLALQETKVDDPLFPLKPFQERGYHLSIHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN----TQTLRIGNLYLPHGNPI 119
           SYNGVA++S+    ++     G+           T           +R+ NLY+P+G+ +
Sbjct: 61  SYNGVALISRQPLEDVRLGFTGELPGDADAEALGTQKRVISALVDGIRVVNLYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S KY  K++W+    R+       +EPL   GD+NI P+  D ++P         +   
Sbjct: 121 DSEKYSYKLNWMGCLERYLRAAETRDEPLCVVGDFNIGPEARDLHDPERLTGGIMASEAE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++  ++      DA R        +S+WDY + +W+++ G RIDHI +S +   L  S 
Sbjct: 181 RKALVQVLGSNLGDAFRLFEPGSGHWSWWDYRSGAWNRDSGWRIDHIYISSDLQELARSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDI 263
            ID + RG  +PSDH PV+V L  
Sbjct: 241 SIDKEERGREQPSDHAPVVVDLAW 264


>gi|262274649|ref|ZP_06052460.1| exodeoxyribonuclease III [Grimontia hollisae CIP 101886]
 gi|262221212|gb|EEY72526.1| exodeoxyribonuclease III [Grimontia hollisae CIP 101886]
          Length = 300

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 81/270 (30%), Positives = 130/270 (48%), Gaps = 9/270 (3%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           S + V ++N+N +RAR+H L A I+++ PD+I LQE K  D+ FP E ++++ Y +   G
Sbjct: 31  SSMKVISFNINGLRARLHQLQALIEKHQPDVIGLQEIKVHDEAFPVEDVEAMGYKVYFHG 90

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLD-VQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           QK++ GVA+L K  P+ +    P D  D  +   +      +   + + N Y P G  I 
Sbjct: 91  QKAHYGVAMLCKQTPVRVQKGFPTDGEDAQRRMIMATFKQEDGSEVTVLNGYFPQGENIE 150

Query: 121 S-TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDA 173
             TK+  K  + +  + + +     +E LI  GD NI P   D           +     
Sbjct: 151 HETKFPAKRKFYQDLMTYLNASHTNDEKLIVMGDINISPLDLDIGIGEVNRKRWLKTGKC 210

Query: 174 CFTLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEA 232
            F  E R+    L N GF D  R  +    + +S++DY +  +  N+G+RID I+ +P  
Sbjct: 211 SFQPEEREMLATLMNWGFVDTFRQQYPDVDNKFSWFDYRSRGFDDNRGLRIDVILATPSL 270

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLD 262
                   ID + RG  KPSDH P+  +  
Sbjct: 271 AVDCIDTGIDYELRGIEKPSDHAPIWATFK 300


>gi|172038905|ref|YP_001805406.1| exodeoxyribonuclease III [Cyanothece sp. ATCC 51142]
 gi|171700359|gb|ACB53340.1| exodeoxyribonuclease III [Cyanothece sp. ATCC 51142]
          Length = 262

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 90/262 (34%), Positives = 140/262 (53%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R  ++  W+  N+ D++CLQETK  DK+FP E  + L YH+   GQK
Sbjct: 1   MKIATWNVNSIRTRQSHVINWLSNNSIDVLCLQETKVIDKDFPREPFEELGYHVYIYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT---QTLRIGNLYLPHGNPIT 120
           +YNGVAI S+    +I+        +  A+  +    + +     +RI NLY+P+G  + 
Sbjct: 61  AYNGVAIFSRQPMTDIIMGFTPMVGEAIAQQFDEQKRVISGVIDGIRIINLYVPNGAAVG 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPL-IFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           S KY  K+ W +    +    ++ E       GD+NI  +  D YN    EN    +   
Sbjct: 121 SEKYQYKLQWFQVLKVYLDNLIQKESHELCICGDFNIALEDKDIYNSKGKENHIMSSPLE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++ + +  +G  DA R        +S+WDY +  + +N+G RIDH+ L+ +      + 
Sbjct: 181 REALENILEIGLQDAFRKFTTEGGHFSWWDYRSGGFQRNRGWRIDHLYLTNKLYGKAINC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            ID +PR   KPSDHTPVI+ +
Sbjct: 241 TIDIEPRKQEKPSDHTPVILEI 262


>gi|330810622|ref|YP_004355084.1| exodeoxyribonuclease III [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378730|gb|AEA70080.1| exodeoxyribonuclease III [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 270

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 88/269 (32%), Positives = 134/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+++ PD+I LQETK  D+ FP   +Q+L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIEKHQPDVIGLQETKVHDEQFPLAEVQALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD D Q RFI  TF   N   + I N Y P G      
Sbjct: 61  GHYGVALLSRQAPLSLYKGFEGDDEDAQRRFIWGTFADANGVPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWE------NDACF 175
            K+  K  +     +    R   ++P++  GD NI P+  D                  F
Sbjct: 121 TKFPAKERFYSDLQQLLESRFSNDQPVVVMGDVNISPEDCDIGIGPDNMKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+   +L+N G  D+ R  +      +S++DY +  +     +G+RID I+ S   
Sbjct: 181 LPEEREWMARLKNWGLVDSFRHLNPDVTDRFSWFDYRSRGFEDEPKRGLRIDLILTSHGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +  A +D + RG  KPSDH P+ + L
Sbjct: 241 LPRVKDAGVDYELRGMEKPSDHAPIWLQL 269


>gi|183599301|ref|ZP_02960794.1| hypothetical protein PROSTU_02765 [Providencia stuartii ATCC 25827]
 gi|188021535|gb|EDU59575.1| hypothetical protein PROSTU_02765 [Providencia stuartii ATCC 25827]
          Length = 271

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 131/268 (48%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I ++ P++I LQETK  D+ FP++ +  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLAAIIDKHQPEVIGLQETKVHDEMFPYDDVSKLGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           ++ GVA+L+K +P+ +    P DD D Q R I A    N   L + N Y P G       
Sbjct: 61  AHYGVALLTKNKPVAVRKGFPTDDDDAQRRIIMADIETNHGLLTVVNGYFPQGESREHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    + +     +  L+  GD NI P               +      F 
Sbjct: 121 KFPAKEKFYQDLQDYITSTQTPQSQLLIMGDMNISPTDLDIGIGEANRKRWLKTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R   ++L N G  D  RA +      YS++DY +  +  N+G+RID ++ S   ++ 
Sbjct: 181 PEERAWMERLLNWGLVDTYRAMNPDVDDCYSWFDYRSKGFDDNRGLRIDLLLASTALSTR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID + RG  KPSDH PV    D+
Sbjct: 241 CVATGIDYEIRGMEKPSDHAPVWAEFDL 268


>gi|118594091|ref|ZP_01551438.1| Exodeoxyribonuclease III:Exodeoxyribonuclease III xth
           [Methylophilales bacterium HTCC2181]
 gi|118439869|gb|EAV46496.1| Exodeoxyribonuclease III:Exodeoxyribonuclease III xth
           [Methylophilales bacterium HTCC2181]
          Length = 260

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 87/259 (33%), Positives = 139/259 (53%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           +  +ATWNVNS+  R+ ++  W+K +NPDI+CLQETK  +  F  E   S+ Y     GQ
Sbjct: 1   MTKIATWNVNSLNVRLEHVIDWVKIHNPDILCLQETKQTNDKFSHEAFDSIGYKSYHNGQ 60

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVAI+S  +   + + +PG     +        + +   + + + Y+P+G  + S 
Sbjct: 61  KTYNGVAIISNKELQNVGSDIPGFSDPQKRIIHGLYPSRSLGLIHVVSAYVPNGQSLDSE 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+  K+SW++ F  +        +  I  GD+NI P+  DC++P  W+ +   +   R  
Sbjct: 121 KFKYKVSWLEAFNTWVKSSYGKSDHHILTGDFNIAPRDIDCHDPEAWKGNILVSQIERDL 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F  + ++GF D+ R  +     +S+WDY    + +N G+RIDHI+ S      L +A ID
Sbjct: 181 FDAIIDIGFDDSFRVLNKDIQKFSWWDYRMAGFRRNLGMRIDHILTSHSLKENLTTAYID 240

Query: 243 TKPRGWTKPSDHTPVIVSL 261
             PR   +PSDHTPVI   
Sbjct: 241 EDPRKLERPSDHTPVITEF 259


>gi|116073418|ref|ZP_01470680.1| Exodeoxyribonuclease III xth [Synechococcus sp. RS9916]
 gi|116068723|gb|EAU74475.1| Exodeoxyribonuclease III xth [Synechococcus sp. RS9916]
          Length = 276

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 91/273 (33%), Positives = 141/273 (51%), Gaps = 5/273 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+R R+ ++ AW++ + PD++CLQETK  D  FP    +S+ Y +   GQK
Sbjct: 1   MLIASWNVNSVRTRLDHVLAWLQSHQPDLLCLQETKVADPLFPQTAFESIGYRVSFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT----QTLRIGNLYLPHGNPI 119
           SYNGVA++S+    ++     G+                       +R+ NLY+P+G+ +
Sbjct: 61  SYNGVALISRTPLDDVRCGFIGELPGDLEAGELGEQKRVISALLDGVRVVNLYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           TS KY  K+ W+    R+     E +EPL   GD+NI  +  D ++P         +   
Sbjct: 121 TSDKYPYKLKWLNCLKRYREAAQERDEPLCIVGDFNIGMEARDIHDPERLTGGIMASDAE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R +  +    G  D  RA       +S+WDY + +W+++ G RIDHI LS +   L  S 
Sbjct: 181 RTALNEALGEGMVDVFRAFEPDAGHWSWWDYRSGAWNRDSGWRIDHIYLSEDLLDLARSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQD 272
            I  + RG  +PSDH PV+V L  P P   + D
Sbjct: 241 VIHKQERGKEQPSDHAPVVVDLCWP-PEDDEDD 272


>gi|33596079|ref|NP_883722.1| putative exodeoxyribonuclease III [Bordetella parapertussis 12822]
 gi|33601475|ref|NP_889035.1| putative exodeoxyribonuclease III [Bordetella bronchiseptica RB50]
 gi|33573082|emb|CAE36724.1| putative exodeoxyribonuclease III [Bordetella parapertussis]
 gi|33575911|emb|CAE32990.1| putative exodeoxyribonuclease III [Bordetella bronchiseptica RB50]
          Length = 260

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 87/258 (33%), Positives = 130/258 (50%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+  N  D +C+QE K  D  FP +      YH    GQK
Sbjct: 1   MKLATWNVNSLNVRLPQVLDWLAANPVDALCIQELKLTDDKFPLDAFTEAGYHAAWAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+     +V + P    D Q R +  T       +R+   Y P+G  + S K
Sbjct: 61  TYNGVAIISREPGFALVRNNP-RYEDPQQRILAVTLPSPAGDVRVICAYCPNGQSVDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W      +  + +     L   GDYN+ P   D +NP  WE     +   R +F
Sbjct: 120 YVYKLAWFDGLRDWLEEEMRTYPRLAILGDYNVAPADADVHNPEKWEGQVLVSEPERAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD+ R        +S+WDY   ++ +N G+RIDH++LS        +  ID 
Sbjct: 180 RALLDLGLTDSFRLFEQPEKSFSWWDYRQFAFRRNAGLRIDHVLLSDALKPHCVACVIDK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PVI +L
Sbjct: 240 APRANEQPSDHAPVIATL 257


>gi|300917685|ref|ZP_07134334.1| exodeoxyribonuclease III [Escherichia coli MS 115-1]
 gi|300415086|gb|EFJ98396.1| exodeoxyribonuclease III [Escherichia coli MS 115-1]
          Length = 272

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 124/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSLLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ + P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMDRLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|226944961|ref|YP_002800034.1| exonuclease III [Azotobacter vinelandii DJ]
 gi|226719888|gb|ACO79059.1| exodeoxyribonuclease III [Azotobacter vinelandii DJ]
          Length = 270

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 87/270 (32%), Positives = 133/270 (49%), Gaps = 11/270 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H L+A I ++ PD+I LQETK  D+ FP E +  L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLSALIDKHRPDVIGLQETKVADEQFPLEQIGELGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+E+    P D  D Q RFI   +     Q + + N Y P G      
Sbjct: 61  GHYGVALLSRQPPLEVQKGFPDDGEDSQKRFIWGVYADAAGQPVTVMNGYFPQGESRAHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+  K  +          R +  +PL   GD+NI P+  D           +      F
Sbjct: 121 LKFPAKTRFYADLQALLESRFDPGQPLALMGDFNIAPEDSDIGIGAENARRWLRTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKN--KGIRIDHIMLSPEA 232
             E R+   +L++ G  D+ R  H      +S++DY +  +  +  +G+RID I+ S   
Sbjct: 181 LPEEREWMARLKDWGLQDSFRELHPQACDRFSWFDYRSRGFEDDPRRGLRIDLILTSRAL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLD 262
              L +A +D + R   KPSDH PV + LD
Sbjct: 241 RPRLRAADVDYELRAMDKPSDHAPVWLELD 270


>gi|91784274|ref|YP_559480.1| exodeoxyribonuclease III [Burkholderia xenovorans LB400]
 gi|91688228|gb|ABE31428.1| Exodeoxyribonuclease III [Burkholderia xenovorans LB400]
          Length = 258

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 83/258 (32%), Positives = 131/258 (50%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R  ++  W++ +  D++CLQE K  D+ FP   L+   Y     GQK
Sbjct: 1   MKIATWNVNSLKVRQQHVIDWLETSGTDVLCLQELKLPDEKFPRAELEEKGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGV IL +   + +       ++       +         +RI + Y P+G    + K
Sbjct: 61  TYNGVGILVRGG-LTVDESSIVRNIPGFEDPQQRVIAATIDGVRIISAYFPNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     + +  + L   L   GDYNI P+  D ++P  WE     + E R +F
Sbjct: 120 FAYKLRWLAALHDWIASEMALHPKLALLGDYNIAPEDRDVHDPKAWEGQNLVSPEERAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +G  DA R       +YS+WDY   ++ +N G+RIDHI+LS     +  S  +D 
Sbjct: 180 VQLIGLGLVDAFRQFEQPEKIYSWWDYRMMAFRRNAGLRIDHILLSKALAEICSSCEVDK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDH PV+  L
Sbjct: 240 VPRKWDQPSDHAPVVAQL 257


>gi|71083659|ref|YP_266379.1| exodeoxyribonuclease III [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062772|gb|AAZ21775.1| exodeoxyribonuclease III [Candidatus Pelagibacter ubique HTCC1062]
          Length = 258

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 96/258 (37%), Positives = 158/258 (61%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + +WNVNS+RARI N+  ++++ +PD++ +QE KT+D+ FP++   +L+Y     GQK
Sbjct: 1   MIITSWNVNSVRARIENIKEYLQKFSPDVVMMQEIKTQDETFPYDDFSALDYESHVFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAI+SK++   +   L  D L               + +++ N+Y P+GNP+ + K
Sbjct: 61  SYNGVAIISKHKLENVKIDLIKDKLKQSRIISA-ELKHKKKNIQLINIYTPNGNPVDTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K +W+ + ++      +  E +I AGD+NI+P   D YN   +E+DA + LE+R+ F
Sbjct: 120 YTYKKNWLDKLIKQLKTLSKKNENIILAGDFNILPSAEDAYNIKGFEDDALYRLEIRKKF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GF DA R  H     Y++WDY   +W KN G+RIDH ++S    +++ +  I+ 
Sbjct: 180 REMINLGFHDAYRHIHGEKEGYTYWDYMRGAWQKNNGLRIDHFLVSNSLLNIVKNVNINK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PRG  KPSDHTP+ + L
Sbjct: 240 DPRGKGKPSDHTPIEIEL 257


>gi|120610799|ref|YP_970477.1| exodeoxyribonuclease III [Acidovorax citrulli AAC00-1]
 gi|120589263|gb|ABM32703.1| Exodeoxyribonuclease III [Acidovorax citrulli AAC00-1]
          Length = 262

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 111/257 (43%), Positives = 159/257 (61%), Gaps = 5/257 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVNSIRAR+  L  W++E+ PD+ CLQE K  D  FP   +++  Y     GQK
Sbjct: 1   MKIATFNVNSIRARLPALLQWLEESRPDVACLQELKCTDDAFPAGEIRAAGYGALWHGQK 60

Query: 64  SYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           ++NGVAIL++   PIE+   LPGD+ D Q+R++EA        + +  LYLP+GNP    
Sbjct: 61  AWNGVAILARGANPIEVQRGLPGDEADSQSRYLEAAVDG----VLVACLYLPNGNPAPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K++W+ R  R A    +  EP++ AGD+NIIP   D Y P  W +DA F  EVR +
Sbjct: 117 KFDYKLAWLDRLARRAGVLRDRPEPVVLAGDFNIIPTERDVYKPGAWVDDALFRSEVRDA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F+ L + G+TDA+RA H    +Y+FWDY    + +N G+RIDH++L+P A   L  A +D
Sbjct: 177 FRALVDSGWTDALRAVHPDETVYTFWDYLRQRFQRNAGLRIDHLLLNPAAAHRLQDAGVD 236

Query: 243 TKPRGWTKPSDHTPVIV 259
            + RG  +PSDH P   
Sbjct: 237 REVRGRPRPSDHAPAWA 253


>gi|317126375|ref|YP_004100487.1| exodeoxyribonuclease III [Intrasporangium calvum DSM 43043]
 gi|315590463|gb|ADU49760.1| Exodeoxyribonuclease III [Intrasporangium calvum DSM 43043]
          Length = 263

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 75/262 (28%), Positives = 123/262 (46%), Gaps = 3/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR+R+  +  W+  ++ D++ LQETK  +  FP +  + L Y +   G  
Sbjct: 1   MRIATWNVNSIRSRVDRVTDWLVRSDVDVLALQETKAREDQFPHDRFRELGYEVAHHGLS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQ-TLRIGNLYLPHGNPITST 122
            +NGVAI+S+    ++     G          EA         +RI +LY+P+G  +   
Sbjct: 61  QWNGVAIVSRVGIEDVRVGFDGMPGWGDPAAAEARAIGALCGGVRIWSLYIPNGRTLEDP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFA--GDYNIIPQPHDCYNPIIWENDACFTLEVR 180
               K+ W+          L  +     A  GD+NI P   D ++   +E     +   R
Sbjct: 121 HLLYKLDWLAALADAGRSWLADDPSAPIALLGDWNIAPFDEDVWSVPFYEGRTHTSPRER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +FQ + + GF D +R       +Y++WDY    + K +G+RID  + SP     +  A 
Sbjct: 181 AAFQAVVDAGFADVVRPHCPGPGVYTYWDYVQLRFQKGRGMRIDFALCSPALARRVTGAA 240

Query: 241 IDTKPRGWTKPSDHTPVIVSLD 262
           ID + R     SDH PV+  ++
Sbjct: 241 IDREARKGKGASDHAPVVFEIE 262


>gi|312961749|ref|ZP_07776247.1| exodeoxyribonuclease III [Pseudomonas fluorescens WH6]
 gi|311284008|gb|EFQ62591.1| exodeoxyribonuclease III [Pseudomonas fluorescens WH6]
          Length = 270

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 84/269 (31%), Positives = 132/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP   +Q+L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIEKHQPDVIGLQETKVHDDQFPLAEVQALGYHVYYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+ + + +     GD+ D Q RFI  TF   +   + + N Y P G      
Sbjct: 61  GHYGVALLSRQEALSVHKGFLGDEEDAQRRFIWGTFADEHGNPVTVMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +        +   ++ L+  GD NI P+        D     +      F
Sbjct: 121 TKFPAKQRFYEDLQHLLESQFSNDQALVVMGDVNISPEDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+   +L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMARLKNWGLVDSFRHLNPDVTDRFSWFDYRSRGFEDEPKRGLRIDVIMASTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +  A +D   RG  KPSDH P+ + L
Sbjct: 241 VHRVKDAGVDYDLRGLEKPSDHAPIWLEL 269


>gi|78066923|ref|YP_369692.1| exodeoxyribonuclease III [Burkholderia sp. 383]
 gi|77967668|gb|ABB09048.1| Exodeoxyribonuclease III [Burkholderia sp. 383]
          Length = 258

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 83/256 (32%), Positives = 131/256 (51%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ FP   L++  Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLAQSGTDVLCLQELKLPDEKFPRAELEAAGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++   + +       ++       +         +RI + Y P+G    S K
Sbjct: 61  TYNGVAILARDT-LSVDESDVVRNIPGFDDPQQRVVAATVDGVRIVSAYFPNGQAPDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLRTELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDH++LSP       S  +D 
Sbjct: 180 AQLIELGFVDAFRRFEQPEKTFTWWDYRMMAFRRNAGLRIDHVLLSPALAETCTSCEVDR 239

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDHTPV+ 
Sbjct: 240 TPRTWEQPSDHTPVVA 255


>gi|33863562|ref|NP_895122.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9313]
 gi|33641011|emb|CAE21469.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9313]
          Length = 279

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 89/272 (32%), Positives = 139/272 (51%), Gaps = 4/272 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  + AW+K+  PD++CLQETK +D  FP E  ++  Y +   GQK
Sbjct: 1   MQIATWNVNSIRTRLDQVQAWLKDAQPDLLCLQETKVDDPLFPHEVFEAQGYQVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN----TQTLRIGNLYLPHGNPI 119
           +YNGVAI+S+    ++     G+  +                    +RI N Y+P+G+ +
Sbjct: 61  AYNGVAIVSRQPLEDVRRGFTGELPEDAEALQLGEQKRVISALVNNIRIVNAYVPNGSAL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S KY  K+ W+    R+   + + +EPL   GD+NI  +  D ++P +       +   
Sbjct: 121 KSEKYPYKLEWLSCLNRYLCAQAKRDEPLCLVGDFNIALEARDIHHPELLTGGIMASELE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++  K+      D  R      + +S+WDY + +W +++G RIDHI L  E  S   S 
Sbjct: 181 REALLKVLGDRLHDVFRVFEPDANHWSWWDYRSGAWDRDQGWRIDHIYLCDELLSQARSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQ 271
            I    RG  KPSDH PV V L+       ++
Sbjct: 241 VIHKHLRGHEKPSDHAPVSVDLNWTPTDDDEE 272


>gi|300823193|ref|ZP_07103326.1| exodeoxyribonuclease III [Escherichia coli MS 119-7]
 gi|331677629|ref|ZP_08378304.1| exodeoxyribonuclease III [Escherichia coli H591]
 gi|300524347|gb|EFK45416.1| exodeoxyribonuclease III [Escherichia coli MS 119-7]
 gi|331074089|gb|EGI45409.1| exodeoxyribonuclease III [Escherichia coli H591]
          Length = 272

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 124/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ + P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMDRLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|121611360|ref|YP_999167.1| exodeoxyribonuclease III Xth [Verminephrobacter eiseniae EF01-2]
 gi|121556000|gb|ABM60149.1| exodeoxyribonuclease III Xth [Verminephrobacter eiseniae EF01-2]
          Length = 258

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 129/257 (50%), Gaps = 1/257 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  + AW+  N  D +CLQE K  D  FP   LQ+  Y     GQK
Sbjct: 1   MKIATWNVNSLSVRLPQVLAWLAANPVDALCLQELKLSDDKFPHAALQAAGYDAVALGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+++   +V ++P    +          +     LR+ N Y  +G    S K
Sbjct: 61  TYNGVAILSRHRLNAVVRNIPDFGDEQARVIAATLDSPLGP-LRLLNGYFVNGQEPGSEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++         L     L+ AGD+N+ PQ  D Y+P         T   R  F
Sbjct: 120 FAYKLRWLQALQDMVRAELAAHPRLVLAGDFNVAPQDRDSYDPEGLRETIHHTSAERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G  DA R        YS+WDY    + KN+G+RIDHI++S      + +  ID 
Sbjct: 180 QALLALGLADAFRMFEQPGKSYSWWDYRMLGFQKNRGLRIDHILVSAALRPAVSACMIDR 239

Query: 244 KPRGWTKPSDHTPVIVS 260
            PR   +PSDH PV+++
Sbjct: 240 APRKNPQPSDHAPVVLT 256


>gi|41410014|ref|NP_962850.1| hypothetical protein MAP3916c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41398847|gb|AAS06466.1| XthA [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 272

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 78/271 (28%), Positives = 124/271 (45%), Gaps = 7/271 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR+R+  +  W+     D++ +QETK  D  FP      L Y +   G  
Sbjct: 1   MRLATWNVNSIRSRLPRVLDWLARTEVDVLAMQETKCADGQFPTLPFFELGYEVAHVGFN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQAR-----FIEATFTINTQTLRIGNLYLPHGNP 118
            +NGVAI S+    ++     G                         +RI +LY+P+G  
Sbjct: 61  QWNGVAIASRVGLDDVRVGFEGQPSWSGKPEVAAAAEARALAATCAGVRIWSLYVPNGRA 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           +    Y  K+ W+      A+  L  +    +  AGD+NI PQ  D ++   +      +
Sbjct: 121 VGDPHYAYKLDWLAALRDSAAAWLREDPAAQIALAGDWNIAPQDDDVWSMEFFAGATHVS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R++F  + +  F D +R       +Y++WDY A  + K +G+RID I+ SP     +
Sbjct: 181 EPERRAFNAILDAQFADLVRPFAPGPGVYTYWDYTALRFPKRQGMRIDFILGSPALARRV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSLDIPEPR 267
             A+ID + R     SDH PV+V +   EP 
Sbjct: 241 THAQIDREERKGKGASDHAPVLVDVSRDEPP 271


>gi|298487202|ref|ZP_07005251.1| Exodeoxyribonuclease III [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298158226|gb|EFH99297.1| Exodeoxyribonuclease III [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 270

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 90/270 (33%), Positives = 135/270 (50%), Gaps = 11/270 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPHAEVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD + Q RFI  T    N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNPPLALHKGFEGDDEESQKRFIWGTCADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +            E+PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQTLLESHFSNEQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRHLYPEVVDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLD 262
              + +A +D   RG  KPSDH P+ + L+
Sbjct: 241 QPRIKAAGVDYDLRGMEKPSDHAPIWLELN 270


>gi|254431951|ref|ZP_05045654.1| exodeoxyribonuclease III [Cyanobium sp. PCC 7001]
 gi|197626404|gb|EDY38963.1| exodeoxyribonuclease III [Cyanobium sp. PCC 7001]
          Length = 278

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 90/271 (33%), Positives = 141/271 (52%), Gaps = 4/271 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+R R+  +  W+++  P+++CLQETK  D+ FP +  Q L Y     GQK
Sbjct: 1   MRLASWNVNSVRTRLEQVTTWLEQERPEVLCLQETKVADELFPHDAFQELGYATAISGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHL----PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           +YNGVAILS     ++        PGD    +    +   +     +R+ NLY+P+G+ +
Sbjct: 61  AYNGVAILSLLPLEDVRIGFEALLPGDAEAQELSTQKRVISALVDGVRVLNLYVPNGSAL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S KY  K+ W+    R+ + + E  +PL   GD+NI P+  D ++P         +   
Sbjct: 121 RSEKYAYKLQWLACLRRYLAVQEEQGDPLCMLGDFNIGPEDRDLHDPDRLTGGIMASEAE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           RQ+ ++      TDA R        +S+WDY   +W +++G RIDHI L     +     
Sbjct: 181 RQALREALGDRLTDAFRLFEPEAGHWSWWDYRTGAWDRDRGWRIDHIYLCDTLAACATGC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQ 270
           RI    RG  +PSDH PV+V+L  PE   + 
Sbjct: 241 RIHKHTRGNVQPSDHAPVVVNLAWPEEDPED 271


>gi|158423021|ref|YP_001524313.1| exodeoxyribonuclease III protein [Azorhizobium caulinodans ORS 571]
 gi|158329910|dbj|BAF87395.1| exodeoxyribonuclease III protein [Azorhizobium caulinodans ORS 571]
          Length = 270

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 94/261 (36%), Positives = 146/261 (55%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN +  R+  L  W++++ PD+ CLQE K   + FP   L+   Y     GQK
Sbjct: 1   MRIATFNVNGVNGRLPPLLDWLRQSKPDVACLQELKAPHERFPAAELEQAGYGAVWLGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           ++NGVAIL++ +                              + IG LY P+GNP    K
Sbjct: 61  AWNGVAILARGEMPVETRRGL---PGDPDDIQSRYIEAAVGGVLIGCLYAPNGNPAPGAK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K+ W++R   +++Q L+L+ P++ AGD+NI+P+  D Y P  W +DA F  EVR +F
Sbjct: 118 FDYKLRWLERLRNYSAQMLDLDLPMVLAGDFNIMPEERDVYAPERWRDDALFRPEVRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L++ G+ DA+R  H    LY+FW Y  ++++++ G+RIDH++LSP     L SA +D 
Sbjct: 178 ADLRDDGWVDALRHLHPDARLYTFWKYLRNAFARDAGLRIDHLLLSPALAPRLVSAGVDR 237

Query: 244 KPRGWTKPSDHTPVIVSLDIP 264
             RG    SDH P  ++LD P
Sbjct: 238 AVRGRDHASDHAPAWITLDAP 258


>gi|51596420|ref|YP_070611.1| exonuclease III [Yersinia pseudotuberculosis IP 32953]
 gi|108807521|ref|YP_651437.1| exonuclease III [Yersinia pestis Antiqua]
 gi|108811797|ref|YP_647564.1| exonuclease III [Yersinia pestis Nepal516]
 gi|145598263|ref|YP_001162339.1| exonuclease III [Yersinia pestis Pestoides F]
 gi|149365909|ref|ZP_01887944.1| exodeoxyribonuclease III [Yersinia pestis CA88-4125]
 gi|153949149|ref|YP_001400949.1| exonuclease III [Yersinia pseudotuberculosis IP 31758]
 gi|161484800|ref|NP_669464.2| exonuclease III [Yersinia pestis KIM 10]
 gi|161511386|ref|NP_993308.2| exonuclease III [Yersinia pestis biovar Microtus str. 91001]
 gi|162420660|ref|YP_001606769.1| exonuclease III [Yersinia pestis Angola]
 gi|165927745|ref|ZP_02223577.1| exodeoxyribonuclease III [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939329|ref|ZP_02227877.1| exodeoxyribonuclease III [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166009140|ref|ZP_02230038.1| exodeoxyribonuclease III [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210881|ref|ZP_02236916.1| exodeoxyribonuclease III [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401408|ref|ZP_02306905.1| exodeoxyribonuclease III [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420251|ref|ZP_02312004.1| exodeoxyribonuclease III [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426574|ref|ZP_02318327.1| exodeoxyribonuclease III [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167469881|ref|ZP_02334585.1| exodeoxyribonuclease III [Yersinia pestis FV-1]
 gi|170024319|ref|YP_001720824.1| exonuclease III [Yersinia pseudotuberculosis YPIII]
 gi|186895466|ref|YP_001872578.1| exonuclease III [Yersinia pseudotuberculosis PB1/+]
 gi|218929268|ref|YP_002347143.1| exonuclease III [Yersinia pestis CO92]
 gi|229894844|ref|ZP_04510024.1| exonuclease III [Yersinia pestis Pestoides A]
 gi|229897588|ref|ZP_04512744.1| exonuclease III [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229898233|ref|ZP_04513381.1| exonuclease III [Yersinia pestis biovar Orientalis str. India 195]
 gi|229902093|ref|ZP_04517214.1| exonuclease III [Yersinia pestis Nepal516]
 gi|270490729|ref|ZP_06207803.1| exodeoxyribonuclease III [Yersinia pestis KIM D27]
 gi|294503787|ref|YP_003567849.1| exodeoxyribonuclease III [Yersinia pestis Z176003]
 gi|51589702|emb|CAH21332.1| exodeoxyribonuclease III [Yersinia pseudotuberculosis IP 32953]
 gi|108775445|gb|ABG17964.1| Exodeoxyribonuclease III [Yersinia pestis Nepal516]
 gi|108779434|gb|ABG13492.1| Exodeoxyribonuclease III [Yersinia pestis Antiqua]
 gi|115347879|emb|CAL20799.1| exodeoxyribonuclease III [Yersinia pestis CO92]
 gi|145209959|gb|ABP39366.1| Exodeoxyribonuclease III [Yersinia pestis Pestoides F]
 gi|149292322|gb|EDM42396.1| exodeoxyribonuclease III [Yersinia pestis CA88-4125]
 gi|152960644|gb|ABS48105.1| exodeoxyribonuclease III [Yersinia pseudotuberculosis IP 31758]
 gi|162353475|gb|ABX87423.1| exodeoxyribonuclease III [Yersinia pestis Angola]
 gi|165912670|gb|EDR31299.1| exodeoxyribonuclease III [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165920359|gb|EDR37636.1| exodeoxyribonuclease III [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165991695|gb|EDR43996.1| exodeoxyribonuclease III [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166208061|gb|EDR52541.1| exodeoxyribonuclease III [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961946|gb|EDR57967.1| exodeoxyribonuclease III [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049104|gb|EDR60512.1| exodeoxyribonuclease III [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054450|gb|EDR64262.1| exodeoxyribonuclease III [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169750853|gb|ACA68371.1| exodeoxyribonuclease III [Yersinia pseudotuberculosis YPIII]
 gi|186698492|gb|ACC89121.1| exodeoxyribonuclease III [Yersinia pseudotuberculosis PB1/+]
 gi|229680989|gb|EEO77084.1| exonuclease III [Yersinia pestis Nepal516]
 gi|229688799|gb|EEO80867.1| exonuclease III [Yersinia pestis biovar Orientalis str. India 195]
 gi|229693925|gb|EEO83974.1| exonuclease III [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229702317|gb|EEO90336.1| exonuclease III [Yersinia pestis Pestoides A]
 gi|262362092|gb|ACY58813.1| exodeoxyribonuclease III [Yersinia pestis D106004]
 gi|262365769|gb|ACY62326.1| exodeoxyribonuclease III [Yersinia pestis D182038]
 gi|270339233|gb|EFA50010.1| exodeoxyribonuclease III [Yersinia pestis KIM D27]
 gi|294354246|gb|ADE64587.1| exodeoxyribonuclease III [Yersinia pestis Z176003]
 gi|320015154|gb|ADV98725.1| exonuclease III [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 268

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 87/268 (32%), Positives = 131/268 (48%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEDVSQHGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K QP+ +    P D+ D Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVALLTKEQPLAVRRGFPSDEEDAQRRIIMADLATPQGTLTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  +     R+  ++L  E  ++  GD NI P         D     +      F 
Sbjct: 121 KFPAKARFYADLQRYLEEQLSPEAQVLIMGDLNISPTDLDIGIGEDNRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++LQN G  D  RA +   +  +S++DY +  + +N+G+RID ++ S    + 
Sbjct: 181 PEEREWLERLQNWGLVDTFRAANPDCNDHFSWFDYRSRGFDENRGLRIDLLLASQPLAAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   RG  KPSDH PV     +
Sbjct: 241 CIATGIDYAIRGMEKPSDHAPVWSEFSL 268


>gi|189350943|ref|YP_001946571.1| exodeoxyribonuclease III [Burkholderia multivorans ATCC 17616]
 gi|189334965|dbj|BAG44035.1| exodeoxyribonuclease III [Burkholderia multivorans ATCC 17616]
          Length = 258

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 84/256 (32%), Positives = 133/256 (51%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ FP   L++  Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLAQSAVDVLCLQELKLPDEKFPRADLEAAGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       + +  +    +         +    +RI + Y P+G  + S K
Sbjct: 61  TYNGVAILARDTLPFDESDVVRNIPGFEDTQQRV-IAVTIDGVRIVSAYFPNGQAVGSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    ++    L   GDYNI P+  D ++P  WE +   + + R  F
Sbjct: 120 FLYKMQWLDALHAWLRTEMQRYPKLALLGDYNIAPEDRDVHDPAKWEGENLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            KL  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 180 AKLIELGFVDAFRRFEQPEKTFTWWDYRMFAFRRNAGLRIDHILLSPALAGSCTSCEVDR 239

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDHTPV+ 
Sbjct: 240 VPRTWEQPSDHTPVVA 255


>gi|217977845|ref|YP_002361992.1| exodeoxyribonuclease III [Methylocella silvestris BL2]
 gi|217503221|gb|ACK50630.1| exodeoxyribonuclease III [Methylocella silvestris BL2]
          Length = 258

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 124/258 (48%), Positives = 166/258 (64%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R  +L  ++KE  PD++CLQE K  D+ FP+  +++  Y+    GQK
Sbjct: 1   MQIATWNVNSVRQRTGHLLRYLKEQAPDVLCLQELKCVDEAFPWGEVEAAGYNAAVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAILSK  PIE+   LPGD  D  AR+IEA        +R+ ++YLP+GNP  + K
Sbjct: 61  GFNGVAILSK-APIEVKRGLPGDPTDEHARYIEAVIPHKQSVVRVASIYLPNGNPPDTEK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W+ R +  A + L LEEPL+ AGDYN+IP   DC +P  W  DA F  + R  F
Sbjct: 120 YGYKLAWMDRLIAHARELLRLEEPLVLAGDYNVIPAAADCADPAAWVGDALFLPQTRARF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L N+G TDA+RAT D   LY+FWDY A +W +NKGIRIDH++LSP A   L +  ID 
Sbjct: 180 RTLLNLGLTDALRATTDEAGLYTFWDYQAGAWQRNKGIRIDHLLLSPGAADRLVTTTIDK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R   KPSDH PV + L
Sbjct: 240 GLRAEDKPSDHVPVRIEL 257


>gi|170019904|ref|YP_001724858.1| exonuclease III [Escherichia coli ATCC 8739]
 gi|253773296|ref|YP_003036127.1| exonuclease III [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|300818391|ref|ZP_07098601.1| exodeoxyribonuclease III [Escherichia coli MS 107-1]
 gi|300904608|ref|ZP_07122444.1| exodeoxyribonuclease III [Escherichia coli MS 84-1]
 gi|300924797|ref|ZP_07140737.1| exodeoxyribonuclease III [Escherichia coli MS 182-1]
 gi|300951354|ref|ZP_07165196.1| exodeoxyribonuclease III [Escherichia coli MS 116-1]
 gi|300958643|ref|ZP_07170767.1| exodeoxyribonuclease III [Escherichia coli MS 175-1]
 gi|301303958|ref|ZP_07210076.1| exodeoxyribonuclease III [Escherichia coli MS 124-1]
 gi|301327485|ref|ZP_07220718.1| exodeoxyribonuclease III [Escherichia coli MS 78-1]
 gi|301647945|ref|ZP_07247720.1| exodeoxyribonuclease III [Escherichia coli MS 146-1]
 gi|309793523|ref|ZP_07687950.1| exodeoxyribonuclease III [Escherichia coli MS 145-7]
 gi|331642351|ref|ZP_08343486.1| exodeoxyribonuclease III [Escherichia coli H736]
 gi|169754832|gb|ACA77531.1| exodeoxyribonuclease III [Escherichia coli ATCC 8739]
 gi|253324340|gb|ACT28942.1| exodeoxyribonuclease III [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|260449129|gb|ACX39551.1| exodeoxyribonuclease III [Escherichia coli DH1]
 gi|300314694|gb|EFJ64478.1| exodeoxyribonuclease III [Escherichia coli MS 175-1]
 gi|300403439|gb|EFJ86977.1| exodeoxyribonuclease III [Escherichia coli MS 84-1]
 gi|300419004|gb|EFK02315.1| exodeoxyribonuclease III [Escherichia coli MS 182-1]
 gi|300449344|gb|EFK12964.1| exodeoxyribonuclease III [Escherichia coli MS 116-1]
 gi|300529031|gb|EFK50093.1| exodeoxyribonuclease III [Escherichia coli MS 107-1]
 gi|300840755|gb|EFK68515.1| exodeoxyribonuclease III [Escherichia coli MS 124-1]
 gi|300845916|gb|EFK73676.1| exodeoxyribonuclease III [Escherichia coli MS 78-1]
 gi|301073916|gb|EFK88722.1| exodeoxyribonuclease III [Escherichia coli MS 146-1]
 gi|308123110|gb|EFO60372.1| exodeoxyribonuclease III [Escherichia coli MS 145-7]
 gi|315061052|gb|ADT75379.1| exonuclease III [Escherichia coli W]
 gi|315136390|dbj|BAJ43549.1| exonuclease III [Escherichia coli DH1]
 gi|315257443|gb|EFU37411.1| exodeoxyribonuclease III [Escherichia coli MS 85-1]
 gi|324016423|gb|EGB85642.1| exodeoxyribonuclease III [Escherichia coli MS 117-3]
 gi|331039149|gb|EGI11369.1| exodeoxyribonuclease III [Escherichia coli H736]
          Length = 272

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 124/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSLLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ + P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMDRLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|229591315|ref|YP_002873434.1| exonuclease III [Pseudomonas fluorescens SBW25]
 gi|229363181|emb|CAY50233.1| exodeoxyribonuclease III [Pseudomonas fluorescens SBW25]
          Length = 270

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 85/269 (31%), Positives = 132/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP   +Q+L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIEKHQPDVIGLQETKVHDDQFPLAEVQALGYHVYYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+   + +      D+ D Q RFI  TF   + Q + I N Y P G      
Sbjct: 61  GHYGVALLSRQPALSLHKGFASDEEDAQRRFIWGTFADEHGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +   +    +   ++ L+  GD NI P+        D     +      F
Sbjct: 121 TKFPAKQRFYEDLQQLLESQFSNDQALVVMGDVNISPEDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+   +L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMARLKNWGLVDSFRHLNPDVVDRFSWFDYRSRGFEDEPKRGLRIDVIMASNGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +  A +D   RG  KPSDH P+ + L
Sbjct: 241 LPRVKDAGVDYDLRGLEKPSDHAPIWLEL 269


>gi|256393746|ref|YP_003115310.1| exodeoxyribonuclease III Xth [Catenulispora acidiphila DSM 44928]
 gi|256359972|gb|ACU73469.1| exodeoxyribonuclease III Xth [Catenulispora acidiphila DSM 44928]
          Length = 261

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 78/261 (29%), Positives = 120/261 (45%), Gaps = 1/261 (0%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           VV VATWNVNS+ AR+  L  W+    PD++CLQE KT D+ FP   L  + Y   T G 
Sbjct: 2   VVRVATWNVNSVTARVERLVGWLDSAKPDVVCLQELKTTDEAFPAGQLADVGYQAATWGT 61

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
             +NGVAILS+    ++    P            A        +R+  +Y+P+G  +   
Sbjct: 62  GRWNGVAILSRLPIADVWRGWPDLPDFDGVAEPRALTATCGG-VRVTCVYVPNGRELGHP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
            +D K+ W+       ++    E P    GD+NI P   D ++  ++      T   R  
Sbjct: 121 HFDYKLRWLDSLTASVAEPARGELPYAVLGDFNIAPTDADVWDMSLFAESTHVTPAERAK 180

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
              L+  G  + +         Y++WDY   ++ KN G+RID +  +      +  A +D
Sbjct: 181 LADLEAQGLVEVLPRALKYDKPYTYWDYRQLAFPKNNGMRIDLVFGNAAFAGAVRDAYVD 240

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
            + R     SDH PV+V LD+
Sbjct: 241 REERKGKGASDHAPVVVDLDV 261


>gi|71735024|ref|YP_274825.1| exonuclease III [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257487832|ref|ZP_05641873.1| exonuclease III [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289625127|ref|ZP_06458081.1| exonuclease III [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289648704|ref|ZP_06480047.1| exonuclease III [Pseudomonas syringae pv. aesculi str. 2250]
 gi|71555577|gb|AAZ34788.1| exodeoxyribonuclease III [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|320324615|gb|EFW80692.1| exonuclease III [Pseudomonas syringae pv. glycinea str. B076]
 gi|320328987|gb|EFW84986.1| exonuclease III [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330867998|gb|EGH02707.1| exonuclease III [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330880714|gb|EGH14863.1| exonuclease III [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330985313|gb|EGH83416.1| exonuclease III [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331008544|gb|EGH88600.1| exonuclease III [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 270

 Score =  205 bits (521), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 90/270 (33%), Positives = 136/270 (50%), Gaps = 11/270 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPHAEVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD + Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNPPLALHKGFEGDDEESQKRFIWGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +            E+PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQTLLESHFSNEQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRHLYPEVVDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLD 262
              + +A +D   RG  KPSDH P+ + L+
Sbjct: 241 QPRIKAAGVDYDLRGMEKPSDHAPIWLELN 270


>gi|320086216|emb|CBY95990.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 292

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 77/269 (28%), Positives = 122/269 (45%), Gaps = 8/269 (2%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
            +   ++N+N +RAR H L A ++++ PD+I LQETK  D+ FP E +  L Y++   GQ
Sbjct: 24  TMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDEMFPLEEVAKLGYNVFYHGQ 83

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G      
Sbjct: 84  KGHYGVALLTKATPISVRRGFPDDGEEAQRRIIMAEIPSPLGNITVINGYFPQGESRDHP 143

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
            K+  K  + +    +    L+ + P++  GD NI P         +     +      F
Sbjct: 144 LKFPAKAQFYQNLQNYLETELKCDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSF 203

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S     
Sbjct: 204 LPEEREWMSRLLKWGLVDTFREANPQTMDKFSWFDYRSKGFVDNRGLRIDLLLASAPLAE 263

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                 ID   R   KPSDH PV  +  +
Sbjct: 264 RCAETGIDYDIRSMEKPSDHAPVWATFRV 292


>gi|307153787|ref|YP_003889171.1| exodeoxyribonuclease III [Cyanothece sp. PCC 7822]
 gi|306984015|gb|ADN15896.1| exodeoxyribonuclease III [Cyanothece sp. PCC 7822]
          Length = 264

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 90/264 (34%), Positives = 130/264 (49%), Gaps = 6/264 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R   ++ W++ N  D++CLQETK  D +FP    + L YH+   GQ 
Sbjct: 1   MKIATWNVNSIRIRQQQVSHWLQMNPVDVLCLQETKVIDADFPKMPFEELGYHLYISGQP 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT-----INTQTLRIGNLYLPHGNP 118
           SYNGVA+LS+    ++                               +RI NLY+P+G  
Sbjct: 61  SYNGVALLSRQPLEDVRIGFTQVLGVDDVLAATFDQQKRVISGIFHDVRIVNLYVPNGAD 120

Query: 119 ITSTKYDDK-ISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTL 177
           ++S KY  K              +    + L   GD+N+ P+  D +NP   E     T 
Sbjct: 121 LSSDKYAYKLQWLKMLRNYLTLFKENYPQELCVCGDFNVAPEDKDIHNPKGKETHIMATP 180

Query: 178 EVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLH 237
           + R++ Q++  +G  DA R        YS+WDY +  + +N+G RIDH  L+P+      
Sbjct: 181 QERKALQEVLEIGLKDAFRKFTAEGGHYSWWDYRSGGFQRNRGWRIDHHFLTPKLYEQAT 240

Query: 238 SARIDTKPRGWTKPSDHTPVIVSL 261
           S  ID +PR   KPSDHTPVIV  
Sbjct: 241 SCTIDIEPRKQEKPSDHTPVIVEF 264


>gi|170694716|ref|ZP_02885867.1| exodeoxyribonuclease III Xth [Burkholderia graminis C4D1M]
 gi|170140347|gb|EDT08524.1| exodeoxyribonuclease III Xth [Burkholderia graminis C4D1M]
          Length = 258

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 83/258 (32%), Positives = 128/258 (49%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R  ++  W++ +  D++CLQE K  D+ FP   L+   Y     GQK
Sbjct: 1   MKIATWNVNSLKVRQQHVIDWLETSGTDVLCLQELKLPDEKFPRAELEEKGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGV IL +   + +       ++       +       + +RI + Y P+G    + K
Sbjct: 61  TYNGVGILVR-AGLNVDEASVVRNIPGFDDLQQRVVAATVEGVRIISAYFPNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    + L   L   GDYNI P   D ++P  WE     + E R  F
Sbjct: 120 FAYKLRWLAALHDWVKSEMALYPKLALLGDYNIAPDDRDVHDPKAWEGQNLVSPEERAEF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +G  DA R       +YS+WDY   ++ +N G+RIDHI+LS        S  +D 
Sbjct: 180 VRLIELGLVDAFRQFEQPEKIYSWWDYRMMAFRRNAGLRIDHILLSKALAETCASCEVDK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDH PV+  L
Sbjct: 240 VPRKWDQPSDHAPVVAQL 257


>gi|309812281|ref|ZP_07706036.1| exodeoxyribonuclease III [Dermacoccus sp. Ellin185]
 gi|308433586|gb|EFP57463.1| exodeoxyribonuclease III [Dermacoccus sp. Ellin185]
          Length = 262

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 80/262 (30%), Positives = 127/262 (48%), Gaps = 3/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R+  + A+++  + D++ +QETK +D+ FP    +   Y +   G  
Sbjct: 1   MRIATWNVNSIRTRVDRVIAFLERGDVDVLAMQETKCKDEQFPMARFEEAGYEVAHHGLN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT-LRIGNLYLPHGNPITST 122
            +NGVAI S+    ++                EA     T   +R+ +LY+P+G  I   
Sbjct: 61  QWNGVAIASRVGLEDVQIGFEDMPGFGDPIAAEARAIAATCDGVRMWSLYVPNGREIGHP 120

Query: 123 KYDDKISWIKRFLRFASQRL--ELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
            Y+ K+ W+        + L    E  +   GD+NI P+  D ++P  +E     T   R
Sbjct: 121 HYEYKLDWLAALRADGEKWLTENPEAQIALTGDWNIAPRDEDVWDPAFFEGKTHVTQPER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +FQ + + G+ D +R   +    Y++WDY    + K +G+RID  + SP     +  A 
Sbjct: 181 DAFQAMIDTGYADVVRPHTNEPRTYTYWDYTQLRFPKKQGMRIDFALCSPALAGRVQGAV 240

Query: 241 IDTKPRGWTKPSDHTPVIVSLD 262
           ID   R     SDH PVIV LD
Sbjct: 241 IDRDERKGKGASDHAPVIVQLD 262


>gi|283785027|ref|YP_003364892.1| exodeoxyribonuclease III [Citrobacter rodentium ICC168]
 gi|282948481|emb|CBG88070.1| exodeoxyribonuclease III [Citrobacter rodentium ICC168]
          Length = 268

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 82/268 (30%), Positives = 124/268 (46%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEDVARLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPDDGEEAQRRIIMAELPSPLGNVTVINGYFPQGESRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACFT 176
           K+  K  + +    +    L+ + P++  GD NI P   D           +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLDSELKRDNPVLIMGDMNISPSDRDIGIGEENRRRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L N G  D  R  H   +  +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLLNWGLVDTFRHAHPETNDKFSWFDYRSKGFDDNRGLRIDLLLASQPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   RG  KPSDH PV    D+
Sbjct: 241 CVETGIDYAIRGMEKPSDHAPVWAKFDV 268


>gi|227885825|ref|ZP_04003630.1| exodeoxyribonuclease III [Escherichia coli 83972]
 gi|301050910|ref|ZP_07197761.1| exodeoxyribonuclease III [Escherichia coli MS 185-1]
 gi|26108407|gb|AAN80609.1|AE016761_184 Exodeoxyribonuclease III [Escherichia coli CFT073]
 gi|227837398|gb|EEJ47864.1| exodeoxyribonuclease III [Escherichia coli 83972]
 gi|300297429|gb|EFJ53814.1| exodeoxyribonuclease III [Escherichia coli MS 185-1]
 gi|307553768|gb|ADN46543.1| exodeoxyribonuclease III [Escherichia coli ABU 83972]
          Length = 272

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 125/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ E P++  GD NI P         +     +      
Sbjct: 123 PIKFSAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|301168642|emb|CBW28232.1| exonuclease III [Haemophilus influenzae 10810]
          Length = 267

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 127/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  +    P D+ D Q R I A        L   N Y P G      T
Sbjct: 61  GHYGVALLTKQEPKVVRRGFPTDNEDAQKRIIMADLETEFGLLTAINGYFPQGESRAHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R  +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDDNRGLRIDHILVSQKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|242239395|ref|YP_002987576.1| exodeoxyribonuclease III [Dickeya dadantii Ech703]
 gi|242131452|gb|ACS85754.1| exodeoxyribonuclease III [Dickeya dadantii Ech703]
          Length = 268

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 84/266 (31%), Positives = 125/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAVIEQHQPDVIGLQETKVHDDVFPLEDVAKFGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L++  P+ +    P D+ D Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVAMLTRNTPLAVRRGFPTDEEDAQRRIIMADLETPLGTLTVINGYFPQGESRDHPV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +       E+P++  GD NI P         D     +      F 
Sbjct: 121 KFPAKTRFYQDLQHYLEHHHNAEQPVLIMGDMNISPTDLDIGIGEDSRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +LQ+ G  D  RA +      +S++DY +  +  N+G+RID I+ S    S 
Sbjct: 181 PEEREWMLRLQDWGLVDTFRAQNPECRDRFSWFDYRSSGFDDNRGLRIDLILASQPLASR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
             +  ID   R   KPSDH P+    
Sbjct: 241 CSATGIDYAIRSMEKPSDHAPIWAEF 266


>gi|300930770|ref|ZP_07146143.1| exodeoxyribonuclease III [Escherichia coli MS 187-1]
 gi|300461403|gb|EFK24896.1| exodeoxyribonuclease III [Escherichia coli MS 187-1]
          Length = 272

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 124/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSLLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ + P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQHLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMDRLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|307729190|ref|YP_003906414.1| exodeoxyribonuclease III Xth [Burkholderia sp. CCGE1003]
 gi|307583725|gb|ADN57123.1| exodeoxyribonuclease III Xth [Burkholderia sp. CCGE1003]
          Length = 258

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 84/258 (32%), Positives = 128/258 (49%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R  ++  W++ +  D++CLQE K  D+ FP   L+   Y     GQK
Sbjct: 1   MKIATWNVNSLKVRQQHVIDWLETSRTDVLCLQELKLPDEKFPRAELEEKGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGV IL + + I +       ++       +         +RI + Y P+G    + K
Sbjct: 61  TYNGVGILVR-EGISVDETTIVRNIPGFDDLQQRVVAATVDGVRIISAYFPNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    + L   L   GDYNI P   D ++P  WE     + E R  F
Sbjct: 120 FAYKLRWLAALHDWVQSEMALYPKLALLGDYNIAPDDRDVHDPKAWEGQNLVSPEERAEF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +G  DA R       +YS+WDY   ++ +N G+RIDHI+LS        S  +D 
Sbjct: 180 VRLTELGLVDAFRQFEQPEKIYSWWDYRMMAFRRNAGLRIDHILLSKPLAETCTSCEVDK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDH PV+  L
Sbjct: 240 VPRKWDQPSDHAPVVAQL 257


>gi|254228998|ref|ZP_04922419.1| exodeoxyribonuclease III [Vibrio sp. Ex25]
 gi|262394738|ref|YP_003286592.1| exodeoxyribonuclease III [Vibrio sp. Ex25]
 gi|151938466|gb|EDN57303.1| exodeoxyribonuclease III [Vibrio sp. Ex25]
 gi|262338332|gb|ACY52127.1| exodeoxyribonuclease III [Vibrio sp. Ex25]
          Length = 268

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 133/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPIEAVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +P+ +    P  ++   +   +      N + + + N Y P G+ I+  
Sbjct: 61  AHYGVAMLCKQEPLHVQKGFPTDNEEHQKRMIMATFLNENGEKVTVLNGYFPQGDNISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYKDLMTYLNDHHNSDEQLIVMGDINISPIDADIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D  R  +   +  +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLKTLLDWGFEDTFRKLYPEVNDQFSWFDYRSRGFDDNRGLRIDVILATPSLAQ 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  +  
Sbjct: 241 KCIDSGIDYELRGIEKPSDHAPIWSTFK 268


>gi|261493298|ref|ZP_05989824.1| exodeoxyribonuclease III [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496564|ref|ZP_05992944.1| exodeoxyribonuclease III [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261307767|gb|EEY09090.1| exodeoxyribonuclease III [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261310942|gb|EEY12119.1| exodeoxyribonuclease III [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 291

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 84/267 (31%), Positives = 130/267 (48%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I+++ PD++ LQE K  D++FP++ +  L YH+   GQK
Sbjct: 25  MKFISFNINGLRARPHQLEAIIEKHQPDVLGLQEIKVADEDFPYDLVNHLGYHVFHHGQK 84

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +PI +    P D LD Q R I A    +   L + N Y P G   +  T
Sbjct: 85  GHYGVALLTKKEPIAVRKGFPTDVLDAQKRMIMADIETDFGVLTVLNGYFPQGENRSHET 144

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +      +    L+ E P+I  GD NI P               + +    F 
Sbjct: 145 KFPAKQKFYADLQNYLESELKPENPIIIMGDMNISPTDLDIGIGEPNRKRWLRDGKCSFL 204

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  RA +   +  +S++DY +  +  N+G+RID I+ S      
Sbjct: 205 PEEREWLDRLYSYGLVDTFRAGNPDVNDKFSWFDYRSKGFDDNRGLRIDLILASKSLAER 264

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                ID   R   KPSDH+PV  +  
Sbjct: 265 CVETGIDLDIRAMEKPSDHSPVWATFK 291


>gi|307329665|ref|ZP_07608823.1| exodeoxyribonuclease III Xth [Streptomyces violaceusniger Tu 4113]
 gi|306884723|gb|EFN15751.1| exodeoxyribonuclease III Xth [Streptomyces violaceusniger Tu 4113]
          Length = 259

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 74/260 (28%), Positives = 128/260 (49%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSI AR+  L AW++ +  D++C+QETK  +  FP+E L+ L Y        
Sbjct: 1   MRIATWNVNSITARLPRLLAWLESSGTDVLCVQETKCAESAFPYEPLRELGYEAAVNATG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVA++SK    ++   LPG       +   A        +R+ ++Y+P+G  I    
Sbjct: 61  RWNGVALVSKAGLTDVTVGLPGGPDYDGDQEPRAIGATCGP-VRLWSVYVPNGREIGHPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD K+ W++      +     + P    GD+N+ P   D ++   ++     T   R++ 
Sbjct: 120 YDYKLRWLEALRTAVAGDAAGDRPFAVLGDFNVAPTDEDVWDRSAFDGLTHVTDLEREAL 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L+  G +D +         +++WDY    + KN+G+RID +  +      +  A +D 
Sbjct: 180 AALREAGLSDVVPRPLKYDRPFTYWDYRELGFPKNRGMRIDLVYGNEVFAKAVGDAYVDR 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R     SDH PV+V L++
Sbjct: 240 EERKGKGASDHAPVVVDLEV 259


>gi|327480794|gb|AEA84104.1| exonuclease III [Pseudomonas stutzeri DSM 4166]
          Length = 270

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 83/269 (30%), Positives = 131/269 (48%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H L+A I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLSAIIDKHQPDVIGLQETKVADEQFPQAEIEALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+E+    P D  + Q RFI   F   N Q + + N Y P G      
Sbjct: 61  GHYGVALLSRQAPLEVHKGFPSDGEESQKRFIWGRFADANGQPVTVMNGYFPQGESRAHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+  K  +         QR   +E L   GD+NI PQ  D           +      F
Sbjct: 121 VKFPAKTKFYADLQALLEQRFSPDESLALMGDFNISPQDCDIGIGEVNAKRWLRTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKN--KGIRIDHIMLSPEA 232
             E R+  ++++  G  D+ R  +      +S++DY +  +     +G+RID+I+ +   
Sbjct: 181 LPEEREWLERIKGWGLQDSFRTLNPKVVDRFSWFDYRSRGFEDEPRRGLRIDYILTTHAL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +    +D   R   KPSDH PV + L
Sbjct: 241 HERVTDCGVDYDIRAMEKPSDHCPVWIEL 269


>gi|91225244|ref|ZP_01260412.1| exodeoxyribonuclease III [Vibrio alginolyticus 12G01]
 gi|91189883|gb|EAS76155.1| exodeoxyribonuclease III [Vibrio alginolyticus 12G01]
          Length = 268

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 133/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPIEAVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +P+ +    P  ++   +   +      N + + + N Y P G+ I+  
Sbjct: 61  AHYGVAMLCKQEPLHVQKGFPTDNEEHQKRMIMATFLNENGEKVTVLNGYFPQGDNISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYKDLMTYLNDHHNNDEQLIVMGDINISPIDADIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D  R  +   +  +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLKTLLDWGFVDTFRKLYPEVNDQFSWFDYRSRGFDDNRGLRIDVILATPSLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  +  
Sbjct: 241 KCIESGIDYELRGIEKPSDHAPIWSTFK 268


>gi|323526639|ref|YP_004228792.1| exodeoxyribonuclease III Xth [Burkholderia sp. CCGE1001]
 gi|323383641|gb|ADX55732.1| exodeoxyribonuclease III Xth [Burkholderia sp. CCGE1001]
          Length = 259

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 81/258 (31%), Positives = 127/258 (49%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R  ++  W++ +  D++CLQE K  D+ FP   L+   Y     GQK
Sbjct: 1   MKIATWNVNSLKVRQQHVIDWLETSRTDVLCLQELKLPDEKFPRAELEEKGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGV IL +   + +       ++       +         +R+ + Y P+G    + K
Sbjct: 61  TYNGVGILVREG-LSVDEASVVRNIPGFEDLQQRVVAATVDGVRVISAYFPNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    + L   L   GDYNI P   D ++P  WE     + E R  F
Sbjct: 120 FAYKLRWLAALHDWVRSEMALYPKLALLGDYNIAPDDRDVHDPKAWEGQNLVSPEERAEF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +G  DA R       +YS+WDY   ++ +N G+RIDHI+LS        S  +D 
Sbjct: 180 VRLTELGLVDAFRQFDQPEKIYSWWDYRMMAFRRNAGLRIDHILLSKPLAETCTSCEVDK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDH PV+  +
Sbjct: 240 VPRKWDQPSDHAPVVAQI 257


>gi|152984142|ref|YP_001348052.1| exonuclease III [Pseudomonas aeruginosa PA7]
 gi|150959300|gb|ABR81325.1| exodeoxyribonuclease III [Pseudomonas aeruginosa PA7]
          Length = 270

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 88/269 (32%), Positives = 129/269 (47%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+ + PD+I LQETK  D  FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIERHQPDVIGLQETKVADDQFPQAEIEALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+E+    P D  + Q RFI  TF       L + N Y P G      
Sbjct: 61  GHYGVALLSRQAPLELHRGFPSDGEESQRRFIWGTFADAQGNPLTVMNGYFPQGENRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+  K  +            + E+ L+  GD NI P+  D           +      F
Sbjct: 121 TKFPAKQRFYADLQLLLENSFKPEQALVVMGDINISPEDCDIGIGEENRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+    L+N G  D+ RA +      +S++DY +  +     +G+RID I+ S   
Sbjct: 181 LPEEREWLATLKNWGLVDSFRALNPEVTDRFSWFDYRSRGFEDTPKRGLRIDVILASRAL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
            S    A ID   RG  KPSDH P+ + L
Sbjct: 241 QSRFRDAGIDYDLRGMEKPSDHAPIWLEL 269


>gi|114321929|ref|YP_743612.1| exodeoxyribonuclease III [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228323|gb|ABI58122.1| Exodeoxyribonuclease III [Alkalilimnicola ehrlichii MLHE-1]
          Length = 258

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 84/262 (32%), Positives = 138/262 (52%), Gaps = 5/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS++ R+  +  W++   PD++ LQETK  D+ FP E L    Y +   GQ 
Sbjct: 1   MKLASWNVNSLKVRLPQVLDWLESRQPDLVGLQETKLTDERFPAEALNEAGYQVAYAGQP 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+L++ +  E V        D Q R +  T       LR  NLY+P+G+ + S K
Sbjct: 61  TYNGVAVLARGRAPEAVIRDIPGLDDPQRRVLGVTVG----DLRFINLYVPNGSEVGSEK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACF-TLEVRQS 182
           Y  K+ W+ R   + ++     + L+  GD+NI P   D ++P +W       T E    
Sbjct: 117 YAYKLDWLARLADWLAEERRRHDKLVVVGDFNIAPDDRDVHDPELWREKVLCSTPEREAL 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
            +    +G TD  R       ++S+WDY  +++ +N+G+RID ++ SP       S+ +D
Sbjct: 177 RRLTGELGLTDTFRLFDQPEKVWSWWDYRMNNFKRNRGLRIDLVLASPALYQACTSSYVD 236

Query: 243 TKPRGWTKPSDHTPVIVSLDIP 264
            +PR W +PSDH P +   ++ 
Sbjct: 237 REPRTWERPSDHAPAVAEFNLD 258


>gi|33593125|ref|NP_880769.1| putative exodeoxyribonuclease III [Bordetella pertussis Tohama I]
 gi|33563500|emb|CAE42388.1| putative exodeoxyribonuclease III [Bordetella pertussis Tohama I]
          Length = 260

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 87/261 (33%), Positives = 130/261 (49%), Gaps = 1/261 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+  N  D +C+QE K  D  FP +      YH    GQK
Sbjct: 1   MKLATWNVNSLNVRLPQVLDWLAANPVDALCIQELKLTDDKFPLDAFTEAGYHAAWAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+     +V + P    D Q R +  T       +R+   Y P+G  + S K
Sbjct: 61  TYNGVAIISREPGFALVRNNP-RYEDPQQRILAVTLPSPAGDVRVICAYCPNGQSVDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K++W      +  + +     L   GDYN+ P   D +NP  WE     +   R +F
Sbjct: 120 YVYKLAWFDGLRDWLEEEMRTYPRLAILGDYNVAPADADVHNPEKWEGQVLVSEPERAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD+ R        +S+WDY   ++ +N G+RIDH++LS        +  ID 
Sbjct: 180 RALLDLGLTDSFRLFEQPEKSFSWWDYRQFAFRRNAGLRIDHVLLSDALKPHCVACVIDK 239

Query: 244 KPRGWTKPSDHTPVIVSLDIP 264
            PR   +PSDH PVI +L   
Sbjct: 240 APRANEQPSDHAPVIATLAFD 260


>gi|332187206|ref|ZP_08388946.1| exodeoxyribonuclease III [Sphingomonas sp. S17]
 gi|332012906|gb|EGI54971.1| exodeoxyribonuclease III [Sphingomonas sp. S17]
          Length = 257

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 101/259 (38%), Positives = 152/259 (58%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + T+NVN I+AR+  L  ++ E + DI+CLQE K  D+ FP   +++  Y     GQK
Sbjct: 1   MKITTYNVNGIKARLPRLLEYLAEADADIVCLQELKASDETFPVADIEAAGYGAVWHGQK 60

Query: 64  SYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           S+NGVA+L++  QP+E    L G+D D  +R++E         L + +LYLP+GNP    
Sbjct: 61  SWNGVAVLARGAQPVERQRGLAGEDEDEHSRYLECEVNG----LVVASLYLPNGNPQPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W++R    A + L  E P + AGDYN+IP   D ++     +DA    E RQ+
Sbjct: 117 KFDYKLRWMERLAARARELLAEEVPAVLAGDYNVIPNDDDTFSVPAMASDALMQPESRQA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           +++L   G+TD++R       +++FWDY A SW ++ G RIDH++LSP+A   L  A +D
Sbjct: 177 YRRLLTQGWTDSVRTRAPKGGVWTFWDYQAGSWQRDAGFRIDHLLLSPQAADRLVDAGVD 236

Query: 243 TKPRGWTKPSDHTPVIVSL 261
              RG  K SDH P  V L
Sbjct: 237 KSYRGREKASDHAPTWVRL 255


>gi|300994386|ref|ZP_07180891.1| exodeoxyribonuclease III [Escherichia coli MS 45-1]
 gi|300406232|gb|EFJ89770.1| exodeoxyribonuclease III [Escherichia coli MS 45-1]
 gi|315290452|gb|EFU49827.1| exodeoxyribonuclease III [Escherichia coli MS 153-1]
          Length = 272

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 125/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ E P++  GD NI P         +     +      
Sbjct: 123 PIKFSAKAQFYQNLHNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|118472074|ref|YP_885233.1| exodeoxyribonuclease III [Mycobacterium smegmatis str. MC2 155]
 gi|118173361|gb|ABK74257.1| exodeoxyribonuclease III [Mycobacterium smegmatis str. MC2 155]
          Length = 260

 Score =  205 bits (520), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 79/261 (30%), Positives = 121/261 (46%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + VATWNVNSIRAR+  +  W+   + D++ +QETK  D  FP      L Y +   G  
Sbjct: 1   MRVATWNVNSIRARVDRVTDWLARADVDVLAMQETKCSDDKFPAMPFVELGYEVAYHGLN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            +NGVAI S+     +            A    A        +R+ +LY+P+G  + S  
Sbjct: 61  QWNGVAIASRVGLENVQLGFDNQPAWEAAAEARALAATCG-GVRVWSLYVPNGRTVDSPH 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIF--AGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
           Y  K+ W+      A + L  +        GD+NI P   D ++   +      T + R 
Sbjct: 120 YAYKLEWLAALRDNAQKWLADDPQAQIALTGDWNIAPTDEDVWDIDFFAGSTHVTEKERA 179

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +FQ + +  F D +R       +Y++WDY    + K +G+RID I+ SP     +  A I
Sbjct: 180 AFQAIVDAQFADVVRPFAPGPGVYTYWDYTQLRFPKRQGMRIDFILGSPAFAQRVGHAEI 239

Query: 242 DTKPRGWTKPSDHTPVIVSLD 262
             + R    PSDH PV+V L+
Sbjct: 240 VREERKGKSPSDHAPVLVELN 260


>gi|261401182|ref|ZP_05987307.1| exodeoxyribonuclease III [Neisseria lactamica ATCC 23970]
 gi|269208860|gb|EEZ75315.1| exodeoxyribonuclease III [Neisseria lactamica ATCC 23970]
          Length = 256

 Score =  205 bits (520), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 132/260 (50%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRNAPEDVHFGLPSLPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRYGKLVLLGDFNIAPADADCYDPKKWYEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP     L   R+D 
Sbjct: 177 QNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAEALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R   +PSDH PV    D 
Sbjct: 237 DTRALERPSDHAPVTAEFDW 256


>gi|226304979|ref|YP_002764937.1| exodeoxyribonuclease III [Rhodococcus erythropolis PR4]
 gi|226184094|dbj|BAH32198.1| putative exodeoxyribonuclease III [Rhodococcus erythropolis PR4]
          Length = 266

 Score =  205 bits (520), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 75/265 (28%), Positives = 125/265 (47%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   +  W+  ++ D++ +QETK +D+ FP+E  + + Y +   G  
Sbjct: 1   MRIATWNVNSVRARTDRIIDWLGRSDVDVLAMQETKCKDEQFPYERFKEIGYEVAHVGLS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARF-----IEATFTINTQTLRIGNLYLPHGNP 118
            +NGVAI S+    ++           +                   +R+ +LY+P+G  
Sbjct: 61  QWNGVAIASRVGLDDVQIGFEDQPGFDKDPEADPVREARAIGATCGGVRVWSLYVPNGRE 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEEPLIF--AGDYNIIPQPHDCYNPIIWENDACFT 176
           +    Y  K+ W+ +    A   L+ +        GD+N+ P   D ++P  +E     +
Sbjct: 121 LEDPHYAYKLDWLAKLRDDAEGWLKQDPDAQIALVGDWNVAPTDDDVWDPAFFEGKTHTS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R +F      GF D +R       +Y++WDY    + K +G+RID I+ SP   + +
Sbjct: 181 EPERAAFTAFTESGFADVVRPYTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPAFAARV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
            +A ID   R     SDH PVIV L
Sbjct: 241 EAAEIDRNERKGKGASDHAPVIVKL 265


>gi|238894275|ref|YP_002919009.1| exonuclease III [Klebsiella pneumoniae NTUH-K2044]
 gi|238546591|dbj|BAH62942.1| exonuclease III [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 272

 Score =  205 bits (520), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 82/268 (30%), Positives = 127/268 (47%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H LAA ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLAAIVEKHQPDVIGLQETKVHDDMFPLEEVARLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPDDGEEAQRRIIMAEIPSPFGNVTVINGYFPQGESRDH 122

Query: 122 -TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
            TK+  K ++ +    +    L  E P++  GD NI P         +     +      
Sbjct: 123 ETKFPAKAAFYQNLQNYLETELNKENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHH-LYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+   +L   G  D  R  +  +H  +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMDRLLGWGLVDTWRQANPDNHEHFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + RG  KPSDH PV  + 
Sbjct: 243 QRCVETGIDYEIRGMEKPSDHAPVWATF 270


>gi|33866339|ref|NP_897898.1| exodeoxyribonuclease III [Synechococcus sp. WH 8102]
 gi|33639314|emb|CAE08322.1| exodeoxyribonuclease III [Synechococcus sp. WH 8102]
          Length = 278

 Score =  204 bits (519), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 87/265 (32%), Positives = 138/265 (52%), Gaps = 4/265 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+  +  W+++  PD++CLQETK +D  FP +  ++  + +   GQK
Sbjct: 1   MRIATWNVNSVRTRLEQVLCWLEQTKPDLLCLQETKVDDPLFPMQAFENAGWQVSIHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARF----IEATFTINTQTLRIGNLYLPHGNPI 119
           SYNGVA++S+    ++     G+  D              +     +R+ NLY+P+G+ +
Sbjct: 61  SYNGVALVSREPLEDVRCGFVGELPDDAEAATLGEQRRVISGLLDGVRVLNLYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           +S KY  K++W+    R+   + E  EPL   GD+NI  +  D ++P         +   
Sbjct: 121 SSEKYPYKLTWLGCLKRYLDAQAERGEPLCMVGDFNIALEARDIHDPDRLSGSVMASDAE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R + ++       DA R        +S+WDY   +W +++G RIDHI L  E   L  S 
Sbjct: 181 RDALREALGNRLQDAFRMFEPDAGHWSWWDYRTGAWDRDRGWRIDHIYLCEELMGLARSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIP 264
            I  + RG  +PSDH PV V LD P
Sbjct: 241 SIHKQLRGNVQPSDHAPVSVDLDWP 265


>gi|269967644|ref|ZP_06181694.1| exodeoxyribonuclease III [Vibrio alginolyticus 40B]
 gi|269827731|gb|EEZ82015.1| exodeoxyribonuclease III [Vibrio alginolyticus 40B]
          Length = 268

 Score =  204 bits (519), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 133/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPIEAVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +P+ +    P  ++   +   +      N + + + N Y P G+ I+  
Sbjct: 61  AHYGVAMLCKQEPLHVQKGFPTDNEEHQKRMIMATFLNENGEKVTVLNGYFPQGDNISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYKDLMTYLNDHHNNDEQLIVMGDINISPIDADIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D  R  +   +  +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLKALLDWGFVDTFRKLYPEVNDQFSWFDYRSRGFDDNRGLRIDVILATPSLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  +  
Sbjct: 241 KCIESGIDYELRGIEKPSDHAPIWSTFK 268


>gi|229493724|ref|ZP_04387508.1| exodeoxyribonuclease III [Rhodococcus erythropolis SK121]
 gi|229319393|gb|EEN85230.1| exodeoxyribonuclease III [Rhodococcus erythropolis SK121]
          Length = 266

 Score =  204 bits (519), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 75/265 (28%), Positives = 126/265 (47%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   +  W+  ++ D++ +QETK +D+ FP+E  + + Y +   G  
Sbjct: 1   MRIATWNVNSVRARTDRIIDWLGRSDVDVLAMQETKCKDEQFPYERFKEIGYEVAHVGLS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARF-----IEATFTINTQTLRIGNLYLPHGNP 118
            +NGVAI S+    ++           +                   +R+ +LY+P+G  
Sbjct: 61  QWNGVAIASRVGLDDVQIGFEDQPGFDKDPEADPVREARAIGATCGGVRVWSLYVPNGRE 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEEPLIF--AGDYNIIPQPHDCYNPIIWENDACFT 176
           +    Y  K+ W+ +    A   L+ +        GD+N+ P   D ++P  +E     +
Sbjct: 121 LEDPHYAYKLDWLAKLRDDAEGWLKQDPDAQIALVGDWNVAPTDDDVWDPAFFEGKTHTS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R +F      GF D +R       +Y++WDY    + K +G+RID I+ SP   + +
Sbjct: 181 EPERAAFTAFTESGFADVVRPYTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPAFAARV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
            +A ID   R     SDH PVIV+L
Sbjct: 241 EAAEIDRNERKGKGASDHAPVIVNL 265


>gi|307130940|ref|YP_003882956.1| exonuclease III [Dickeya dadantii 3937]
 gi|306528469|gb|ADM98399.1| exonuclease III [Dickeya dadantii 3937]
          Length = 268

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 86/266 (32%), Positives = 131/266 (49%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP + ++   YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLDEVKQFGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P+ +    P D+ D Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVALLTKAEPLAVRRGFPTDEEDAQRRIIMADLATPLGTLTVVNGYFPQGESRDHAV 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q  + ++P++  GD NI P         D     +      F 
Sbjct: 121 KFPAKTRFYQDLQHYLEQHHQADQPVLIMGDMNISPTDLDIGIGEDNRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L+N G  D  RA +      +S++DY +  +  N+G+RID IM +    S 
Sbjct: 181 PEEREWMERLKNWGLVDTFRAANPECQDRFSWFDYRSAGFDDNRGLRIDLIMATAPLASR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
             +  ID   RG  KPSDH PV    
Sbjct: 241 CAATGIDYAIRGMEKPSDHAPVWAEF 266


>gi|170733499|ref|YP_001765446.1| exodeoxyribonuclease III Xth [Burkholderia cenocepacia MC0-3]
 gi|169816741|gb|ACA91324.1| exodeoxyribonuclease III Xth [Burkholderia cenocepacia MC0-3]
          Length = 258

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 84/256 (32%), Positives = 131/256 (51%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ FP   L++  Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLAQSGTDVLCLQELKLPDEKFPRADLEAAGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL +   +   + +  +                   +RI + Y P+G  + S K
Sbjct: 61  TYNGVAILVRDTLVVDESDVVRNIPGFDDPQQRVIAATVDG-VRIVSAYFPNGQALDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLRTELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP   +   S  +D 
Sbjct: 180 AQLIELGFVDAFRRFEQPEKTFTWWDYRMMAFRRNAGLRIDHILLSPALAATCASCEVDR 239

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDHTPV+ 
Sbjct: 240 TPRTWEQPSDHTPVVA 255


>gi|186474317|ref|YP_001861659.1| exodeoxyribonuclease III Xth [Burkholderia phymatum STM815]
 gi|184196649|gb|ACC74613.1| exodeoxyribonuclease III Xth [Burkholderia phymatum STM815]
          Length = 308

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/261 (39%), Positives = 152/261 (58%), Gaps = 5/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N IR+R+  L  W++   PD++CLQE K  D  FP   L    Y     GQ 
Sbjct: 1   MKLATFNINGIRSRLPALLQWLEREAPDVVCLQELKAPDSGFPEAELNRAGYGAIWHGQV 60

Query: 64  SYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           S+NGVAIL+K  QP+E    LPGD  D  +R+IEA        + IG LYLP+GNP    
Sbjct: 61  SWNGVAILAKDAQPVETRRGLPGDPDDTHSRYIEAAVEG----ILIGCLYLPNGNPQPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K++W +R + +A + L+   P++ AGDYN++P   D YNP  W  DA    E R  
Sbjct: 117 KFDYKLAWFERLIVYAKRLLDSGHPVVLAGDYNVVPTDFDIYNPRSWLKDALLQPESRAC 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           + +L + G+TDA+R       +++FWDY+   W +N G+RIDH++L+    +++  A +D
Sbjct: 177 YARLLDQGWTDALRTRFPDEQIFTFWDYFRQHWERNSGLRIDHLLLNRPVAAMMRDAGVD 236

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
              RG    SDH P  V LD+
Sbjct: 237 RWVRGEPHASDHAPAWVELDL 257


>gi|107101992|ref|ZP_01365910.1| hypothetical protein PaerPA_01003039 [Pseudomonas aeruginosa PACS2]
          Length = 270

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 87/269 (32%), Positives = 130/269 (48%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+ + PD+I LQETK  D  FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIERHQPDVIGLQETKVADDQFPQAEIEALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+E+    P D  + Q RFI  TF       + + N Y P G      
Sbjct: 61  GHYGVALLSRQAPLELHRGFPSDGEESQRRFIWGTFSDAQGNPITVMNGYFPQGENREHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+  K  +            + E+ L+  GD NI P+  D           +      F
Sbjct: 121 TKFPAKQRFYADLQSLLENSFKPEQALVVMGDINISPEDCDIGIGEENRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKN--KGIRIDHIMLSPEA 232
             E R+    L+N G  D+ RA +   +  +S++DY +  +  N  +G+RID I+ S   
Sbjct: 181 LPEEREWLATLKNWGLVDSFRALNPEVNDRFSWFDYRSRGFEDNPKRGLRIDVILASRVL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
            S    A ID   R   KPSDH P+ + L
Sbjct: 241 QSRFKDAGIDYDLRSMEKPSDHAPIWLEL 269


>gi|68248592|ref|YP_247704.1| exonuclease III [Haemophilus influenzae 86-028NP]
 gi|68056791|gb|AAX87044.1| exodeoxyribonuclease III [Haemophilus influenzae 86-028NP]
          Length = 267

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 82/267 (30%), Positives = 128/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D+ FP+E  ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYEITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  I    P D+ D Q R I A        L + N Y P G      T
Sbjct: 61  GHYGVALLTKQEPKVIRRGFPTDNEDAQKRIIMADLETEFGLLTVINGYFPQGESRAHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKEHDRSNPILIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R  +Q+L + G  D+ R  + T +  +S++DY +  +  N+G+RIDHI++S +    
Sbjct: 181 PEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDDNRGLRIDHILISQKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|226358180|ref|YP_002787919.1| Exodeoxyribonuclease III [Deinococcus deserti VCD115]
 gi|226319823|gb|ACO47817.1| putative Exodeoxyribonuclease III [Deinococcus deserti VCD115]
          Length = 270

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 82/258 (31%), Positives = 133/258 (51%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  + AW++   PD++ LQETK  D  FP   L++L Y     GQK
Sbjct: 1   MKLATWNVNSLNVRLGQVMAWLEAQQPDVLALQETKLPDDRFPVAELEALGYRAVFSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVA+LS+    ++   +PG D + +         +    L +     P+G  + S K
Sbjct: 61  SYNGVALLSRLPLEDVQIGIPGLDDEQRRVVAATVGGMRVVCLYV-----PNGQAVDSPK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W+     +    L     L   GD+N+ P+  D ++P  W      +   RQ+F
Sbjct: 116 YTYKLEWLSAVRAWLQLELMAHPRLAVVGDFNVAPEDRDVHSPKRWAGQVLVSEPERQAF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G  DA R       ++S+W+Y    + +N G+RIDH+++S    +   S  +D 
Sbjct: 176 RALLDLGLHDAFRLHPQPERVFSWWNYGRLGFPRNWGLRIDHVLVSGILAAECQSCTVDL 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
           +PR   +PSDH PV+ + 
Sbjct: 236 EPRRHERPSDHAPVVATF 253


>gi|296102796|ref|YP_003612942.1| exonuclease III [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295057255|gb|ADF61993.1| exonuclease III [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 268

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 124/268 (46%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEQHQPDVIGLQETKVHDDMFPLEEVVKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K  P+ +    PGD  + Q R I A        + + N Y P G      T
Sbjct: 61  GHYGVALLTKETPVSVRRGFPGDGEEAQRRIIMAEIPSALGNITVINGYFPQGESRDHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    + +  L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAKFYQDLQDYLTTELKKENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLLSWGLVDTFRTANPDTQDRFSWFDYRSKGFDDNRGLRIDLLLASSPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   R   KPSDH PV     +
Sbjct: 241 CIETGIDYDIRSMEKPSDHAPVWAKFKL 268


>gi|206580746|ref|YP_002239049.1| exodeoxyribonuclease III [Klebsiella pneumoniae 342]
 gi|206569804|gb|ACI11580.1| exodeoxyribonuclease III [Klebsiella pneumoniae 342]
          Length = 268

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 81/266 (30%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G      T
Sbjct: 61  GHYGVALLTKETPIAVRRGFPDDGEEAQRRIIMAEIPSPFGNVTVINGYFPQGESRDHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K ++ +    +    L  E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAAFYQNLQNYLETELNKENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLLGWGLVDTWRQANPDNQEHFSWFDYRSKGFDDNRGLRIDLLLASQPLAQR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + RG  KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRGMEKPSDHAPVWATF 266


>gi|238754917|ref|ZP_04616267.1| Exodeoxyribonuclease III [Yersinia ruckeri ATCC 29473]
 gi|238706928|gb|EEP99295.1| Exodeoxyribonuclease III [Yersinia ruckeri ATCC 29473]
          Length = 268

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 88/268 (32%), Positives = 129/268 (48%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEEVSQHGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K +P+ +    P D+ D Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVALLTKQKPLAVRRGFPTDEEDAQRRIIMADLATPQGTLTVINGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACFT 176
           K+  K  + +    + +Q L  E  ++  GD NI P         D     +      F 
Sbjct: 121 KFPAKARFYQDLQNYLAQELTPEAQVLIMGDINISPTDRDIGIGEDNRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++LQN G  D  RA +      YS++DY +  + +N+G+RID +M S      
Sbjct: 181 PEEREWLERLQNWGLVDTFRAANPDCEDRYSWFDYRSRGFDENRGLRIDVLMASKPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   R   KPSDH PV     +
Sbjct: 241 CIATGIDYDIRSMEKPSDHAPVWSEFSL 268


>gi|239814966|ref|YP_002943876.1| exodeoxyribonuclease III Xth [Variovorax paradoxus S110]
 gi|239801543|gb|ACS18610.1| exodeoxyribonuclease III Xth [Variovorax paradoxus S110]
          Length = 260

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 102/263 (38%), Positives = 154/263 (58%), Gaps = 5/263 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN I +R+  + +W+ E  PD+ CLQE K+ D+NFP   ++   Y +   GQ+
Sbjct: 1   MKIATFNVNGINSRLALVLSWLAEARPDVACLQELKSPDENFPAAAIREAGYGVLFHGQR 60

Query: 64  SYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           ++NGVAIL++  +PIE    L G+  D Q+R++EA        + +G LYLP+GNP    
Sbjct: 61  AWNGVAILARGREPIETGRGLDGNSEDSQSRYLEAVVNG----VIVGCLYLPNGNPQPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W +R    A        P + AGD+N++P   D YNP  W++DA    E R +
Sbjct: 117 KFDYKLEWFERLNAHARLLYGCGMPAVLAGDFNVVPTDADIYNPASWQDDALLQPESRAA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F +L   G+TDAIR  H    +Y++WDY+ + W +N G+RIDH++L+ E    L  A +D
Sbjct: 177 FARLLKQGWTDAIRTRHPREAIYTYWDYWRNRWPRNAGLRIDHLLLNRELAPFLADANVD 236

Query: 243 TKPRGWTKPSDHTPVIVSLDIPE 265
            + RG    SDH P    LD+P 
Sbjct: 237 REVRGRPGASDHAPAWALLDLPA 259


>gi|206560581|ref|YP_002231346.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia
           cenocepacia J2315]
 gi|198036623|emb|CAR52521.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia
           cenocepacia J2315]
          Length = 258

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/256 (33%), Positives = 133/256 (51%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ FP   L++  Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLAQSGTDVLCLQELKLPDEKFPRADLEAAGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++   +   + +  +                   +RI + Y P+G  + S K
Sbjct: 61  TYNGVAILARDTLVVDESDVVRNIPGFDDPQQRVIAATVDG-VRIVSAYFPNGQALDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLRTELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSPE  +   S  +D 
Sbjct: 180 AQLIELGFVDAFRRFEQPEKTFTWWDYRMMAFRRNAGLRIDHILLSPELAATCASCEVDR 239

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDHTPV+ 
Sbjct: 240 TPRTWEQPSDHTPVVA 255


>gi|146307459|ref|YP_001187924.1| exonuclease III [Pseudomonas mendocina ymp]
 gi|145575660|gb|ABP85192.1| Exodeoxyribonuclease III [Pseudomonas mendocina ymp]
          Length = 270

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 85/269 (31%), Positives = 133/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H L A I ++ PD+I LQETK  D+ FP   ++ L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLEALIAKHQPDVIGLQETKVADEQFPESEIRQLGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+ +P+ +    P D  + Q RFI  TF   +   + + N Y P G      
Sbjct: 61  GHYGVALLSRQEPLNLQKGFPNDGEESQRRFIYGTFADAHGNPVTVMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+  K  +     +   +R + ++ L+  GD NI P+  D           +      F
Sbjct: 121 VKFPAKQRFYADLQQLLVERFDPQQALVVMGDINISPEDCDIGIGEANRLRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+    L+N G  D+ R  + T +  +S++DY +  +     +G+RID I+ S   
Sbjct: 181 LPEEREWLATLKNWGLVDSFRHLNPTVNDRFSWFDYRSRGFEDEPKRGLRIDVILASQAL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              L  A ID   RG  KPSDH P+ + L
Sbjct: 241 QGRLKDAGIDYDLRGMDKPSDHAPIWLEL 269


>gi|213967028|ref|ZP_03395178.1| exodeoxyribonuclease III [Pseudomonas syringae pv. tomato T1]
 gi|301385213|ref|ZP_07233631.1| exonuclease III [Pseudomonas syringae pv. tomato Max13]
 gi|302059606|ref|ZP_07251147.1| exonuclease III [Pseudomonas syringae pv. tomato K40]
 gi|302130154|ref|ZP_07256144.1| exonuclease III [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213928350|gb|EEB61895.1| exodeoxyribonuclease III [Pseudomonas syringae pv. tomato T1]
          Length = 270

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 89/269 (33%), Positives = 135/269 (50%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPLADVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +      DD + Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNPPLALHKGFESDDEESQKRFIWGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +        +   E+PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQALLEGQFSNEQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRYLYPEVSDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D   RG  KPSDH P+ + L
Sbjct: 241 QPRIKAAGVDYDLRGMEKPSDHAPIWLEL 269


>gi|283457216|ref|YP_003361786.1| exonuclease III [Rothia mucilaginosa DY-18]
 gi|283133201|dbj|BAI63966.1| exonuclease III [Rothia mucilaginosa DY-18]
          Length = 309

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 71/264 (26%), Positives = 124/264 (46%), Gaps = 6/264 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NSIRAR + +  W+ E++ D++ LQETKT+D+ FPF+  + + Y +   G  
Sbjct: 44  MKIATWNINSIRARENRVEDWLDEHDVDVLALQETKTKDETFPFDLFEFMGYEVAHFGLN 103

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIE----ATFTINTQTLRIGNLYLPHGNPI 119
            +NGVAI S+    ++           +    E             +R+ +LY+P+G  +
Sbjct: 104 QWNGVAIASRVGLEDVQRGFDNQPHFGKPGEPEVLEARAIGATCGGVRVWSLYVPNGRGL 163

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLI--FAGDYNIIPQPHDCYNPIIWENDACFTL 177
           T    D K+ W++   +     L           GD+N+ P+  D ++   +  +    +
Sbjct: 164 TDPHMDYKLHWMEALRQNVHNELAANPQSQLALVGDWNVAPEDADVWDIDYFLRNEMTHV 223

Query: 178 EVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLH 237
              +       +           T   Y++WDY A  ++K++G+RID  + SP   + + 
Sbjct: 224 SEPERCAFAALLEEGMVDVVRPHTPGEYTYWDYQAGRFTKDEGMRIDFQLFSPALAARVE 283

Query: 238 SARIDTKPRGWTKPSDHTPVIVSL 261
            A ID   R     SDHTPV+V +
Sbjct: 284 RAWIDKVERAGEGASDHTPVVVEI 307


>gi|156973843|ref|YP_001444750.1| exonuclease III [Vibrio harveyi ATCC BAA-1116]
 gi|156525437|gb|ABU70523.1| hypothetical protein VIBHAR_01553 [Vibrio harveyi ATCC BAA-1116]
          Length = 268

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 133/267 (49%), Gaps = 9/267 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPIEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P  ++   +   +      N + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKQEPISVQKGFPTDNEEHQKRMIMATFEDENGEKVTVLNGYFPQGDNIAHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TKY  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKYPYKRQFYKDLMTYLNDHHTNDEQLIVMGDINISPIDSDIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D  R  H   +  +S++DY +  +  N+G+RID I+++P    
Sbjct: 181 QPEEREWLKTLLDWGFEDTFRNLHPEVNDRFSWFDYRSRGFDDNRGLRIDVILVTPSLAK 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSL 261
               + ID + RG  KPSDH P+  + 
Sbjct: 241 KCVESDIDYELRGIEKPSDHAPIWSTF 267


>gi|327188747|gb|EGE55945.1| exodeoxyribonuclease III protein [Rhizobium etli CNPAF512]
          Length = 263

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 117/262 (44%), Positives = 167/262 (63%), Gaps = 5/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN I  R+  L  W+KE+ PD++CLQE KT+D  FP +  +   Y     GQ+
Sbjct: 1   MKIATYNVNGINGRLDILLRWLKEDAPDVVCLQELKTDDAKFPRKETERAGYGAVWHGQR 60

Query: 64  SYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           S+NGVAIL+K   PI     LPGD  D  +R+IEA        + IG+LYLP+GNP  S 
Sbjct: 61  SWNGVAILAKGKTPILTRRGLPGDPDDTHSRYIEAAVDG----VLIGSLYLPNGNPFPSA 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K++ K+ W +R   +A++ LE+E P I AGD+N++P   D Y P  W +DA F  EVR++
Sbjct: 117 KFEYKLRWFRRLSAYAAELLEIEVPSILAGDFNVMPTEIDVYKPERWLDDALFRPEVRKA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           + +L   G+TDA+R  H    +Y+FW Y+ +S+ ++ G+RIDH++LSP     L SAR+ 
Sbjct: 177 YAQLVAQGWTDAVRHLHPGERIYTFWKYWRNSFERDAGLRIDHLLLSPTVAPWLRSARVR 236

Query: 243 TKPRGWTKPSDHTPVIVSLDIP 264
            KPRGW   SDH PV++ LDIP
Sbjct: 237 RKPRGWEHTSDHAPVMIELDIP 258


>gi|218768830|ref|YP_002343342.1| exodeoxyribonuclease III [Neisseria meningitidis Z2491]
 gi|121052838|emb|CAM09187.1| exodeoxyribonuclease III [Neisseria meningitidis Z2491]
          Length = 256

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 90/260 (34%), Positives = 132/260 (50%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRNAPEDVHIGLPALPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMARHGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G  D++R  H     Y+++DY    + +  G+RIDHI++SP     L   R+D 
Sbjct: 177 QNLLDLGLADSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAEALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D 
Sbjct: 237 ETRALERPSDHAPVTAEFDW 256


>gi|330428202|gb|AEC19536.1| putative exodeoxyribonuclease III [Pusillimonas sp. T7-7]
          Length = 262

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 137/259 (52%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W++ +  + +CLQE K  D  FP +      Y     GQK
Sbjct: 1   MKLATWNVNSLKVRLPQVLDWLENSPVEALCLQELKLTDDKFPIDAFTEAGYQACWAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI++K    +I  +LPG + D Q R I  T       +R+   Y P+G  + S K
Sbjct: 61  TYNGVAIITKVPGTDIQRNLPGFE-DHQQRIIATTLPSPVGDVRVICAYCPNGQAVGSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y+ K+ W      +  Q L+    L   GDYN+ P   D ++P  WE D   +   R +F
Sbjct: 120 YEYKLKWFLALQEWLEQELQRYPRLAILGDYNVAPHNDDVHDPKKWEGDVLVSEPERAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L ++G TD+ R        +++WDY   ++ +N G+RIDH++LS        +  ID 
Sbjct: 180 NALLSLGLTDSFREFEQEEKSFTWWDYRRFAFRRNAGLRIDHVLLSDALKPYCSACVIDK 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
            PR   +PSDHTPVI +LD
Sbjct: 240 APRNNEQPSDHTPVIATLD 258


>gi|224823708|ref|ZP_03696817.1| exodeoxyribonuclease III Xth [Lutiella nitroferrum 2002]
 gi|224604163|gb|EEG10337.1| exodeoxyribonuclease III Xth [Lutiella nitroferrum 2002]
          Length = 257

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 87/260 (33%), Positives = 139/260 (53%), Gaps = 7/260 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+ E   D++CLQE K +   FP   +++  Y     GQK
Sbjct: 1   MRLATWNVNSLKVRLPQVLQWLAETPVDVLCLQELKMDQDAFPLAEIEAAGYRAAWLGQK 60

Query: 64  SYNGVAILSKYQP--IEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           +YNGVAIL +      ++V  +PG D + +              +R+   Y  +G  + S
Sbjct: 61  TYNGVAILVRDGHSLDDVVPGIPGYDDEQRRVIAATVGG-----VRVICAYFVNGEAVDS 115

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY  K++W+    R+ +  L     L   GDYNI P   D Y+P  W++    ++  R 
Sbjct: 116 PKYPYKLAWLAELERYVADELTRHPSLALLGDYNIAPDDRDVYDPDAWKDKVLCSVPERD 175

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +F++L  +G +D+ R  +     YS+WDY A  + +N G+RIDHI++S    +      I
Sbjct: 176 AFRRLIGLGLSDSFRLFNQDEKQYSWWDYRAMMFRRNLGLRIDHILISDALKARATECVI 235

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D  PR W +PSDHTPV+++L
Sbjct: 236 DKAPRKWERPSDHTPVVLTL 255


>gi|220911407|ref|YP_002486716.1| exodeoxyribonuclease III Xth [Arthrobacter chlorophenolicus A6]
 gi|219858285|gb|ACL38627.1| exodeoxyribonuclease III Xth [Arthrobacter chlorophenolicus A6]
          Length = 268

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 73/266 (27%), Positives = 120/266 (45%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   + AW++ ++ D++ +QETK +D NFP+E  + + Y +   G  
Sbjct: 1   MKIATWNVNSLRARADRVEAWLQRSDCDVLAIQETKCKDDNFPWELFERMGYEVAHFGVN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLD----VQARFIEATFTINTQTLRIGNLYLPHGNPI 119
            +NGVAI S+    ++                              +RI +LY+P+G  +
Sbjct: 61  QWNGVAIASRVGLEDVERTFLDQPAFGKAGKDPVQEARAMAATCGGVRIWSLYIPNGRSL 120

Query: 120 TSTKYDD--KISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNP--IIWENDACF 175
                    K     +    +      E  +   GD+NI P   D ++    +       
Sbjct: 121 DDEHMPYKLKWLESLKSHAQSLVTENPEAQVALMGDWNIAPFDDDVWDIDLFVNNGYTHV 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
           +   R +F   +  GFTD +R       +Y++WDY    + K +G+RID ++ S    S 
Sbjct: 181 SPPERAAFHAFETAGFTDVVRPYTPGPGVYTYWDYTQLRFPKKEGMRIDFVLASKALASR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
           +  A ID + R     SDH PV+V L
Sbjct: 241 VTGASIDREERKGKGASDHAPVLVEL 266


>gi|304386652|ref|ZP_07368935.1| exodeoxyribonuclease III [Neisseria meningitidis ATCC 13091]
 gi|304339271|gb|EFM05348.1| exodeoxyribonuclease III [Neisseria meningitidis ATCC 13091]
          Length = 256

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 90/260 (34%), Positives = 133/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRNAPEDVHIGLPALPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRYGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP     L   R+D 
Sbjct: 177 KNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAEALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D 
Sbjct: 237 ETRALERPSDHAPVTAEFDW 256


>gi|15802160|ref|NP_288182.1| exonuclease III [Escherichia coli O157:H7 EDL933]
 gi|15831709|ref|NP_310482.1| exonuclease III [Escherichia coli O157:H7 str. Sakai]
 gi|168749430|ref|ZP_02774452.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4113]
 gi|168756758|ref|ZP_02781765.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4401]
 gi|168762180|ref|ZP_02787187.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4501]
 gi|168770517|ref|ZP_02795524.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4486]
 gi|168774945|ref|ZP_02799952.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4196]
 gi|168782171|ref|ZP_02807178.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4076]
 gi|168788152|ref|ZP_02813159.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC869]
 gi|168800064|ref|ZP_02825071.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC508]
 gi|195937435|ref|ZP_03082817.1| exonuclease III [Escherichia coli O157:H7 str. EC4024]
 gi|208810770|ref|ZP_03252646.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4206]
 gi|208816750|ref|ZP_03257870.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4045]
 gi|208821646|ref|ZP_03261966.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4042]
 gi|209395934|ref|YP_002270819.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4115]
 gi|217328604|ref|ZP_03444685.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. TW14588]
 gi|254793367|ref|YP_003078204.1| exonuclease III [Escherichia coli O157:H7 str. TW14359]
 gi|261227757|ref|ZP_05942038.1| exonuclease III [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258078|ref|ZP_05950611.1| exonuclease III [Escherichia coli O157:H7 str. FRIK966]
 gi|291282928|ref|YP_003499746.1| Exodeoxyribonuclease III [Escherichia coli O55:H7 str. CB9615]
 gi|12515771|gb|AAG56735.1|AE005398_1 exonuclease III [Escherichia coli O157:H7 str. EDL933]
 gi|13361922|dbj|BAB35878.1| exonuclease III [Escherichia coli O157:H7 str. Sakai]
 gi|187769420|gb|EDU33264.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4196]
 gi|188016211|gb|EDU54333.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4113]
 gi|189000291|gb|EDU69277.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4076]
 gi|189356216|gb|EDU74635.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4401]
 gi|189360591|gb|EDU79010.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4486]
 gi|189367497|gb|EDU85913.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4501]
 gi|189372068|gb|EDU90484.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC869]
 gi|189377552|gb|EDU95968.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC508]
 gi|208725286|gb|EDZ74993.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4206]
 gi|208731093|gb|EDZ79782.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4045]
 gi|208741769|gb|EDZ89451.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4042]
 gi|209157334|gb|ACI34767.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC4115]
 gi|209768548|gb|ACI82586.1| exonuclease III [Escherichia coli]
 gi|209768550|gb|ACI82587.1| exonuclease III [Escherichia coli]
 gi|209768552|gb|ACI82588.1| exonuclease III [Escherichia coli]
 gi|209768554|gb|ACI82589.1| exonuclease III [Escherichia coli]
 gi|209768556|gb|ACI82590.1| exonuclease III [Escherichia coli]
 gi|217317951|gb|EEC26378.1| exodeoxyribonuclease III [Escherichia coli O157:H7 str. TW14588]
 gi|254592767|gb|ACT72128.1| exonuclease III [Escherichia coli O157:H7 str. TW14359]
 gi|290762801|gb|ADD56762.1| Exodeoxyribonuclease III [Escherichia coli O55:H7 str. CB9615]
 gi|320188437|gb|EFW63099.1| Exodeoxyribonuclease III [Escherichia coli O157:H7 str. EC1212]
 gi|320641598|gb|EFX10986.1| exonuclease III [Escherichia coli O157:H7 str. G5101]
 gi|320646958|gb|EFX15791.1| exonuclease III [Escherichia coli O157:H- str. 493-89]
 gi|320652240|gb|EFX20538.1| exonuclease III [Escherichia coli O157:H- str. H 2687]
 gi|320657841|gb|EFX25603.1| exonuclease III [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320658415|gb|EFX26109.1| exonuclease III [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668313|gb|EFX35140.1| exonuclease III [Escherichia coli O157:H7 str. LSU-61]
 gi|326342117|gb|EGD65898.1| Exodeoxyribonuclease III [Escherichia coli O157:H7 str. 1044]
 gi|326343669|gb|EGD67431.1| Exodeoxyribonuclease III [Escherichia coli O157:H7 str. 1125]
          Length = 268

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGD+ + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDEEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|288935952|ref|YP_003440011.1| exodeoxyribonuclease III [Klebsiella variicola At-22]
 gi|288890661|gb|ADC58979.1| exodeoxyribonuclease III [Klebsiella variicola At-22]
          Length = 268

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 81/266 (30%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G      T
Sbjct: 61  GHYGVALLTKDTPIAVRRGFPDDGEEAQRRIIMAEIPSPFGNVTVINGYFPQGESRDHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K ++ +    +    L  E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAAFYQNLQNYLETELNKENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLLGWGLVDTWRQANPDNQEHFSWFDYRSKGFDDNRGLRIDLLLASQPLAQR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + RG  KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRGMEKPSDHAPVWATF 266


>gi|134296326|ref|YP_001120061.1| exodeoxyribonuclease III [Burkholderia vietnamiensis G4]
 gi|134139483|gb|ABO55226.1| Exodeoxyribonuclease III [Burkholderia vietnamiensis G4]
          Length = 271

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 84/256 (32%), Positives = 134/256 (52%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ +P   L+++ Y     GQK
Sbjct: 14  MKIATWNVNSLNVRKQHVLDWLAQSGADVLCLQELKLPDEKYPRADLEAVGYRSWFTGQK 73

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL +   + +       ++       +    +  + +RI + Y P+G    S K
Sbjct: 74  TYNGVAILVRDT-LAVDESDVVRNIPGFDDPQQRVVAVTVEGVRIVSAYFPNGQAPDSDK 132

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 133 FLYKMQWLDALHAWLGAELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 192

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            KL  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP   +   S  +D 
Sbjct: 193 AKLLELGFVDAFRRFEQPEKTFTWWDYRMFAFRRNAGLRIDHILLSPALAATCTSCEVDR 252

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDHTPV+ 
Sbjct: 253 VPRTWEQPSDHTPVVA 268


>gi|260768888|ref|ZP_05877822.1| exodeoxyribonuclease III [Vibrio furnissii CIP 102972]
 gi|260616918|gb|EEX42103.1| exodeoxyribonuclease III [Vibrio furnissii CIP 102972]
 gi|315180582|gb|ADT87496.1| exodeoxyribonuclease III [Vibrio furnissii NCTC 11218]
          Length = 269

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 131/267 (49%), Gaps = 9/267 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAVIDKHQPDVIGLQEIKVHDEAFPLEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K  P+E+    P  +D   +   +        Q + + N Y P G+ I+  
Sbjct: 61  AHYGVAMLCKQTPLEVRKGFPTDNDDHQKRMIMATFLNEQGQKVTVMNGYFPQGDNISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  +    + + +     ++ LI  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYADLMTYLNDYHTKDDQLIVMGDINISPIDLDIGIGEPNRQRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E RQ  + L + GF D  R  H   +  +S++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEERQWLKTLLDWGFEDTFRKLHPAVNDQFSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSL 261
               A ID + RG  KPSDH P+    
Sbjct: 241 TCVEAGIDYELRGIEKPSDHAPIWSVF 267


>gi|284921668|emb|CBG34740.1| exodeoxyribonuclease III [Escherichia coli 042]
          Length = 268

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRQANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|300938914|ref|ZP_07153616.1| exodeoxyribonuclease III [Escherichia coli MS 21-1]
 gi|300456174|gb|EFK19667.1| exodeoxyribonuclease III [Escherichia coli MS 21-1]
          Length = 272

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 125/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ E P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKVFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|15607568|ref|NP_214941.1| exodeoxyribonuclease III protein [Mycobacterium tuberculosis H37Rv]
 gi|15839814|ref|NP_334851.1| exodeoxyribonuclease III [Mycobacterium tuberculosis CDC1551]
 gi|31791605|ref|NP_854098.1| exodeoxyribonuclease III protein [Mycobacterium bovis AF2122/97]
 gi|121636341|ref|YP_976564.1| putative exodeoxyribonuclease III protein xthA [Mycobacterium bovis
           BCG str. Pasteur 1173P2]
 gi|148660192|ref|YP_001281715.1| exodeoxyribonuclease III [Mycobacterium tuberculosis H37Ra]
 gi|148821623|ref|YP_001286377.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis F11]
 gi|167970756|ref|ZP_02553033.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis H37Ra]
 gi|215402179|ref|ZP_03414360.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis 02_1987]
 gi|215409943|ref|ZP_03418751.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis 94_M4241A]
 gi|215425649|ref|ZP_03423568.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis T92]
 gi|215429249|ref|ZP_03427168.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis EAS054]
 gi|215444523|ref|ZP_03431275.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis T85]
 gi|218752060|ref|ZP_03530856.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis GM 1503]
 gi|219556248|ref|ZP_03535324.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis T17]
 gi|224988813|ref|YP_002643500.1| putative exodeoxyribonuclease III protein [Mycobacterium bovis BCG
           str. Tokyo 172]
 gi|253797351|ref|YP_003030352.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           KZN 1435]
 gi|254230777|ref|ZP_04924104.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis C]
 gi|254363391|ref|ZP_04979437.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis str. Haarlem]
 gi|254549374|ref|ZP_05139821.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260185294|ref|ZP_05762768.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           CPHL_A]
 gi|260199425|ref|ZP_05766916.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           T46]
 gi|260203577|ref|ZP_05771068.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           K85]
 gi|289441807|ref|ZP_06431551.1| exodeoxyribonuclease III [Mycobacterium tuberculosis T46]
 gi|289445967|ref|ZP_06435711.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           CPHL_A]
 gi|289552676|ref|ZP_06441886.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           KZN 605]
 gi|289568343|ref|ZP_06448570.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           T17]
 gi|289573012|ref|ZP_06453239.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           K85]
 gi|289744123|ref|ZP_06503501.1| exodeoxyribonuclease III protein [Mycobacterium tuberculosis
           02_1987]
 gi|289748911|ref|ZP_06508289.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           T92]
 gi|289752456|ref|ZP_06511834.1| exodeoxyribonuclease III protein [Mycobacterium tuberculosis
           EAS054]
 gi|289756500|ref|ZP_06515878.1| exodeoxyribonuclease III protein [Mycobacterium tuberculosis T85]
 gi|289760543|ref|ZP_06519921.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis GM 1503]
 gi|294995932|ref|ZP_06801623.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           210]
 gi|297632911|ref|ZP_06950691.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           KZN 4207]
 gi|297729886|ref|ZP_06959004.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           KZN R506]
 gi|298523904|ref|ZP_07011313.1| exodeoxyribonuclease III protein XthA [Mycobacterium tuberculosis
           94_M4241A]
 gi|306774523|ref|ZP_07412860.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu001]
 gi|306779272|ref|ZP_07417609.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu002]
 gi|306783061|ref|ZP_07421383.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu003]
 gi|306787428|ref|ZP_07425750.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu004]
 gi|306791980|ref|ZP_07430282.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu005]
 gi|306796167|ref|ZP_07434469.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu006]
 gi|306966432|ref|ZP_07479093.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu009]
 gi|306970627|ref|ZP_07483288.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu010]
 gi|307078353|ref|ZP_07487523.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu011]
 gi|307082911|ref|ZP_07492024.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu012]
 gi|313657215|ref|ZP_07814095.1| exodeoxyribonuclease III [Mycobacterium tuberculosis KZN V2475]
 gi|1817693|emb|CAB06567.1| PROBABLE EXODEOXYRIBONUCLEASE III PROTEIN XTHA (EXONUCLEASE III)
           (EXO III) (AP ENDONUCLEASE VI) [Mycobacterium
           tuberculosis H37Rv]
 gi|13879945|gb|AAK44665.1| exodeoxyribonuclease III [Mycobacterium tuberculosis CDC1551]
 gi|31617191|emb|CAD93298.1| PROBABLE EXODEOXYRIBONUCLEASE III PROTEIN XTHA (EXONUCLEASE III)
           (EXO III) (AP ENDONUCLEASE VI) [Mycobacterium bovis
           AF2122/97]
 gi|121491988|emb|CAL70451.1| Probable exodeoxyribonuclease III protein xthA [Mycobacterium bovis
           BCG str. Pasteur 1173P2]
 gi|124599836|gb|EAY58846.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis C]
 gi|134148905|gb|EBA40950.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis str. Haarlem]
 gi|148504344|gb|ABQ72153.1| exodeoxyribonuclease III [Mycobacterium tuberculosis H37Ra]
 gi|148720150|gb|ABR04775.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis F11]
 gi|224771926|dbj|BAH24732.1| putative exodeoxyribonuclease III protein [Mycobacterium bovis BCG
           str. Tokyo 172]
 gi|253318854|gb|ACT23457.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           KZN 1435]
 gi|289414726|gb|EFD11966.1| exodeoxyribonuclease III [Mycobacterium tuberculosis T46]
 gi|289418925|gb|EFD16126.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           CPHL_A]
 gi|289437308|gb|EFD19801.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           KZN 605]
 gi|289537443|gb|EFD42021.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           K85]
 gi|289542096|gb|EFD45745.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           T17]
 gi|289684651|gb|EFD52139.1| exodeoxyribonuclease III protein [Mycobacterium tuberculosis
           02_1987]
 gi|289689498|gb|EFD56927.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           T92]
 gi|289693043|gb|EFD60472.1| exodeoxyribonuclease III protein [Mycobacterium tuberculosis
           EAS054]
 gi|289708049|gb|EFD72065.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis GM 1503]
 gi|289712064|gb|EFD76076.1| exodeoxyribonuclease III protein [Mycobacterium tuberculosis T85]
 gi|298493698|gb|EFI28992.1| exodeoxyribonuclease III protein XthA [Mycobacterium tuberculosis
           94_M4241A]
 gi|308216872|gb|EFO76271.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu001]
 gi|308327716|gb|EFP16567.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu002]
 gi|308332078|gb|EFP20929.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu003]
 gi|308335893|gb|EFP24744.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu004]
 gi|308339470|gb|EFP28321.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu005]
 gi|308343335|gb|EFP32186.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu006]
 gi|308355828|gb|EFP44679.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu009]
 gi|308359748|gb|EFP48599.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu010]
 gi|308363690|gb|EFP52541.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu011]
 gi|308367342|gb|EFP56193.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu012]
 gi|323721099|gb|EGB30161.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           CDC1551A]
 gi|326902253|gb|EGE49186.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           W-148]
 gi|328457137|gb|AEB02560.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           KZN 4207]
          Length = 291

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 126/266 (47%), Gaps = 7/266 (2%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           ++ +ATWNVNSIR R+  +  W+   + D++ +QETK  D  FP   L  L Y +   G 
Sbjct: 23  LLRLATWNVNSIRTRLDRVLDWLGRADVDVLAMQETKCPDGQFPALPLFELGYDVAHVGF 82

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPHGN 117
             +NGVAI S+    ++     G         + AT            +R+ +LY+P+G 
Sbjct: 83  DQWNGVAIASRVGLDDVRVGFDGQPSWSGKPEVAATTEARALGATCGGIRVWSLYVPNGR 142

Query: 118 PITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACF 175
            +    Y  K+ W+      A   L  +   P+   GD+NI P   D ++   +      
Sbjct: 143 ALDDPHYTYKLDWLAALRDTAEGWLRDDPAAPIALMGDWNIAPTDDDVWSTEFFAGCTHV 202

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
           +   R++F  + +  FTD +R       +Y++WDY    + K +G+RID I+ SP   + 
Sbjct: 203 SEPERKAFNAIVDAQFTDVVRPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAAR 262

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
           +  A+I  + R    PSDH PV+V L
Sbjct: 263 VMDAQIVREERKGKAPSDHAPVLVDL 288


>gi|161870674|ref|YP_001599847.1| exodeoxyribonuclease III [Neisseria meningitidis 053442]
 gi|161596227|gb|ABX73887.1| exodeoxyribonuclease III [Neisseria meningitidis 053442]
 gi|319411070|emb|CBY91471.1| exodeoxyribonuclease III (exonuclease III; EXO III) [Neisseria
           meningitidis WUE 2594]
          Length = 256

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 134/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRNAPEDVHIGLPALPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRYGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP   + L   R+D 
Sbjct: 177 QNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAAALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D 
Sbjct: 237 ETRALERPSDHAPVTAEFDW 256


>gi|301632179|ref|XP_002945168.1| PREDICTED: exodeoxyribonuclease III-like [Xenopus (Silurana)
           tropicalis]
          Length = 263

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 92/258 (35%), Positives = 135/258 (52%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWN+NS+  R+  +  W+  N  D + LQE K  D  FP +   +  Y     GQK
Sbjct: 1   MRITTWNINSLAVRLPQVLDWLAANPVDALALQELKLTDDKFPADAFAAAGYRAVVFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+Y   ++V ++PG   D QAR I AT    T  LR+ N Y  +G    S K
Sbjct: 61  TYNGVAILSRYPMTDVVRNIPGF-ADEQARVIAATLDTPTGPLRLVNGYFVNGQAPGSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++    +    L L   L   GD+N+ P+  D ++P         T + R  F
Sbjct: 120 FAYKMRWLQALQDWLRSELALHPRLALVGDFNVAPEDRDSHDPEGLRETIHHTTQERLHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L  +G  DA R        +S+WDY    + KN+G+RIDHI++S     L+ +  +D 
Sbjct: 180 QALLGLGLVDAFRLFVQPEKSFSWWDYRMLGFQKNRGLRIDHILVSQMLAPLVSACAVDR 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV+V+L
Sbjct: 240 LPRKNKQPSDHAPVVVTL 257


>gi|161503598|ref|YP_001570710.1| exonuclease III [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160864945|gb|ABX21568.1| hypothetical protein SARI_01677 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 268

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 77/268 (28%), Positives = 122/268 (45%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D+ FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDEMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKATPISVRRGFPDDGEEAQRRIIMAEIPSPLGNITVINGYFPQGESRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKCDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMSRLLKWGLVDTFRQANPETVDKFSWFDYRSKGFVDNRGLRIDLLLASRPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   R   KPSDH PV  +  +
Sbjct: 241 CAETGIDYDIRSMEKPSDHAPVWATFRV 268


>gi|218705247|ref|YP_002412766.1| exonuclease III [Escherichia coli UMN026]
 gi|293405248|ref|ZP_06649240.1| exodeoxyribonuclease III [Escherichia coli FVEC1412]
 gi|298380891|ref|ZP_06990490.1| exodeoxyribonuclease III [Escherichia coli FVEC1302]
 gi|218432344|emb|CAR13234.1| exonuclease III [Escherichia coli UMN026]
 gi|291427456|gb|EFF00483.1| exodeoxyribonuclease III [Escherichia coli FVEC1412]
 gi|298278333|gb|EFI19847.1| exodeoxyribonuclease III [Escherichia coli FVEC1302]
 gi|323186929|gb|EFZ72247.1| exodeoxyribonuclease III [Escherichia coli RN587/1]
          Length = 268

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSTLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|163841804|ref|YP_001626209.1| exodeoxyribonuclease III [Renibacterium salmoninarum ATCC 33209]
 gi|162955280|gb|ABY24795.1| exodeoxyribonuclease III [Renibacterium salmoninarum ATCC 33209]
          Length = 267

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 81/266 (30%), Positives = 129/266 (48%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   +  W++  + D++ +QETK +D+NFP+E  ++  Y +   G  
Sbjct: 1   MKIATWNVNSLRARADRVEDWLRRTDIDVLAIQETKCKDENFPWELFENNGYEVAHFGFS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEAT----FTINTQTLRIGNLYLPHGNPI 119
            +NGVAI SK    ++    PG     +                  +R+ +LY+P+G  +
Sbjct: 61  QWNGVAIASKVGLDDVERTFPGQPAFGKPGVEPEQEGRAIAATCGGVRVWSLYVPNGRAL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIF--AGDYNIIPQPHDCYNPIIWE--NDACF 175
                  K+ W++     A   L  +        GD+NI PQ  D ++   +       F
Sbjct: 121 DDPHMPYKLEWLRVLNEEAKGWLAKDPNAQIALVGDWNIAPQDDDVWDVKYFIDEGLTHF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
           +   R +FQ  +  GFTD +R +H    +Y++WDY    + K +G+RID IM SP   + 
Sbjct: 181 SAPERAAFQAFEAAGFTDVVRPSHPGPGVYTYWDYKQLRFPKKEGMRIDFIMASPALAAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
           +    ID + R     SDH PVI  L
Sbjct: 241 VVHTEIDREERKGKGASDHAPVIAEL 266


>gi|126662905|ref|ZP_01733904.1| exodeoxyribonuclease III [Flavobacteria bacterium BAL38]
 gi|126626284|gb|EAZ96973.1| exodeoxyribonuclease III [Flavobacteria bacterium BAL38]
          Length = 253

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/263 (30%), Positives = 126/263 (47%), Gaps = 14/263 (5%)

Query: 4   VTVATWNVNSIRARI-HNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNY---HIET 59
           + + ++NVN IRA I      W+++ NPD+ICLQE K  ++  P   +++  Y   +  +
Sbjct: 1   MKIISYNVNGIRAAISKGFLEWLQQANPDVICLQEIKATEEQIPKLEIEAAGYPYQYYFS 60

Query: 60  CGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
             +K Y+GVA+LSK +P  IV       +D + R +   F      L + +LYLP G  I
Sbjct: 61  AEKKGYSGVAVLSKIEPKTIVFGTGIKHMDFEGRNLRVDFD----KLSVMSLYLPSGTNI 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
                D K  ++  F  +  +  +    L+  GDYNI  +  D ++PI     + F  E 
Sbjct: 117 DR--LDYKFQYMAEFQLYVDELKKEIPNLVICGDYNICHEAIDIHDPIRNAKVSGFLPEE 174

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R         GF D  R  +   + YS+W Y A++ + NKG RID+ + +      +  A
Sbjct: 175 RAWLDGFLKNGFVDTFRHLNKEPNNYSWWSYRANARNNNKGWRIDYCLATESLKEKIQRA 234

Query: 240 RIDTKPRGWTKPSDHTPVIVSLD 262
            I  +     K SDH PV+V + 
Sbjct: 235 LILPEA----KHSDHCPVLVEIK 253


>gi|293415066|ref|ZP_06657709.1| exodeoxyribonuclease III [Escherichia coli B185]
 gi|291432714|gb|EFF05693.1| exodeoxyribonuclease III [Escherichia coli B185]
          Length = 268

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTAERFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|162138430|ref|YP_540952.2| exonuclease III [Escherichia coli UTI89]
 gi|170683141|ref|YP_001743499.1| exonuclease III [Escherichia coli SMS-3-5]
 gi|215486966|ref|YP_002329397.1| exonuclease III [Escherichia coli O127:H6 str. E2348/69]
 gi|218558617|ref|YP_002391530.1| exonuclease III [Escherichia coli S88]
 gi|218689690|ref|YP_002397902.1| exonuclease III [Escherichia coli ED1a]
 gi|293410066|ref|ZP_06653642.1| exodeoxyribonuclease III [Escherichia coli B354]
 gi|306814999|ref|ZP_07449155.1| exonuclease III [Escherichia coli NC101]
 gi|312966949|ref|ZP_07781167.1| exodeoxyribonuclease III [Escherichia coli 2362-75]
 gi|331663230|ref|ZP_08364140.1| exodeoxyribonuclease III [Escherichia coli TA143]
 gi|170520859|gb|ACB19037.1| exodeoxyribonuclease III [Escherichia coli SMS-3-5]
 gi|215265038|emb|CAS09425.1| exonuclease III [Escherichia coli O127:H6 str. E2348/69]
 gi|218365386|emb|CAR03109.1| exonuclease III [Escherichia coli S88]
 gi|218427254|emb|CAR08144.2| exonuclease III [Escherichia coli ED1a]
 gi|222033502|emb|CAP76243.1| exodeoxyribonuclease III [Escherichia coli LF82]
 gi|291470534|gb|EFF13018.1| exodeoxyribonuclease III [Escherichia coli B354]
 gi|294494019|gb|ADE92775.1| exodeoxyribonuclease III [Escherichia coli IHE3034]
 gi|305851647|gb|EFM52100.1| exonuclease III [Escherichia coli NC101]
 gi|307626765|gb|ADN71069.1| exonuclease III [Escherichia coli UM146]
 gi|312288413|gb|EFR16315.1| exodeoxyribonuclease III [Escherichia coli 2362-75]
 gi|312946349|gb|ADR27176.1| exonuclease III [Escherichia coli O83:H1 str. NRG 857C]
 gi|320194541|gb|EFW69172.1| Exodeoxyribonuclease III [Escherichia coli WV_060327]
 gi|323952256|gb|EGB48129.1| exodeoxyribonuclease III [Escherichia coli H252]
 gi|323956518|gb|EGB52259.1| exodeoxyribonuclease III [Escherichia coli H263]
 gi|331059029|gb|EGI31006.1| exodeoxyribonuclease III [Escherichia coli TA143]
          Length = 268

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|284993327|ref|YP_003411882.1| exodeoxyribonuclease III Xth [Geodermatophilus obscurus DSM 43160]
 gi|284066573|gb|ADB77511.1| exodeoxyribonuclease III Xth [Geodermatophilus obscurus DSM 43160]
          Length = 264

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 75/262 (28%), Positives = 132/262 (50%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R   + AW++ ++ D++ LQETK  D  FP      L Y +   G  
Sbjct: 1   MRIATWNVNSIRTRADRVVAWLQRSDVDVLALQETKCRDDQFPESCFTDLGYQVAHVGHS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGD--DLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
            +NGVA+LS+    ++    PG     + +              +R+ +LY+P+G  +T 
Sbjct: 61  QWNGVALLSRVGLEDVEVAFPGQPGFGNPEPAVEARALAATCGGVRVWSLYVPNGRTLTD 120

Query: 122 TKYDDKISWIKRFLRFASQRL--ELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
             Y+ K+ W+      A+  L  +    +   GD+NI PQ  D ++  ++ +    +   
Sbjct: 121 PHYEYKLRWLGALRTAAAGWLAEDGGAQVALVGDWNIAPQDDDVWDVRVFAHSTHVSEPE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R +F+ + + G+ D +R       ++++WDY    +++ +G+RID ++ SP     + +A
Sbjct: 181 RAAFRAIVDAGYADVVRPHTPGPGVFTYWDYTQLRFARREGMRIDFVLGSPALAVRVTNA 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            ID + R     SDH PV+V L
Sbjct: 241 LIDRQERKGKGASDHAPVVVDL 262


>gi|218548682|ref|YP_002382473.1| exonuclease III [Escherichia fergusonii ATCC 35469]
 gi|218356223|emb|CAQ88840.1| exonuclease III [Escherichia fergusonii ATCC 35469]
 gi|324113497|gb|EGC07472.1| exodeoxyribonuclease III [Escherichia fergusonii B253]
          Length = 268

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 77/266 (28%), Positives = 123/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGD  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDGEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|311899750|dbj|BAJ32158.1| putative exodeoxyribonuclease III [Kitasatospora setae KM-6054]
          Length = 270

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 75/269 (27%), Positives = 118/269 (43%), Gaps = 8/269 (2%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
            V +ATWN+NS+ AR+  L  W++   PD++CLQE K     FP E +  L Y     G 
Sbjct: 2   TVRIATWNINSVTARLPKLLEWLESAAPDVLCLQELKCATDAFPAEAVAELGYESAAHGD 61

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTI--------NTQTLRIGNLYLP 114
             +NGVA+LS+    ++V  LP            A   +            +R+ ++Y+P
Sbjct: 62  GRWNGVALLSRIGLADVVRDLPAQPGYRADDADPAEAPVVEPRAIAATCGPVRVWSVYVP 121

Query: 115 HGNPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDAC 174
           +G  +    Y  K+ W+               P    GD+N+ P   D Y+   +     
Sbjct: 122 NGREVDHAHYRYKLEWMAALRDAVRDDAAGGRPFAVLGDFNVAPTDEDVYDLAAFAGLTH 181

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
            T   R +   L+ +G  D +         Y+FWDY A ++ KN+G+RID    +     
Sbjct: 182 VTAPERATLAALRELGLRDVVPRPLKYDRPYTFWDYRALAFPKNRGMRIDLTYANEPFAD 241

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
            +    +D + R     SDH PV+V LD+
Sbjct: 242 AVTDTYVDREARKGKGTSDHAPVVVDLDL 270


>gi|281178820|dbj|BAI55150.1| exonuclease III [Escherichia coli SE15]
 gi|330911554|gb|EGH40064.1| exodeoxyribonuclease 3 [Escherichia coli AA86]
          Length = 268

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPISVRRGFPGDDEEAQRRIIMAEIPSPLGNITVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|254672519|emb|CBA06061.1| exodeoxyribonuclease III [Neisseria meningitidis alpha275]
 gi|254673406|emb|CBA08729.1| exodeoxyribonuclease III [Neisseria meningitidis alpha275]
 gi|308388602|gb|ADO30922.1| exodeoxyribonuclease III [Neisseria meningitidis alpha710]
 gi|325130865|gb|EGC53597.1| exodeoxyribonuclease III [Neisseria meningitidis OX99.30304]
 gi|325136967|gb|EGC59564.1| exodeoxyribonuclease III [Neisseria meningitidis M0579]
 gi|325202788|gb|ADY98242.1| exodeoxyribonuclease III [Neisseria meningitidis M01-240149]
 gi|325208783|gb|ADZ04235.1| exodeoxyribonuclease III [Neisseria meningitidis NZ-05/33]
          Length = 256

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 90/260 (34%), Positives = 134/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRNAPEDVHIGLPALPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRYGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP   + L   R+D 
Sbjct: 177 KNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAAALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D 
Sbjct: 237 ETRALERPSDHAPVTAEFDW 256


>gi|330953392|gb|EGH53652.1| exonuclease III [Pseudomonas syringae Cit 7]
          Length = 270

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 89/269 (33%), Positives = 134/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPQAEVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD + Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNAPLALHKGFEGDDEESQKRFIWGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +            ++PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQTLLEGHFSNDQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRHLYPEVVDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +  A +D   RG  KPSDH P+ + L
Sbjct: 241 QPRIKEAGVDYDLRGMEKPSDHAPIWLEL 269


>gi|145299881|ref|YP_001142722.1| exodeoxyribonuclease III [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142852653|gb|ABO90974.1| exodeoxyribonuclease III [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 268

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 80/267 (29%), Positives = 132/267 (49%), Gaps = 9/267 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP   ++++ YH+E  GQK
Sbjct: 1   MKIISFNINGLRARLHQLQAIIDKHQPDVIGLQEIKVHDEAFPLADVEAMGYHVEFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLD-VQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVAI+SK +P+E+    P D  D  +   +      +   +++ N Y P G      
Sbjct: 61  AHYGVAIMSKQKPVEVQKGFPTDPEDAQRRMIMATFKREDGSLIKVMNGYFPQGENQDHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + +    +        + L+  GD NI P               + E    F
Sbjct: 121 TKFPAKQKFYENLQHYLETHHTPNDQLVLIGDVNISPTDLDIGIGEANRKRWLREGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
               R+  ++L+  G TD  RA + T    +S++DY +  + +N+G+RID IM S     
Sbjct: 181 LPIEREWMERLKGFGLTDTFRAANPTECERFSWFDYRSKGFDENRGLRIDLIMASDALKD 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSL 261
            +    ID + RG  KPSDH P+  + 
Sbjct: 241 TVTETGIDYELRGIEKPSDHAPIWATF 267


>gi|215409940|ref|ZP_03418748.1| exodeoxyribonuclease III protein xthA (exonuclease III)
           [Mycobacterium tuberculosis 94_M4241A]
 gi|298523903|ref|ZP_07011312.1| exodeoxyribonuclease III protein XthA [Mycobacterium tuberculosis
           94_M4241A]
 gi|298493697|gb|EFI28991.1| exodeoxyribonuclease III protein XthA [Mycobacterium tuberculosis
           94_M4241A]
          Length = 273

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/267 (29%), Positives = 127/267 (47%), Gaps = 7/267 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           +++ +ATWNVNSIR R+  +  W+   + D++ +QETK  D  FP   L  L Y +   G
Sbjct: 4   ALLRLATWNVNSIRTRLDRVLDWLGRADVDVLAMQETKCPDGQFPALPLFELGYDVAHVG 63

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPHG 116
              +NGVAI S+    ++     G         + AT            +R+ +LY+P+G
Sbjct: 64  FDQWNGVAIASRVGLDDVRVGFDGQPSWSGKPEVAATTEARALGATCGGIRVWSLYVPNG 123

Query: 117 NPITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDAC 174
             +    Y  K+ W+      A   L  +   P+   GD+NI P   D ++   +     
Sbjct: 124 RALDDPHYTYKLDWLAALRDTAEGWLRDDPAAPIALMGDWNIAPTDDDVWSTEFFAGCTH 183

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
            +   R++F  + +  FTD +R       +Y++WDY    + K +G+RID I+ SP   +
Sbjct: 184 VSEPERKAFNAIVDAQFTDVVRPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAA 243

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSL 261
            +  A+I  + R    PSDH PV+V L
Sbjct: 244 RVMDAQIVREERKGKAPSDHAPVLVDL 270


>gi|16119275|ref|NP_395981.1| exodeoxyribonuclease III [Agrobacterium tumefaciens str. C58]
 gi|15161781|gb|AAK90422.1| exodeoxyribonuclease III [Agrobacterium tumefaciens str. C58]
          Length = 258

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 104/260 (40%), Positives = 153/260 (58%), Gaps = 5/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN I  R+  L  W+ E  PD++CLQE K  +  FP   ++   Y     GQK
Sbjct: 1   MKLATYNVNGINGRLEVLLRWLAEAKPDVVCLQELKAPNDKFPRREIERAGYGAIWRGQK 60

Query: 64  SYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           S+NGVAIL++  +P E    LPGD  D  +R+IEA        + IG LYLP+GNP    
Sbjct: 61  SWNGVAILARDQEPRETRRGLPGDPDDSHSRYIEAAIDG----IVIGCLYLPNGNPAPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W +R   +A++  EL+ P+   GD+N++P   D Y P  W +DA F  EVR +
Sbjct: 117 KFDYKLRWFERLYSYAAELFELDVPVALVGDFNVMPTDLDVYKPERWRDDALFRPEVRAA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           + +L  MG+TDA+R  H    +Y+FW Y+ ++++++ G+RIDH +LSP     L +  +D
Sbjct: 177 YAELIAMGWTDAVRLLHPEERIYTFWKYFRNAFARDAGLRIDHFLLSPSLRERLQTCGVD 236

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
              R W   SDH PV + LD
Sbjct: 237 KFARAWEHTSDHAPVWIELD 256


>gi|296114978|ref|ZP_06833622.1| putative exodeoxyribonuclease III [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978440|gb|EFG85174.1| putative exodeoxyribonuclease III [Gluconacetobacter hansenii ATCC
           23769]
          Length = 260

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 99/258 (38%), Positives = 137/258 (53%), Gaps = 3/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +  ATWNVNSIR R  ++  W++   PD+I LQE K  +  FP +  +   Y     GQK
Sbjct: 1   MKFATWNVNSIRQRHDHVLQWLEREQPDLIGLQEIKCIEDQFPADAFRKAGYESVVVGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAILS+         LPG + +           I T+ L  GNLYLP+GN      
Sbjct: 61  SYNGVAILSRVPFTVTHRALPGWECEPPQ---ARYVEIRTEALTFGNLYLPNGNSGGKAG 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           YD+K++++    + A   L      +  GDYN+ P   D     +  +DA      R +F
Sbjct: 118 YDNKLAFMAALAQHARDLLHAGTDFVLTGDYNVCPTDEDLAPGALPPDDALVRPASRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L  +G TDA+RA H     Y+FWDY A +W ++ G+RIDH +LSP     L SA  D 
Sbjct: 178 RTLLWLGLTDALRALHPVGRFYTFWDYQAGAWQRDSGLRIDHALLSPRVAERLLSAIPDR 237

Query: 244 KPRGWTKPSDHTPVIVSL 261
           + R  T+PSDH P+IV+L
Sbjct: 238 EERNMTQPSDHVPLIVTL 255


>gi|332141071|ref|YP_004426809.1| exodeoxyribonuclease III [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551093|gb|AEA97811.1| exodeoxyribonuclease III [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 269

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 86/268 (32%), Positives = 132/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N IRAR+H L A I  + PDII LQE K  ++ FP E ++++ YH+   GQK
Sbjct: 1   MKVISFNINGIRARLHQLQAVIDAHQPDIIGLQEIKVHNEQFPVEAVEAMGYHVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLD-VQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           S+ GVA L+K +P+ +    P D+ D  +   I  T     Q + I N Y P G      
Sbjct: 61  SHYGVAFLAKKEPLSVTMGFPTDEEDAQRRMIILKTTDDAGQPVTILNGYFPQGENEKHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TKY  K  + K  + +  +    E+ +I  GD NI           +     +      F
Sbjct: 121 TKYPAKRKFYKDLMTYLDENHTPEDNVIVMGDVNISHTDLDIGIGEENRKRWLRTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+    L + GF D+ R  +   +  +S++DY +  ++ N+G+RID I+ +    S
Sbjct: 181 LPEEREWLNTLFSWGFEDSFRTLNPETNERFSWFDYRSKGFNDNRGLRIDLILATKSLHS 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            L  A ID + RG  KPSDH P+     
Sbjct: 241 TLVDAGIDYELRGIEKPSDHAPIWAEYK 268


>gi|254805570|ref|YP_003083791.1| exodeoxyribonuclease III [Neisseria meningitidis alpha14]
 gi|254669112|emb|CBA07713.1| exodeoxyribonuclease III [Neisseria meningitidis alpha14]
          Length = 256

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 134/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRNAPEDVHIGLPALPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMARHGKLVLLGDFNIAPADADCYDPEKWYEKIHCSTVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP   + L   R+D 
Sbjct: 177 QNLLDLGLTDSLRHIHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAAALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D 
Sbjct: 237 ETRALERPSDHAPVTAEFDW 256


>gi|268589456|ref|ZP_06123677.1| exodeoxyribonuclease III [Providencia rettgeri DSM 1131]
 gi|291315121|gb|EFE55574.1| exodeoxyribonuclease III [Providencia rettgeri DSM 1131]
          Length = 270

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 86/269 (31%), Positives = 129/269 (47%), Gaps = 8/269 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ P++I LQETK  D  FP+E +  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLAAIIEKHQPEVIGLQETKVHDDMFPYEEVSQLGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
           ++ GVA+L+K +P+ +    P DD D Q R I A    +   L + N Y P G       
Sbjct: 61  AHYGVALLTKNEPLAVRKGFPTDDDDAQRRIIMADIQTDRGPLTVVNGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    + +     E  L+  GD NI P               +      F 
Sbjct: 121 KFPAKEKFYQDLQNYITSTQTAESQLLIMGDMNISPTDLDIGIGDANRKRWLKTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   KL   G  D  RA +      YS++DY +  +  N+G+RID ++ S +    
Sbjct: 181 PEEREWLAKLLGWGLVDTYRAKNPDISDCYSWFDYRSKGFDDNRGLRIDLLLASNKLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDIP 264
             +  ID + RG  KPSDH PV    D+ 
Sbjct: 241 CIATGIDYEIRGMEKPSDHAPVWSEFDLS 269


>gi|194433512|ref|ZP_03065790.1| exodeoxyribonuclease III [Shigella dysenteriae 1012]
 gi|194418275|gb|EDX34366.1| exodeoxyribonuclease III [Shigella dysenteriae 1012]
 gi|320181218|gb|EFW56137.1| Exodeoxyribonuclease III [Shigella boydii ATCC 9905]
 gi|332085670|gb|EGI90834.1| exodeoxyribonuclease III [Shigella dysenteriae 155-74]
 gi|332090564|gb|EGI95661.1| exodeoxyribonuclease III [Shigella boydii 5216-82]
          Length = 268

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLEAELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|170768737|ref|ZP_02903190.1| exodeoxyribonuclease III [Escherichia albertii TW07627]
 gi|170122285|gb|EDS91216.1| exodeoxyribonuclease III [Escherichia albertii TW07627]
          Length = 268

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 80/266 (30%), Positives = 123/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    PGD  D Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPITVRRGFPGDGEDAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +      +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYLNLQNYLETELKRENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLLSWGLVDTFRHANPETADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|331683257|ref|ZP_08383858.1| exodeoxyribonuclease III [Escherichia coli H299]
 gi|331079472|gb|EGI50669.1| exodeoxyribonuclease III [Escherichia coli H299]
          Length = 268

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+++K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALMTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|269102062|ref|ZP_06154759.1| exodeoxyribonuclease III [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268161960|gb|EEZ40456.1| exodeoxyribonuclease III [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 268

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 134/268 (50%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I+++ PD+I LQE K  D+ FP   ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIEKHQPDVIGLQEIKVHDEAFPLADVEAMGYKVYHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLD-VQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PIE+    P DD D  +   +      N + + I N Y P G+ I   
Sbjct: 61  AHYGVALLCKQEPIEVKKGFPTDDDDAQRRMIMATFEQENGKKITIMNGYFPQGDNINHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  +    + + +     +E LI  GD NI P         +     +      F
Sbjct: 121 TKFPAKEKFYADLMTYLNTYHNNDEELIVMGDINISPIDLDIGIGDNNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
               RQ  + L + GF D  R  H T    YS++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPIERQWLKTLLDWGFIDTFRQLHPTVDDQYSWFDYRSKGFDDNRGLRIDVILATPSLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  + +
Sbjct: 241 RCIESGIDYELRGIEKPSDHAPIWSTFN 268


>gi|241758932|ref|ZP_04757044.1| exodeoxyribonuclease III [Neisseria flavescens SK114]
 gi|241320753|gb|EER56986.1| exodeoxyribonuclease III [Neisseria flavescens SK114]
          Length = 256

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 137/259 (52%), Gaps = 4/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+ ++  DI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKIATWNVNSLNVRLPQVQNWLADHQADILALQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+++P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRHEPQDVHCGLPALPDDPQRRVIAATING----VRVINVYCINGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FQYKEQWFAALTEFVRNEMAAHPKLVLLGDFNIAPADADCYDPEKWHEKIHCSSIERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD +R  H     Y+++DY    + +  G+RIDHI+ SPE  + L +  +D 
Sbjct: 177 KNLLDLGLTDGLRKIHPEGAFYTWFDYRGAMFQRKLGLRIDHILTSPELAATLTNVTVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + R   +PSDH PVI   D
Sbjct: 237 ETRAQERPSDHAPVIAEFD 255


>gi|15676313|ref|NP_273448.1| exodeoxyribonuclease III [Neisseria meningitidis MC58]
 gi|134104765|pdb|2JC4|A Chain A, 3'-5' Exonuclease (Nexo) From Neisseria Meningitidis
 gi|7225621|gb|AAF40839.1| exodeoxyribonuclease III [Neisseria meningitidis MC58]
 gi|316984902|gb|EFV63858.1| exodeoxyribonuclease III [Neisseria meningitidis H44/76]
 gi|325134978|gb|EGC57610.1| exodeoxyribonuclease III [Neisseria meningitidis M13399]
 gi|325140915|gb|EGC63422.1| exodeoxyribonuclease III [Neisseria meningitidis CU385]
 gi|325199589|gb|ADY95044.1| exodeoxyribonuclease III [Neisseria meningitidis H44/76]
          Length = 256

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 135/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT +     +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRSVPQDVHFGLPALPDDPQRRVIAATVSG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRHGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP   + L   R+D 
Sbjct: 177 QNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAAALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D 
Sbjct: 237 ETRALERPSDHAPVTAEFDW 256


>gi|123442505|ref|YP_001006482.1| exonuclease III [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122089466|emb|CAL12314.1| exodeoxyribonuclease III [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 268

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/268 (31%), Positives = 128/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEEVSQHGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K +P+ I    P D+ D Q R I A        L + N Y P G       
Sbjct: 61  GHYGVALLTKNEPLAIRRGFPTDEEDAQRRIIMADIATPQGPLTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  +     ++  Q+L  +  ++  GD NI P         D     +      F 
Sbjct: 121 KFPAKERFYADLQQYLEQQLSADAQVLIMGDLNISPTDLDIGIGEDSRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R   ++LQN G  D  RA +   +  +S++DY +  + +N+G+RID ++ S    + 
Sbjct: 181 PEERAWLERLQNWGLVDTFRAANPDCNDQFSWFDYRSRGFDENRGLRIDLLLASRPLAAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   R   KPSDH PV     +
Sbjct: 241 CIATGIDYDIRSMEKPSDHAPVWSEFAL 268


>gi|330941805|gb|EGH44552.1| exonuclease III [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 270

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 90/269 (33%), Positives = 135/269 (50%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPQAEVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD D Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNAPLALHKGFEGDDEDSQKRFIWGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +        +   ++PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKRRFYENLQTLLEGQFRNDQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRHLYPEVVDRFSWFDYRSRGFEDEPKRGLRIDLIMTSSGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +  A +D   RG  KPSDH P+ + L
Sbjct: 241 QPRIKEAGVDYDLRGMEKPSDHAPIWLEL 269


>gi|205352972|ref|YP_002226773.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207857189|ref|YP_002243840.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|205272753|emb|CAR37670.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206708992|emb|CAR33322.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326628046|gb|EGE34389.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 268

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 77/268 (28%), Positives = 122/268 (45%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D+ FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDEMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKATPISVRRGFPDDGEEAQRRIIMAEIPSPLGNITVINGYFPQGENRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKCDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMSRLLKWGLVDTFRQANPQTMDKFSWFDYRSKGFVDNRGLRIDLLLASAPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   R   KPSDH PV  +  +
Sbjct: 241 CAETGIDYDIRSMEKPSDHAPVWATFRV 268


>gi|116050489|ref|YP_790692.1| exonuclease III [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296389031|ref|ZP_06878506.1| exonuclease III [Pseudomonas aeruginosa PAb1]
 gi|313107448|ref|ZP_07793636.1| exodeoxyribonuclease III [Pseudomonas aeruginosa 39016]
 gi|115585710|gb|ABJ11725.1| exodeoxyribonuclease III [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310880138|gb|EFQ38732.1| exodeoxyribonuclease III [Pseudomonas aeruginosa 39016]
          Length = 270

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 87/269 (32%), Positives = 130/269 (48%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I+ + PD+I LQETK  D  FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIERHQPDVIGLQETKVADDQFPQAEIEALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+E+    P D  + Q RFI  TF       + + N Y P G      
Sbjct: 61  GHYGVALLSRQAPLELHRGFPSDGEESQRRFIWGTFSDAQGNPITVMNGYFPQGENREHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+  K  +            + E+ L+  GD NI P+  D           +      F
Sbjct: 121 TKFPAKQRFYADLQSLLENSFKPEQALVVMGDINISPEDCDIGIGEENRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+    L+N G  D+ RA +   +  +S++DY +  +     +G+RID I+ S   
Sbjct: 181 LPEEREWLATLKNWGLVDSFRALNPEVNDRFSWFDYRSRGFEDTPKRGLRIDVILASRVL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
            S    A ID   RG  KPSDH P+ + L
Sbjct: 241 QSRFKDAGIDYDLRGMEKPSDHAPIWLEL 269


>gi|224584182|ref|YP_002637980.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224468709|gb|ACN46539.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 268

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 77/268 (28%), Positives = 121/268 (45%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D+ FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDEMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKATPISVRRGFPDDGEEAQRRIIMAEIPSPLGNITVINGYFPQGESRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +    L+   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKCNNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMSRLLKWGLVDTFRQANPQTMDKFSWFDYRSKGFVDNRGLRIDLLLASAPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   R   KPSDH PV  +  +
Sbjct: 241 CAETGIDYDIRSMEKPSDHAPVWATFRV 268


>gi|269138847|ref|YP_003295548.1| exonuclease III [Edwardsiella tarda EIB202]
 gi|267984508|gb|ACY84337.1| exonuclease III [Edwardsiella tarda EIB202]
 gi|304558837|gb|ADM41501.1| Exodeoxyribonuclease III [Edwardsiella tarda FL6-60]
          Length = 269

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 81/269 (30%), Positives = 124/269 (46%), Gaps = 8/269 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA +++++PD+I LQETK  D  FP + L  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLAAIVEKHSPDVIGLQETKVHDDMFPLQDLAQLGYHLHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L++  P+ +    PGDD + Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVALLTRMAPLAVRKGFPGDDAEAQRRIIMADIPTELGTLTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDC------YNPIIWENDACFT 176
            +  K  +     R+    L  + P++  GD NI P+  D           +      F 
Sbjct: 121 KFPAKSKFYADLQRYLQDALSPQNPVLIMGDMNITPRDIDIGIGEDSRRRWLRSGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHL-YSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWLDRLLAWGLVDTYRQANPQGDERFSWFDYRSKGFDDNRGLRIDLLLASQPLAQR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDIP 264
                ID   R   KPSDH P+     + 
Sbjct: 241 CTDTGIDYAIRAMEKPSDHAPIWAEFALS 269


>gi|16760593|ref|NP_456210.1| exonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|16764653|ref|NP_460268.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29141647|ref|NP_804989.1| exonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|56413712|ref|YP_150787.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|161614297|ref|YP_001588262.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167552346|ref|ZP_02346099.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167991882|ref|ZP_02572981.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168233217|ref|ZP_02658275.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238968|ref|ZP_02664026.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168244409|ref|ZP_02669341.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168263883|ref|ZP_02685856.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|194446222|ref|YP_002040559.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194449710|ref|YP_002045308.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194471225|ref|ZP_03077209.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194733972|ref|YP_002114319.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197250009|ref|YP_002146737.1| exonuclease III [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197264133|ref|ZP_03164207.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197362635|ref|YP_002142272.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198244728|ref|YP_002215824.1| exonuclease III [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|200389740|ref|ZP_03216351.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204927863|ref|ZP_03219064.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|213023056|ref|ZP_03337503.1| exonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. 404ty]
 gi|213162974|ref|ZP_03348684.1| exonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|213427783|ref|ZP_03360533.1| exonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213581312|ref|ZP_03363138.1| exonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-0664]
 gi|213612544|ref|ZP_03370370.1| exonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|213648612|ref|ZP_03378665.1| exonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|213850398|ref|ZP_03381296.1| exonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
 gi|60392242|sp|P0A1A9|EX3_SALTY RecName: Full=Exodeoxyribonuclease III; Short=EXO III;
           Short=Exonuclease III; AltName: Full=AP endonuclease VI
 gi|60392243|sp|P0A1B0|EX3_SALTI RecName: Full=Exodeoxyribonuclease III; Short=EXO III;
           Short=Exonuclease III; AltName: Full=AP endonuclease VI
 gi|25289127|pir||AC0710 exodeoxyribonuclease III (EC 3.1.11.2) [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|4324669|gb|AAD16979.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|16419819|gb|AAL20227.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16502889|emb|CAD02052.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137275|gb|AAO68838.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56127969|gb|AAV77475.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161363661|gb|ABX67429.1| hypothetical protein SPAB_02042 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404885|gb|ACF65107.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194408014|gb|ACF68233.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194457589|gb|EDX46428.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194709474|gb|ACF88695.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197094112|emb|CAR59612.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197213712|gb|ACH51109.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197242388|gb|EDY25008.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288283|gb|EDY27668.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197939244|gb|ACH76577.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199602185|gb|EDZ00731.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204323205|gb|EDZ08401.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205323022|gb|EDZ10861.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205329685|gb|EDZ16449.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205332615|gb|EDZ19379.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205336751|gb|EDZ23515.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205347536|gb|EDZ34167.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|261246511|emb|CBG24321.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993174|gb|ACY88059.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301157839|emb|CBW17333.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912288|dbj|BAJ36262.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321223927|gb|EFX48990.1| Exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322616690|gb|EFY13599.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322619793|gb|EFY16667.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322622362|gb|EFY19207.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322627886|gb|EFY24676.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633016|gb|EFY29759.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322636738|gb|EFY33441.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322641236|gb|EFY37877.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322645225|gb|EFY41754.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322650167|gb|EFY46581.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655740|gb|EFY52042.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322660066|gb|EFY56305.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322665367|gb|EFY61555.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322669646|gb|EFY65793.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673551|gb|EFY69653.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322677477|gb|EFY73541.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322679858|gb|EFY75897.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322687330|gb|EFY83302.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323129573|gb|ADX17003.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323192448|gb|EFZ77678.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323198697|gb|EFZ83798.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323204125|gb|EFZ89139.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323208743|gb|EFZ93681.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323210257|gb|EFZ95156.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323217719|gb|EGA02434.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323220274|gb|EGA04729.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323227561|gb|EGA11719.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229522|gb|EGA13645.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323232745|gb|EGA16841.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240216|gb|EGA24260.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323242796|gb|EGA26817.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323249113|gb|EGA33032.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323254387|gb|EGA38204.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257176|gb|EGA40879.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323263503|gb|EGA47031.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323267084|gb|EGA50569.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323271592|gb|EGA55013.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|326623571|gb|EGE29916.1| exonuclease III [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 268

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 77/268 (28%), Positives = 122/268 (45%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D+ FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDEMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKATPISVRRGFPDDGEEAQRRIIMAEIPSPLGNITVINGYFPQGESRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKCDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMSRLLKWGLVDTFRQANPQTMDKFSWFDYRSKGFVDNRGLRIDLLLASAPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   R   KPSDH PV  +  +
Sbjct: 241 CAETGIDYDIRSMEKPSDHAPVWATFRV 268


>gi|325205470|gb|ADZ00923.1| exodeoxyribonuclease III [Neisseria meningitidis M04-240196]
          Length = 256

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 134/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  I S K
Sbjct: 61  TYNGVAIVSRSVPEDVHFGLPSLPDDPQRRVIAATVGG----VRVINVYCVNGEAIDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMARHGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP   + L   R+D 
Sbjct: 177 KNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAAALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D 
Sbjct: 237 ETRALERPSDHAPVTAEFDW 256


>gi|194292799|ref|YP_002008706.1| exodeoxyribonuclease iii, ap endonuclease, family 1 [Cupriavidus
           taiwanensis LMG 19424]
 gi|193226703|emb|CAQ72654.1| Exodeoxyribonuclease III, AP endonuclease, family 1 [Cupriavidus
           taiwanensis LMG 19424]
          Length = 270

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 109/261 (41%), Positives = 153/261 (58%), Gaps = 5/261 (1%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           S + +AT+N+N IR+R+  L  W+    PDI+CLQE KT D++FP   ++   Y     G
Sbjct: 4   STLKIATFNINGIRSRVGALCHWLAREAPDIVCLQELKTADESFPAREIRDAGYGAIWHG 63

Query: 62  QKSYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           QKS+NGVAIL++  +P+E+   LPGD  D  +R++EA  +     L I  LYLP+GNP  
Sbjct: 64  QKSWNGVAILARGEEPVEVRRGLPGDPDDSHSRYLEAAVSG----LLIACLYLPNGNPQP 119

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             K+D K++W +R +  A +      P++ AGDYN++P   D YNP  W  DA    E R
Sbjct: 120 GPKFDYKLAWFERLIAHAQELFGSGHPVVLAGDYNVVPTDQDIYNPRSWRKDALLQPESR 179

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            ++ +L   G+TDA+R  H    +Y+FWDY+   W  N G+RIDHI+LS E    L  A 
Sbjct: 180 DAYARLLAQGWTDALRQRHPDAPVYTFWDYFRQHWQTNSGLRIDHILLSAELAPRLRDAG 239

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           +D   RG   PSDH P  V L
Sbjct: 240 VDRWVRGEDHPSDHAPAWVVL 260


>gi|330503248|ref|YP_004380117.1| exonuclease III [Pseudomonas mendocina NK-01]
 gi|328917534|gb|AEB58365.1| exonuclease III [Pseudomonas mendocina NK-01]
          Length = 270

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 83/270 (30%), Positives = 135/270 (50%), Gaps = 11/270 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H L A I+++ PD+I LQETK  D+ FP   ++ L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLQALIEKHQPDVIGLQETKVADEQFPEAEIRQLGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+ +P+ +    PGD  D Q RFI  TF   +   + + N Y P G      
Sbjct: 61  GHYGVALLSRQEPLSLHKGFPGDGEDSQRRFIYGTFADASGNPITVMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  +     +   +R + ++ L+  GD NI P+              +      F
Sbjct: 121 VKFPAKQRFYADLQQLLVERFDPQQALVVMGDINISPEDCDIGIGEPNRLRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+    L++ G  D+ R  +   +  +S++DY +  +     +G+RID I+ S + 
Sbjct: 181 LPEEREWLATLKSWGLVDSFRHLNPEVNDRFSWFDYRSRGFEDEPKRGLRIDVILASQQL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            +    A ID   RG  KPSDH P+ + L+
Sbjct: 241 QARFKDAGIDYDLRGMDKPSDHAPIWLELN 270


>gi|114570470|ref|YP_757150.1| exodeoxyribonuclease III [Maricaulis maris MCS10]
 gi|114340932|gb|ABI66212.1| Exodeoxyribonuclease III [Maricaulis maris MCS10]
          Length = 262

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 123/261 (47%), Positives = 167/261 (63%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
            +TVA+WNVNS++AR+ N+  W+ E  PD+ CLQE KT D+ FP   ++ L Y+IET GQ
Sbjct: 2   TLTVASWNVNSVKARLPNVLDWLSEAKPDVACLQEIKTVDEGFPRMEIEDLGYNIETHGQ 61

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           KSYNGVAILSK+   E+   LPGD+ D QAR+IEA        +R+ ++YLP+GNP    
Sbjct: 62  KSYNGVAILSKHPIEELRCGLPGDESDEQARYIEAVIAAEGGPVRVASIYLPNGNPAPGP 121

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KYD K++W++R  R A   L  EEPLI AGDYN IP+  DC++   WE+DA    + R +
Sbjct: 122 KYDYKLAWMERLRRHAQNLLTFEEPLILAGDYNCIPRDSDCWDIAEWESDALALPQTRAA 181

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F+ L+ +G T+A        H Y+F+DY A  W+K  GIRIDH++ SP+A   L    I 
Sbjct: 182 FRALKWLGLTEAFEQLDGRGHQYTFYDYQAGRWNKGHGIRIDHLLCSPQAADHLEGIEIH 241

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
           TK RG  K SDH P++ S  +
Sbjct: 242 TKTRGKEKASDHIPIVGSFSL 262


>gi|34496332|ref|NP_900547.1| exodeoxyribonuclease III [Chromobacterium violaceum ATCC 12472]
 gi|34102184|gb|AAQ58551.1| exodeoxyribonuclease III [Chromobacterium violaceum ATCC 12472]
          Length = 257

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 83/260 (31%), Positives = 135/260 (51%), Gaps = 7/260 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +  ATWNVNS++ R+  +  W+ E   +++CLQE K +   FP   +++  Y     GQK
Sbjct: 1   MRFATWNVNSLKVRLPQVLQWLAETGVEVLCLQELKMDQGAFPLAEIEAAGYRAVWFGQK 60

Query: 64  SYNGVAI--LSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           +YNGVAI   +  +  ++V  +PG   + +              +R+   Y  +G  + S
Sbjct: 61  TYNGVAILARTPLEMTDVVAGIPGYGDEQRRVIAATVNG-----VRVICGYFVNGEAVDS 115

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            KY  K+ W+ +   + +  L     L+  GDYNI P+  D Y+P  W      +   R 
Sbjct: 116 PKYPYKLEWLSKLEGYVAAELARHPQLLLLGDYNIAPEDRDVYDPEGWREQVLCSTPERD 175

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           +F++L  +G +D+ R  +     YS+WDY    + +NKG+RIDHI++S        +  I
Sbjct: 176 AFRRLIALGLSDSFRLFNQEEKQYSWWDYRQMMFRRNKGVRIDHILVSDALKPRAQACEI 235

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D  PR W +PSDHTPV+++L
Sbjct: 236 DKAPRKWERPSDHTPVVLTL 255


>gi|85711701|ref|ZP_01042758.1| Exonuclease III [Idiomarina baltica OS145]
 gi|85694561|gb|EAQ32502.1| Exonuclease III [Idiomarina baltica OS145]
          Length = 269

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 81/269 (30%), Positives = 128/269 (47%), Gaps = 9/269 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N IRAR+H L A I ++ PD+I LQETK  D  FP + ++ + YH+   GQK
Sbjct: 1   MKFISFNINGIRARLHQLQAMIDKHQPDVIGLQETKVHDDQFPQQAVEDMGYHVNFFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTI-NTQTLRIGNLYLPHGNPITST 122
            + GVA+LSK     +    P +  D Q R I   + + +  T+R+ N Y P G      
Sbjct: 61  GHYGVALLSKKPLTNVQKGFPNEPEDAQRRMIMGDYPLDDGATVRVLNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+  K  + +  + + +  L  E+P+I  GD NI  Q  D           +      F
Sbjct: 121 TKFPMKAQFYRDLINYLNDDLSPEQPVIVMGDMNISHQDRDIGIGETNAKRWLRTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTHH-LYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R    ++ + G  D  R  +      +S++DY +  +  N+G+RID I+ +     
Sbjct: 181 LPEERDWLNEVLDWGLIDTYRTLNPEQDNEFSWFDYRSRGFDDNRGLRIDLILATQTLAD 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
               + ID + RG  KPSDH P+     I
Sbjct: 241 RCEESGIDYELRGIEKPSDHAPIWSQFSI 269


>gi|110641869|ref|YP_669599.1| exonuclease III [Escherichia coli 536]
 gi|300987545|ref|ZP_07178252.1| exodeoxyribonuclease III [Escherichia coli MS 200-1]
 gi|110343461|gb|ABG69698.1| exodeoxyribonuclease III [Escherichia coli 536]
 gi|300306115|gb|EFJ60635.1| exodeoxyribonuclease III [Escherichia coli MS 200-1]
 gi|324011528|gb|EGB80747.1| exodeoxyribonuclease III [Escherichia coli MS 60-1]
          Length = 272

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 125/268 (46%), Gaps = 8/268 (2%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
           + +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   G
Sbjct: 3   ATMKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDVMFPLEEVAKLGYNVFYHG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G     
Sbjct: 63  QKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDH 122

Query: 122 TK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDAC 174
              +  K  + +    +    L+ E P++  GD NI P         +     +      
Sbjct: 123 PIKFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCS 182

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEAT 233
           F  E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S    
Sbjct: 183 FLPEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLA 242

Query: 234 SLLHSARIDTKPRGWTKPSDHTPVIVSL 261
                  ID + R   KPSDH PV  + 
Sbjct: 243 ECCVETGIDYEIRSMEKPSDHAPVWATF 270


>gi|262043063|ref|ZP_06016204.1| exodeoxyribonuclease III [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039595|gb|EEW40725.1| exodeoxyribonuclease III [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 268

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 82/266 (30%), Positives = 126/266 (47%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIVEKHQPDVIGLQETKVHDDMFPLEEVARLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G      T
Sbjct: 61  GHYGVALLTKETPITVRRGFPDDGEEAQRRIIMAEIPSPFGNVTVINGYFPQGESRDHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K ++ +    +    L  E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAAFYQNLQNYLETELNKENPVLIMGDMNISPTDLDIGIGEENRKRWLLTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHH-LYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +  +H  +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLLGWGLVDTWRQANPDNHEHFSWFDYRSKGFDDNRGLRIDLLLASQPLAQR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + RG  KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRGMEKPSDHAPVWATF 266


>gi|166363474|ref|YP_001655747.1| exodeoxyribonuclease III [Microcystis aeruginosa NIES-843]
 gi|166085847|dbj|BAG00555.1| exodeoxyribonuclease III [Microcystis aeruginosa NIES-843]
          Length = 266

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 94/262 (35%), Positives = 149/262 (56%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR+R   +  W++ N  +++CLQETK  D++FP E  +SL YH+   GQK
Sbjct: 1   MKIATWNVNSIRSRQEQVINWLQLNPVEVLCLQETKVIDRDFPREAFESLGYHLYISGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHL---PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           SYNGVAI S+    +I        G++L  +    +   T     +RI NLY+P+G+ + 
Sbjct: 61  SYNGVAIFSRKPLDDITVGFSPIIGENLTGELDEQKRVITGVIGDIRIINLYVPNGSSLD 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPL-IFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           S KY  K+ W++   ++  + +  +       GD+NI  +  D Y+P   EN    + + 
Sbjct: 121 SDKYIYKLKWLETLRKYLDKIINSQPEELCICGDFNIALEDKDIYDPKGKENHIMSSAKE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++ +K+  +G  DA R        YS+WDY +  +++N+G RIDH+ L+P+      + 
Sbjct: 181 REALEKVLEIGLQDAFRKFTSAAGHYSWWDYRSGGFARNRGWRIDHLYLTPQLYEKAVNC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            ID +PR   KPSDHTPVI+ +
Sbjct: 241 LIDREPRKQEKPSDHTPVILEI 262


>gi|67924378|ref|ZP_00517808.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth
           [Crocosphaera watsonii WH 8501]
 gi|67853771|gb|EAM49100.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth
           [Crocosphaera watsonii WH 8501]
          Length = 262

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 90/262 (34%), Positives = 140/262 (53%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR R  ++  W+  N+ D++CLQETK  DK+FP +  + L YH    GQK
Sbjct: 1   MKIATWNVNSIRTRQPHVIDWLTNNSIDVLCLQETKVIDKDFPRQPFEELGYHTYIYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT---QTLRIGNLYLPHGNPIT 120
           +YNGVAI S+    +I+T       + +A+  +    I +     +RI N+Y+P+G  + 
Sbjct: 61  AYNGVAIFSRQPMTDIITGFTDIVGEEKAQSFDEQKRIISGVIDDIRIINVYVPNGASLG 120

Query: 121 STKYDDKISWIKRFLRFASQ-RLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           S KY+ K+ W +    +     L+    +   GD+NI     D YN    E     +   
Sbjct: 121 SEKYEYKLQWFQVLKAYLDDLILKEAREVCICGDFNIALDDKDIYNSKGKEKHIMSSPVE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++ Q +  +G  DA R        +S+WDY +  + +N+G RIDH+ L+ +      + 
Sbjct: 181 RETLQNILTIGLKDAFRKFTTEGGHFSWWDYRSGGFQRNRGWRIDHLYLTHKLYEKAINC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            ID +PR   KPSDHTPVI+ +
Sbjct: 241 TIDIEPRKQEKPSDHTPVILEI 262


>gi|258621396|ref|ZP_05716430.1| exodeoxyribonuclease III [Vibrio mimicus VM573]
 gi|262171177|ref|ZP_06038855.1| exodeoxyribonuclease III [Vibrio mimicus MB-451]
 gi|258586784|gb|EEW11499.1| exodeoxyribonuclease III [Vibrio mimicus VM573]
 gi|261892253|gb|EEY38239.1| exodeoxyribonuclease III [Vibrio mimicus MB-451]
          Length = 268

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 128/268 (47%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP + ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPRQEVEAMGYQVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGD-DLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVAIL K  P+E++   P D +   +   +      +     I N Y P G+ +   
Sbjct: 61  AHYGVAILCKQTPVEVIKGFPTDSEEHQKRMIMATFADEDGNKTTILNGYFPQGDNVEHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + +  + +  +     E L+  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYRDLMTYLREHRSNTERLVVMGDINISPLDLDIGIGEANRKRWLQTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H      +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLQTLMDWGLVDTFRQLHPEVSDQFSWFDYRSRGFDDNRGLRIDVILATPTLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + RG  KPSDH P+  +  
Sbjct: 241 TCQEAGIDYELRGIDKPSDHAPIWATFK 268


>gi|218709053|ref|YP_002416674.1| exonuclease III [Vibrio splendidus LGP32]
 gi|218322072|emb|CAV18146.1| Exodeoxyribonuclease III [Vibrio splendidus LGP32]
          Length = 268

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 132/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP   ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAIIDKHQPDVIGLQEIKVHDEAFPLADVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P  ++   +   +      + + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKQEPISVQKGFPTDNEDHQKRMIMATFEDEHGEKVTVLNGYFPQGDNIKHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
           TKY  K  + K  + + +     +E +I  GD NI P               +      F
Sbjct: 121 TKYPYKRQFYKDLMTYLNDYHNKDEQVIVMGDINISPTDIDIGIGEPNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D+ R  H   +  YS++DY +  +  N+G+RID ++ + +   
Sbjct: 181 QPEEREWLKTLMDWGFVDSFRLLHPEVNDQYSWFDYRSKGFVDNRGLRIDVVLATQKLAD 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + RG  KPSDH P+  +  
Sbjct: 241 KCTEAGIDYELRGIEKPSDHAPIWSTFK 268


>gi|168463303|ref|ZP_02697234.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168821944|ref|ZP_02833944.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|195634571|gb|EDX52923.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205341658|gb|EDZ28422.1| exodeoxyribonuclease III [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
          Length = 268

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 77/268 (28%), Positives = 122/268 (45%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D+ FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDEMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKATPISVRRGFPDDGEEAQRRIIMAEIPSPLGNITVINGYFPQGESRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKCDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMSRLLKWGLVDTFREANPQTMDKFSWFDYRSKGFVDNRGLRIDLLLASAPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   R   KPSDH PV  +  +
Sbjct: 241 CAETGIDYDIRSMEKPSDHAPVWATFRV 268


>gi|295676960|ref|YP_003605484.1| exodeoxyribonuclease III Xth [Burkholderia sp. CCGE1002]
 gi|295436803|gb|ADG15973.1| exodeoxyribonuclease III Xth [Burkholderia sp. CCGE1002]
          Length = 283

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 84/258 (32%), Positives = 132/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           V +ATWNVNS++ R  ++  W+  +  D++CLQE K  D+ FP   L+++ Y     GQK
Sbjct: 26  VKIATWNVNSLKVRQQHVIDWLASSGTDVLCLQELKLPDEKFPRAELEAVGYRSWYAGQK 85

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGV IL +   + +       ++       +         +RI + Y P+G    + K
Sbjct: 86  TYNGVGILVREG-VNVDESSIVRNIPGFEDPQQRVIAATVDGVRIISAYFPNGQAPGTDK 144

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     + +  + L   L   GDYNI P+  D ++P  WE     + E R +F
Sbjct: 145 FAYKLRWLDALHDWLATEMTLHPKLALLGDYNIAPEDRDVHDPKAWEGQNLVSPEERAAF 204

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +G  DA R       +YS+WDY   ++ +N G+RIDHI+LS   + +  +  ID 
Sbjct: 205 VRLIGLGLLDAFRQFEQQEKIYSWWDYRMMAFRRNAGLRIDHILLSKALSDICKACDIDK 264

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDH PV   L
Sbjct: 265 VPRKWDQPSDHAPVFAQL 282


>gi|240949558|ref|ZP_04753897.1| exonuclease III [Actinobacillus minor NM305]
 gi|257465617|ref|ZP_05629988.1| exonuclease III [Actinobacillus minor 202]
 gi|240295999|gb|EER46665.1| exonuclease III [Actinobacillus minor NM305]
 gi|257451277|gb|EEV25320.1| exonuclease III [Actinobacillus minor 202]
          Length = 267

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 83/267 (31%), Positives = 127/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I+++ PD+I LQE K  D++FP++ +  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKHQPDVIGLQEIKVADEDFPYDLVNHLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K  P+ +    P D  D Q R I A       TL + N Y P G   +  T
Sbjct: 61  GHYGVALLTKKAPLAVRKGFPTDAEDAQKRMIMADIETEFGTLTVLNGYFPQGENRSHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +      +   +L+ E P+I  GD NI P               + +    F 
Sbjct: 121 KFPAKAKFYADLQHYLENQLKPENPIIIMGDMNISPTDLDIGIGEANRKRWLRDGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  RA +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWLDRLYGYGLVDTFRAMNPLAADKFSWFDYRSKGFDDNRGLRIDLVLASKSLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                ID + R   KPSDH+PV     
Sbjct: 241 CVETGIDLEIRAMEKPSDHSPVWAVFK 267


>gi|194099379|ref|YP_002002479.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae NCCP11945]
 gi|240014802|ref|ZP_04721715.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae DGI18]
 gi|240116328|ref|ZP_04730390.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae PID18]
 gi|240121325|ref|ZP_04734287.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae PID24-1]
 gi|268601995|ref|ZP_06136162.1| exodeoxyribonuclease III [Neisseria gonorrhoeae PID18]
 gi|193934669|gb|ACF30493.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae NCCP11945]
 gi|268586126|gb|EEZ50802.1| exodeoxyribonuclease III [Neisseria gonorrhoeae PID18]
          Length = 256

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 136/260 (52%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRSVPQDVHFGLPSLPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRHGKLVLLGDFNIAPADADCYDPEKWYEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI+++ E  ++L   RID 
Sbjct: 177 QNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVTSEMAAVLKDVRIDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D+
Sbjct: 237 ETRALERPSDHAPVAAEFDL 256


>gi|84393754|ref|ZP_00992502.1| exodeoxyribonuclease III [Vibrio splendidus 12B01]
 gi|84375616|gb|EAP92515.1| exodeoxyribonuclease III [Vibrio splendidus 12B01]
          Length = 268

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 132/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP   ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAIIDKHQPDVIGLQEIKVHDEAFPLADVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +P+ +    P  ++   +   +      N + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKQEPVSVQKGFPTDNEDHQKRMIMATFEDENGEKVTVLNGYFPQGDNIKHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
           TKY  K  + K  + + +     +E +I  GD NI P               +      F
Sbjct: 121 TKYPYKREFYKDLMTYLNDYHNKDEQVIVMGDINISPTDIDIGIGEPNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D+ R  H   +  YS++DY +  +  N+G+RID ++ + +   
Sbjct: 181 QPEEREWLKTLMDWGFVDSFRLLHPEVNDQYSWFDYRSKGFVDNRGLRIDVVLATQKLAD 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + RG  KPSDH P+  +  
Sbjct: 241 KCTEAGIDYELRGIEKPSDHAPIWSTFK 268


>gi|218695307|ref|YP_002402974.1| exonuclease III [Escherichia coli 55989]
 gi|331668438|ref|ZP_08369286.1| exodeoxyribonuclease III [Escherichia coli TA271]
 gi|218352039|emb|CAU97776.1| exonuclease III [Escherichia coli 55989]
 gi|323948123|gb|EGB44113.1| exodeoxyribonuclease III [Escherichia coli H120]
 gi|324119235|gb|EGC13123.1| exodeoxyribonuclease III [Escherichia coli E1167]
 gi|331063632|gb|EGI35543.1| exodeoxyribonuclease III [Escherichia coli TA271]
          Length = 268

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 123/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|332161914|ref|YP_004298491.1| exonuclease III [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318605567|emb|CBY27065.1| exodeoxyribonuclease III [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325666144|gb|ADZ42788.1| exonuclease III [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330859743|emb|CBX70078.1| exodeoxyribonuclease III [Yersinia enterocolitica W22703]
          Length = 268

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 83/268 (30%), Positives = 128/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA I+++ PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIIEQHQPDVIGLQETKVHDDMFPLEEVSQHGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K +P+ +    P D+ D Q R I A        L + N Y P G       
Sbjct: 61  GHYGVALLTKNEPLAVRRGFPTDEEDAQRRIIMADIATPQGPLTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  +     ++  Q+L  +  ++  GD NI P         D     +      F 
Sbjct: 121 KFPAKERFYADLQQYLEQQLSADAQVLIMGDLNISPTDLDIGIGEDSRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R   ++LQN G  D  RA +   +  +S++DY +  + +N+G+RID ++ S    + 
Sbjct: 181 PEERAWLERLQNWGLVDTFRAANPDCNDQFSWFDYRSRGFDENRGLRIDLLLASRPLAAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   R   KPSDH PV     +
Sbjct: 241 CIATGIDYDIRSMEKPSDHAPVWSEFAV 268


>gi|323978068|gb|EGB73154.1| exodeoxyribonuclease III [Escherichia coli TW10509]
          Length = 268

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 77/266 (28%), Positives = 122/266 (45%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPDDGEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLADC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|56479910|ref|NP_707364.2| exonuclease III [Shigella flexneri 2a str. 301]
 gi|56383461|gb|AAN43071.2| exonuclease III [Shigella flexneri 2a str. 301]
          Length = 268

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 123/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEETQRRIIMAEIPSLLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLMSWGVVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|56552297|ref|YP_163136.1| exodeoxyribonuclease III Xth [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543871|gb|AAV90025.1| exodeoxyribonuclease III Xth [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 261

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 113/260 (43%), Positives = 160/260 (61%), Gaps = 6/260 (2%)

Query: 5   TVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQKS 64
            +A++NVN I AR+  L  W+++  PDI+CLQE K++D  FP E ++   Y+    GQK+
Sbjct: 3   KIASFNVNGINARLPRLIEWLEKFQPDILCLQELKSDDARFPQEEIEKTGYYCLYHGQKA 62

Query: 65  YNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTKY 124
           YNGVAILSK QP  I T LP D    Q+R+IEA        L + +LYLP+GNP+ S KY
Sbjct: 63  YNGVAILSKEQPKLIRTSLPDDPDPTQSRYIEAEID----NLTVASLYLPNGNPLNSPKY 118

Query: 125 DDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH--DCYNPIIWENDACFTLEVRQS 182
           D K++W K FL  A    + E+P+I AGDYN++P     D  N     ++A    E    
Sbjct: 119 DYKLAWFKAFLAHARSLWQQEKPVILAGDYNVVPSFDIKDIRNAAALADNALLAPESLFY 178

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           +++L  MG+TD++R  H +  LYSFWDY A SW ++ G+RIDHI+L+P+    L  + +D
Sbjct: 179 WRQLLAMGWTDSLRVRHPSEPLYSFWDYQAQSWPRDDGMRIDHILLTPDLADGLTDSGVD 238

Query: 243 TKPRGWTKPSDHTPVIVSLD 262
            + RG  K SDH PV + +D
Sbjct: 239 RQMRGQEKASDHAPVWIEID 258


>gi|240113324|ref|ZP_04727814.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae MS11]
 gi|260439854|ref|ZP_05793670.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae DGI2]
 gi|268599400|ref|ZP_06133567.1| exodeoxyribonuclease III [Neisseria gonorrhoeae MS11]
 gi|291043128|ref|ZP_06568851.1| exodeoxyribonuclease III [Neisseria gonorrhoeae DGI2]
 gi|268583531|gb|EEZ48207.1| exodeoxyribonuclease III [Neisseria gonorrhoeae MS11]
 gi|291012734|gb|EFE04717.1| exodeoxyribonuclease III [Neisseria gonorrhoeae DGI2]
          Length = 256

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 136/260 (52%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRSVPQDVHFGLPSLPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMSRHGKLVLLGDFNIAPADADCYDPEKWYEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI+++ E  ++L   RID 
Sbjct: 177 QNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVTSEMAAVLKDVRIDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D+
Sbjct: 237 ETRALERPSDHAPVAAEFDL 256


>gi|124267258|ref|YP_001021262.1| exodeoxyribonuclease III [Methylibium petroleiphilum PM1]
 gi|124260033|gb|ABM95027.1| Exodeoxyribonuclease III [Methylibium petroleiphilum PM1]
          Length = 256

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 82/258 (31%), Positives = 135/258 (52%), Gaps = 5/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+  N  D + LQETK  D  FP   +++  Y ++  GQK
Sbjct: 1   MRLATWNVNSLAVRLPQVLDWLTANPVDALVLQETKLTDDKFPRAEIEAAGYAVQWFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+LS+    ++  ++ G   +                +R+   Y P+G    S K
Sbjct: 61  TYNGVALLSREPAHDVTKNIFGFADEQARVIAGTVDG-----VRVIGAYFPNGQAPDSEK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K++W++    +    L     L+  GD+NI P+  D ++P++W      T + R+ F
Sbjct: 116 FTYKMAWLQALRDWVRSELAAHPRLVLMGDFNIAPEDRDVHDPVLWAGQIHCTPQEREHF 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L  +G  DA R        +S+WDY   ++ KN+G+RIDHI++S      + +  ID 
Sbjct: 176 RELIALGLVDAFRLFEQPPKSWSWWDYRNLAFRKNQGLRIDHILVSEALRPAVSACMIDK 235

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR   +PSDH PV+V L
Sbjct: 236 LPRKNERPSDHAPVVVEL 253


>gi|296393768|ref|YP_003658652.1| exodeoxyribonuclease III Xth [Segniliparus rotundus DSM 44985]
 gi|296180915|gb|ADG97821.1| exodeoxyribonuclease III Xth [Segniliparus rotundus DSM 44985]
          Length = 267

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 126/266 (47%), Gaps = 7/266 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NSIRAR     AW++ +  D++ LQETK  +  FP    +   Y +   G  
Sbjct: 1   MRIATWNINSIRARADRAVAWLERSQVDVLALQETKCANAQFPEAPFREAGYAVAHTGNG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPHGNP 118
            +NGVAI+S+    ++     G     +     A             +RI +LY+P+G  
Sbjct: 61  QWNGVAIVSRLGLGDVRIGFDGQPGFHKDPEAPAEPEPRAIAATCGGVRIWSLYVPNGRD 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRL--ELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           +    Y  K+ W+      A   L  + E  +  AGD+NI P   D ++P ++E     +
Sbjct: 121 LADRHYRYKLDWLAALKDQAEGWLAADPEAKIALAGDWNIAPFDEDVWDPSLFEGKTHTS 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              R +F   +  GFTD  R       LY++WDY    + + +G+RID ++ SP     +
Sbjct: 181 APERAAFFAFEQAGFTDVARPHTPGPGLYTYWDYTQLRFPRREGMRIDFVLGSPALARAV 240

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSLD 262
             A +D + R     SDH PV+V L+
Sbjct: 241 QGASVDREERKGKGASDHAPVVVDLE 266


>gi|330431149|gb|AEC16208.1| exonuclease III [Gallibacterium anatis UMN179]
          Length = 267

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 82/267 (30%), Positives = 121/267 (45%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L   I +  PD++ LQE K  D+ FP E +  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLHQLIAQYQPDVLGLQEIKVADEAFPHEIVADLGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
           S+ GVA+L+K QP+ +    P D  D Q R I A        L + N Y P G   +  T
Sbjct: 61  SHYGVALLTKQQPLAVRKGFPTDAEDAQRRIIMADLATPFGQLTVINGYFPQGENRSHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  +      P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYRDLQHYLVKEHNAANPVLVMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  Q L   G  D  RA H   +  +S++DY +  +  N+G+RID I+ +      
Sbjct: 181 PEEREWLQNLYQYGLVDTFRALHPQVNDQFSWFDYRSKGFDDNRGLRIDLILANQALAQR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
             SA I    R   KPSDH P+     
Sbjct: 241 CISAGIAKDIRAMEKPSDHAPIWAEFK 267


>gi|308375155|ref|ZP_07442904.2| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu007]
 gi|308376392|ref|ZP_07438692.2| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu008]
 gi|308347245|gb|EFP36096.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu007]
 gi|308351175|gb|EFP40026.1| exodeoxyribonuclease III protein xthA [Mycobacterium tuberculosis
           SUMu008]
          Length = 273

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 126/266 (47%), Gaps = 7/266 (2%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           ++ +ATWNVNSIR R+  +  W+   + D++ +QETK  D  FP   L  L Y +   G 
Sbjct: 5   LLRLATWNVNSIRTRLDRVLDWLGRADVDVLAMQETKCPDGQFPALPLFELGYDVAHVGF 64

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPHGN 117
             +NGVAI S+    ++     G         + AT            +R+ +LY+P+G 
Sbjct: 65  DQWNGVAIASRVGLDDVRVGFDGQPSWSGKPEVAATTEARALGATCGGIRVWSLYVPNGR 124

Query: 118 PITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACF 175
            +    Y  K+ W+      A   L  +   P+   GD+NI P   D ++   +      
Sbjct: 125 ALDDPHYTYKLDWLAALRDTAEGWLRDDPAAPIALMGDWNIAPTDDDVWSTEFFAGCTHV 184

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
           +   R++F  + +  FTD +R       +Y++WDY    + K +G+RID I+ SP   + 
Sbjct: 185 SEPERKAFNAIVDAQFTDVVRPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAAR 244

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
           +  A+I  + R    PSDH PV+V L
Sbjct: 245 VMDAQIVREERKGKAPSDHAPVLVDL 270


>gi|302186191|ref|ZP_07262864.1| exonuclease III [Pseudomonas syringae pv. syringae 642]
          Length = 270

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 89/269 (33%), Positives = 134/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPQAEVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD D Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNAPLALHKGFEGDDEDSQKRFIWGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +        +   ++PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQTLLESQFRNDQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L++ G  D  R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKSWGLVDTFRHLYPEVVDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +  A +D   RG  KPSDH P+ + L
Sbjct: 241 QPRIKEAGVDYDLRGMEKPSDHAPIWLEL 269


>gi|269796800|ref|YP_003316255.1| exodeoxyribonuclease III [Sanguibacter keddieii DSM 10542]
 gi|269098985|gb|ACZ23421.1| Exodeoxyribonuclease III [Sanguibacter keddieii DSM 10542]
          Length = 263

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 80/261 (30%), Positives = 130/261 (49%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NSIRAR+    A+++ +  D++ LQETK +D  FPFE  ++  Y +   G  
Sbjct: 1   MRLATWNINSIRARVDRAVAFLERSGTDVLALQETKAKDSQFPFEAFEAAGYEVAHFGLS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT-LRIGNLYLPHGNPITST 122
            +NGVAI+S+    ++    P      +   +EA     T   +R+ +LY+PHG  + + 
Sbjct: 61  QWNGVAIISRVGLEDVSLGFPDQPQFGEEPVVEARAIGATCGGVRVWSLYVPHGRALDNP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIF--AGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
            Y  K+ W+      A   +E +        GD+N+ P+  D ++  ++E     +   R
Sbjct: 121 HYAYKLDWLSTLRGHAQSWVEADPQAKVALVGDWNVAPRDTDVWDMAVFEGQTHVSQPER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +F   +  G+T+  R        Y++WDY    + KN+G+RID    SP  TS +    
Sbjct: 181 DAFAAFEGAGYTEVSREFVPEDRKYTYWDYQQLRFPKNQGLRIDFAYTSPALTSAVTGVE 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           ID   R     SDH PVIV +
Sbjct: 241 IDRDERKGKGASDHVPVIVDI 261


>gi|198282497|ref|YP_002218818.1| exodeoxyribonuclease III Xth [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667378|ref|YP_002424687.1| exodeoxyribonuclease III [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198247018|gb|ACH82611.1| exodeoxyribonuclease III Xth [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218519591|gb|ACK80177.1| exodeoxyribonuclease III [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 257

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 85/259 (32%), Positives = 128/259 (49%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R+  +  W+    PD++CLQETK  D  FP   L    Y     GQ 
Sbjct: 1   MKIATWNVNSLKVRLPQVLEWLGSEQPDVLCLQETKLADARFPVAELADAGYRALYHGQP 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAILS+  P ++    P            +        LR+ N+Y+P+G  + S K
Sbjct: 61  TYNGVAILSRTSPSDVRCDWPDGGDGQARLCAASFGD-----LRVVNVYVPNGQALDSDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++R     +  L+    L+  GD+NI P   D Y+   W      +   R + 
Sbjct: 116 YPYKLQWLERLRGLIAGELQGWPQLLLVGDFNIAPDTRDVYDAAEWGEGILCSAPERAAL 175

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L  +G  D+ R  H     +S+WDY A ++ +N+G+RID I+ S    S      ID 
Sbjct: 176 GALLELGLHDSYRKMHPDARAWSWWDYRAAAFRRNQGLRIDLILASSPVLSRTREVVIDR 235

Query: 244 KPRGWTKPSDHTPVIVSLD 262
             R   +PSDH PV ++L+
Sbjct: 236 AARAAERPSDHAPVCITLE 254


>gi|209520714|ref|ZP_03269463.1| exodeoxyribonuclease III Xth [Burkholderia sp. H160]
 gi|209498839|gb|EDZ98945.1| exodeoxyribonuclease III Xth [Burkholderia sp. H160]
          Length = 258

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 83/258 (32%), Positives = 133/258 (51%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R  ++  W+  +  D++CLQE K  D+ FP   L+++ Y     GQK
Sbjct: 1   MKIATWNVNSLKVRQQHVIDWLASSGTDVLCLQELKLPDEKFPRAELEAIGYRSWYAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGV IL + + + +       ++       +       + +RI + Y P+G    + K
Sbjct: 61  TYNGVGILVR-EGLNVDESSIVRNIPGFEDQQQRVIAATVEGVRIISAYFPNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     + S    L   L   GDYNI P+  D ++P  WE     + E R +F
Sbjct: 120 FAYKLRWLDALHDWLSTETTLHPKLALLGDYNIAPEDRDVHDPKAWEGQNLVSPEERAAF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +G  DA R       +YS+WDY   ++ +N G+RIDHI+LS   + +  +  +D 
Sbjct: 180 VRLIALGLLDAFRQFEQPEKIYSWWDYRMMAFRRNAGLRIDHILLSKALSDICTACDVDK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PR W +PSDH PV   L
Sbjct: 240 VPRKWDQPSDHAPVFAQL 257


>gi|85059341|ref|YP_455043.1| exonuclease III [Sodalis glossinidius str. 'morsitans']
 gi|84779861|dbj|BAE74638.1| exodeoxyribonuclease III [Sodalis glossinidius str. 'morsitans']
          Length = 268

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 83/268 (30%), Positives = 123/268 (45%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I    PD+I LQETK  D  FP E +    YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIITTLQPDVIGLQETKVHDDMFPLEEVSRHGYHVYYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+LS+ +P+ I      D  + Q R I A F      L + N Y P G       
Sbjct: 61  GHYGVALLSREKPLAIRRGFSTDGAEAQRRIIMADFLTPKGALTVVNGYFPQGENRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q    E  L+  GD NI P         +     +      F 
Sbjct: 121 KFPAKERFYRDLQGYVEQSHHGESLLLIMGDMNISPTDLDIGIGEESRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHH-LYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R   ++L + G  D  R  + T    YS++DY +  + +N+G+RID ++ S    ++
Sbjct: 181 PEERAWMERLLSWGLVDTYRQANPTDDSRYSWFDYRSRGFDENRGLRIDLLLASKPLAAV 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
           + +A ID   R   KPSDH PV     +
Sbjct: 241 VRAAGIDYTIRAMDKPSDHAPVWADFAL 268


>gi|239994244|ref|ZP_04714768.1| exodeoxyribonuclease III [Alteromonas macleodii ATCC 27126]
          Length = 269

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 84/268 (31%), Positives = 132/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N IRAR+H L A I  + PDII LQE K  ++ FP E ++++ YH+   GQK
Sbjct: 1   MKVISFNINGIRARLHQLQAVIDAHQPDIIGLQEIKVHNEQFPVEAVEAMGYHVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLD-VQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           S+ GVA L+K +P+ +    P DD D  +   I  T     + + + N Y P G      
Sbjct: 61  SHYGVAFLAKKEPLSVSMGFPTDDEDAQRRMIILKTTDDAGEPVTVLNGYFPQGENEKHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TKY  K  + K  + +       ++ +I  GD NI           D     +      F
Sbjct: 121 TKYPAKRKFYKDLMTYLDDNHTPDDNVIVMGDVNISHTDLDIGIGEDNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+    + + GF D+ R  +   +  +S++DY +  ++ N+G+RID I+ +    +
Sbjct: 181 LPEEREWLNTVIDWGFEDSFRTLNPETNDKFSWFDYRSKGFNDNRGLRIDLILATKPLHA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            LH A ID + RG  KPSDH P+     
Sbjct: 241 KLHDAGIDYELRGIEKPSDHAPIWAEYK 268


>gi|24374562|ref|NP_718605.1| exonuclease III [Shewanella oneidensis MR-1]
 gi|24349161|gb|AAN56049.1|AE015740_3 exodeoxyribonuclease III [Shewanella oneidensis MR-1]
          Length = 270

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 132/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +R+R+H L A I  + PDII LQETK  D+ FP   ++++ YH+   G K
Sbjct: 1   MKIVSFNINGLRSRLHQLQALIDSHQPDIIGLQETKVHDEAFPLAEVEAMGYHVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
           ++ GVA+LSK  P+++      D+ D Q R I  TF   N + L + N Y P G  I   
Sbjct: 61  AHYGVAMLSKVAPLKVQKGFATDEEDAQRRMIIGTFAQANGRPLTVLNGYFPQGESIDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            KY  K  + +  +         +E +   GD NI P   D           +      F
Sbjct: 121 TKYPAKRKFYQDLMAHLHANHSNDEDIAIIGDINISPIDLDIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + LQ+ G  D  R  H      YS++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLKTLQDWGLVDTFRQLHPDRSERYSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            L  + +D + RG  KPSDH P+  +  
Sbjct: 241 RLVESDVDYELRGIDKPSDHAPIWSTFK 268


>gi|218699684|ref|YP_002407313.1| exonuclease III [Escherichia coli IAI39]
 gi|218369670|emb|CAR17439.1| exonuclease III [Escherichia coli IAI39]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 77/266 (28%), Positives = 122/266 (45%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPDDGEEAQRRIIIAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|16129703|ref|NP_416263.1| exonuclease III [Escherichia coli str. K-12 substr. MG1655]
 gi|74311932|ref|YP_310351.1| exonuclease III [Shigella sonnei Ss046]
 gi|82543848|ref|YP_407795.1| exonuclease III [Shigella boydii Sb227]
 gi|89108588|ref|AP_002368.1| exonuclease III [Escherichia coli str. K-12 substr. W3110]
 gi|157157800|ref|YP_001463047.1| exonuclease III [Escherichia coli E24377A]
 gi|157161211|ref|YP_001458529.1| exonuclease III [Escherichia coli HS]
 gi|170081406|ref|YP_001730726.1| exonuclease III [Escherichia coli str. K-12 substr. DH10B]
 gi|187730490|ref|YP_001880544.1| exonuclease III [Shigella boydii CDC 3083-94]
 gi|188495310|ref|ZP_03002580.1| exodeoxyribonuclease III [Escherichia coli 53638]
 gi|191169042|ref|ZP_03030806.1| exodeoxyribonuclease III [Escherichia coli B7A]
 gi|193065803|ref|ZP_03046866.1| exodeoxyribonuclease III [Escherichia coli E22]
 gi|193068936|ref|ZP_03049895.1| exodeoxyribonuclease III [Escherichia coli E110019]
 gi|194428570|ref|ZP_03061109.1| exodeoxyribonuclease III [Escherichia coli B171]
 gi|194438505|ref|ZP_03070594.1| exodeoxyribonuclease III [Escherichia coli 101-1]
 gi|209919111|ref|YP_002293195.1| exonuclease III [Escherichia coli SE11]
 gi|218554315|ref|YP_002387228.1| exonuclease III [Escherichia coli IAI1]
 gi|238900963|ref|YP_002926759.1| exonuclease III [Escherichia coli BW2952]
 gi|254161808|ref|YP_003044916.1| exonuclease III [Escherichia coli B str. REL606]
 gi|256018057|ref|ZP_05431922.1| exonuclease III [Shigella sp. D9]
 gi|256022587|ref|ZP_05436452.1| exonuclease III [Escherichia sp. 4_1_40B]
 gi|260844099|ref|YP_003221877.1| exonuclease III [Escherichia coli O103:H2 str. 12009]
 gi|260855614|ref|YP_003229505.1| exonuclease III [Escherichia coli O26:H11 str. 11368]
 gi|260868274|ref|YP_003234676.1| exonuclease III [Escherichia coli O111:H- str. 11128]
 gi|293446121|ref|ZP_06662543.1| exodeoxyribonuclease III [Escherichia coli B088]
 gi|297518661|ref|ZP_06937047.1| exonuclease III [Escherichia coli OP50]
 gi|301020970|ref|ZP_07185022.1| exodeoxyribonuclease III [Escherichia coli MS 196-1]
 gi|307138408|ref|ZP_07497764.1| exonuclease III [Escherichia coli H736]
 gi|307310679|ref|ZP_07590325.1| exodeoxyribonuclease III [Escherichia coli W]
 gi|312969777|ref|ZP_07783960.1| exodeoxyribonuclease III [Escherichia coli 1827-70]
 gi|2506193|sp|P09030|EX3_ECOLI RecName: Full=Exodeoxyribonuclease III; Short=EXO III;
           Short=Exonuclease III; AltName: Full=AP endonuclease VI
 gi|157829928|pdb|1AKO|A Chain A, Exonuclease Iii From Escherichia Coli
 gi|43312|emb|CAA31424.1| exonuclease III [Escherichia coli K-12]
 gi|1742858|dbj|BAA15540.1| exonuclease III [Escherichia coli str. K12 substr. W3110]
 gi|1788046|gb|AAC74819.1| exonuclease III [Escherichia coli str. K-12 substr. MG1655]
 gi|73855409|gb|AAZ88116.1| exonuclease III [Shigella sonnei Ss046]
 gi|81245259|gb|ABB65967.1| exonuclease III [Shigella boydii Sb227]
 gi|157066891|gb|ABV06146.1| exodeoxyribonuclease III [Escherichia coli HS]
 gi|157079830|gb|ABV19538.1| exodeoxyribonuclease III [Escherichia coli E24377A]
 gi|169889241|gb|ACB02948.1| exonuclease III [Escherichia coli str. K-12 substr. DH10B]
 gi|187427482|gb|ACD06756.1| exodeoxyribonuclease III [Shigella boydii CDC 3083-94]
 gi|188490509|gb|EDU65612.1| exodeoxyribonuclease III [Escherichia coli 53638]
 gi|190900924|gb|EDV60709.1| exodeoxyribonuclease III [Escherichia coli B7A]
 gi|192926575|gb|EDV81206.1| exodeoxyribonuclease III [Escherichia coli E22]
 gi|192957731|gb|EDV88175.1| exodeoxyribonuclease III [Escherichia coli E110019]
 gi|194413448|gb|EDX29731.1| exodeoxyribonuclease III [Escherichia coli B171]
 gi|194422515|gb|EDX38513.1| exodeoxyribonuclease III [Escherichia coli 101-1]
 gi|209912370|dbj|BAG77444.1| exonuclease III [Escherichia coli SE11]
 gi|218361083|emb|CAQ98666.1| exonuclease III [Escherichia coli IAI1]
 gi|238861051|gb|ACR63049.1| exonuclease III [Escherichia coli BW2952]
 gi|242377470|emb|CAQ32223.1| exonuclease III [Escherichia coli BL21(DE3)]
 gi|253973709|gb|ACT39380.1| exonuclease III [Escherichia coli B str. REL606]
 gi|253977903|gb|ACT43573.1| exonuclease III [Escherichia coli BL21(DE3)]
 gi|257754263|dbj|BAI25765.1| exonuclease III [Escherichia coli O26:H11 str. 11368]
 gi|257759246|dbj|BAI30743.1| exonuclease III [Escherichia coli O103:H2 str. 12009]
 gi|257764630|dbj|BAI36125.1| exonuclease III [Escherichia coli O111:H- str. 11128]
 gi|291322951|gb|EFE62379.1| exodeoxyribonuclease III [Escherichia coli B088]
 gi|299881725|gb|EFI89936.1| exodeoxyribonuclease III [Escherichia coli MS 196-1]
 gi|306908857|gb|EFN39353.1| exodeoxyribonuclease III [Escherichia coli W]
 gi|309701971|emb|CBJ01285.1| exodeoxyribonuclease III [Escherichia coli ETEC H10407]
 gi|310338062|gb|EFQ03151.1| exodeoxyribonuclease III [Escherichia coli 1827-70]
 gi|320173600|gb|EFW48793.1| Exodeoxyribonuclease III [Shigella dysenteriae CDC 74-1112]
 gi|320184212|gb|EFW59027.1| Exodeoxyribonuclease III [Shigella flexneri CDC 796-83]
 gi|320197933|gb|EFW72541.1| Exodeoxyribonuclease III [Escherichia coli EC4100B]
 gi|323153006|gb|EFZ39275.1| exodeoxyribonuclease III [Escherichia coli EPECa14]
 gi|323158544|gb|EFZ44559.1| exodeoxyribonuclease III [Escherichia coli E128010]
 gi|323166246|gb|EFZ52021.1| exodeoxyribonuclease III [Shigella sonnei 53G]
 gi|323175176|gb|EFZ60790.1| exodeoxyribonuclease III [Escherichia coli LT-68]
 gi|323180528|gb|EFZ66073.1| exodeoxyribonuclease III [Escherichia coli 1180]
 gi|323186233|gb|EFZ71585.1| exodeoxyribonuclease III [Escherichia coli 1357]
 gi|323378375|gb|ADX50643.1| exodeoxyribonuclease III [Escherichia coli KO11]
 gi|323937007|gb|EGB33287.1| exodeoxyribonuclease III [Escherichia coli E1520]
 gi|323940585|gb|EGB36776.1| exodeoxyribonuclease III [Escherichia coli E482]
 gi|323962060|gb|EGB57657.1| exodeoxyribonuclease III [Escherichia coli H489]
 gi|323974008|gb|EGB69179.1| exodeoxyribonuclease III [Escherichia coli TA007]
 gi|332096300|gb|EGJ01301.1| exodeoxyribonuclease III [Shigella boydii 3594-74]
 gi|332101449|gb|EGJ04795.1| exonuclease III [Shigella sp. D9]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 123/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSLLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|319942253|ref|ZP_08016568.1| exodeoxyribonuclease III Xth [Sutterella wadsworthensis 3_1_45B]
 gi|319804126|gb|EFW01026.1| exodeoxyribonuclease III Xth [Sutterella wadsworthensis 3_1_45B]
          Length = 269

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 80/269 (29%), Positives = 128/269 (47%), Gaps = 6/269 (2%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           MS + +A+WNVNS++ R+  +  W++    D + +QETKT D  FP        + +   
Sbjct: 1   MSRLRLASWNVNSLKVRLPQVLDWLESAKIDALVMQETKTTDDVFPQAAFAEAGFDVFFL 60

Query: 61  GQKSYNGVAILSKYQPIEIV------THLPGDDLDVQARFIEATFTINTQTLRIGNLYLP 114
           GQK+YNGVA+ S+   ++           P       +  +          +R    Y P
Sbjct: 61  GQKTYNGVALCSRQTTVKTSDVVLGLPGWPDPQKRFISALLSPLAAPEQPPIRFCGGYFP 120

Query: 115 HGNPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDAC 174
           +G  + S+KY  K+ WI    R     L     L+  GD+NI P   D +NP  W     
Sbjct: 121 NGQAVGSSKYLYKLDWIAVLERTLKTYLADTPRLVLGGDFNIAPADADVWNPEAWRGKIL 180

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
            +   R++ ++L  +G  D+ R        +S+WDY    + +N G+RID +++S     
Sbjct: 181 CSEPERKALERLFALGLYDSFRLFTQPAERFSWWDYRQSGFERNHGLRIDLLLVSEALKG 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
            + SA ID  PRG  +PSDH PV++ L +
Sbjct: 241 AVESASIDDGPRGNPQPSDHAPVMLDLSL 269


>gi|116668987|ref|YP_829920.1| exodeoxyribonuclease III [Arthrobacter sp. FB24]
 gi|116609096|gb|ABK01820.1| Exodeoxyribonuclease III [Arthrobacter sp. FB24]
          Length = 294

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 78/267 (29%), Positives = 131/267 (49%), Gaps = 8/267 (2%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
            V +ATWNVNS+RAR   + AW++ ++ D++ +QETK +D NFP+E  + + Y +   G 
Sbjct: 26  TVKIATWNVNSLRARADRVEAWLERSDCDVLAIQETKCKDDNFPWELFERMGYEVAHFGV 85

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQA----RFIEATFTINTQTLRIGNLYLPHGNP 118
             +NGVAI+S+    ++        +  +                  +R+ +LY+P+G  
Sbjct: 86  SQWNGVAIVSRVGLEDVERSFVDQPVFGKNGKDAIQEARAIGATCGGVRVWSLYVPNGRA 145

Query: 119 ITSTKYDDKISWIKRFLRFASQRL--ELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFT 176
           +       K+SW+      A   +    E  +   GD+NI PQ  D ++   +  +A   
Sbjct: 146 LDDEHMPYKLSWLDMLKTHAQAWVTENPEAQIALMGDWNIAPQDDDVWDIDFFRANAMTH 205

Query: 177 --LEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
                R +F+  ++ GF D +R       +Y++WDY    + K +G+RID ++ SP   +
Sbjct: 206 VSEPERAAFRAFEDAGFQDVVRPHTPGPGVYTYWDYTQLRFPKKEGMRIDFVLASPALAA 265

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSL 261
            +  A ID + R     SDH PVIV L
Sbjct: 266 RVTGASIDREERKGKGASDHAPVIVEL 292


>gi|238910880|ref|ZP_04654717.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 77/268 (28%), Positives = 122/268 (45%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D+ FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDEMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKATPISVRRGFPDDGEEAQRRIIMAEIPSPLGNITVINGYFPQGESRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMSRLLKWGLVDTFRQANPQTMDKFSWFDYRSKGFVDNRGLRIDLLLASAPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   R   KPSDH PV  +  +
Sbjct: 241 CAETGIDYDIRSMEKPSDHAPVWATFRV 268


>gi|239999627|ref|ZP_04719551.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae 35/02]
 gi|240017251|ref|ZP_04723791.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae FA6140]
 gi|240081112|ref|ZP_04725655.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae FA19]
 gi|240118615|ref|ZP_04732677.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae PID1]
 gi|240124158|ref|ZP_04737114.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae PID332]
 gi|240126225|ref|ZP_04739111.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae SK-92-679]
 gi|240128828|ref|ZP_04741489.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae
           SK-93-1035]
 gi|254494342|ref|ZP_05107513.1| exodeoxyribonuclease III [Neisseria gonorrhoeae 1291]
 gi|268595439|ref|ZP_06129606.1| exodeoxyribonuclease III [Neisseria gonorrhoeae 35/02]
 gi|268597223|ref|ZP_06131390.1| exodeoxyribonuclease III [Neisseria gonorrhoeae FA19]
 gi|268604327|ref|ZP_06138494.1| exodeoxyribonuclease III [Neisseria gonorrhoeae PID1]
 gi|268682783|ref|ZP_06149645.1| exodeoxyribonuclease III [Neisseria gonorrhoeae PID332]
 gi|268684808|ref|ZP_06151670.1| exodeoxyribonuclease III [Neisseria gonorrhoeae SK-92-679]
 gi|268687210|ref|ZP_06154072.1| exodeoxyribonuclease III [Neisseria gonorrhoeae SK-93-1035]
 gi|293398467|ref|ZP_06642645.1| exodeoxyribonuclease III [Neisseria gonorrhoeae F62]
 gi|226513382|gb|EEH62727.1| exodeoxyribonuclease III [Neisseria gonorrhoeae 1291]
 gi|268548828|gb|EEZ44246.1| exodeoxyribonuclease III [Neisseria gonorrhoeae 35/02]
 gi|268551011|gb|EEZ46030.1| exodeoxyribonuclease III [Neisseria gonorrhoeae FA19]
 gi|268588458|gb|EEZ53134.1| exodeoxyribonuclease III [Neisseria gonorrhoeae PID1]
 gi|268623067|gb|EEZ55467.1| exodeoxyribonuclease III [Neisseria gonorrhoeae PID332]
 gi|268625092|gb|EEZ57492.1| exodeoxyribonuclease III [Neisseria gonorrhoeae SK-92-679]
 gi|268627494|gb|EEZ59894.1| exodeoxyribonuclease III [Neisseria gonorrhoeae SK-93-1035]
 gi|291610938|gb|EFF40035.1| exodeoxyribonuclease III [Neisseria gonorrhoeae F62]
 gi|317164881|gb|ADV08422.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 256

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 136/260 (52%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRSVPQDVHFGLPSLPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRHGKLVLLGDFNIAPADADCYDPEKWYEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI+++ E  ++L   RID 
Sbjct: 177 QNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVTSEMAAVLKDVRIDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D+
Sbjct: 237 ETRALERPSDHAPVAAEFDL 256


>gi|33239934|ref|NP_874876.1| exonuclease III [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
 gi|33237460|gb|AAP99528.1| Exonuclease III [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 276

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 95/274 (34%), Positives = 151/274 (55%), Gaps = 5/274 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +  ATWNVNSIR R+  +  ++ E  PD++CLQETK EDK FP E+++   Y +   GQK
Sbjct: 1   MLFATWNVNSIRTRLSQVEEFLDETQPDLLCLQETKVEDKLFPRESIEKRGYQVSFYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINT----QTLRIGNLYLPHGNPI 119
           +YNGVA++S  +  +I   + G+ ++ Q                  +R+ N+Y+P+G+ +
Sbjct: 61  AYNGVALISNQKLDDIRLGISGELVNNQVSTFLDEQKRIISALINGIRVVNVYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S KY  K+ W+    ++   + E  EPL   GD+NI+ +  D +NP  + N    +L  
Sbjct: 121 DSEKYIYKLKWLDHLKKYFESQEERSEPLCLMGDFNIVLEEKDIHNPKRFNNGIMASLSE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++ Q +      D  R        +S+WDY + +W K++G RIDHI LS E  +   S 
Sbjct: 181 REALQNVLGTRLEDVFRLFEADTGHWSWWDYRSGAWQKDQGWRIDHIYLSEELINNARSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQQDS 273
            I  K RG  +PSDH PV+V ++ P P++  ++S
Sbjct: 241 VIHKKARGNIQPSDHAPVLVDINWP-PQEDNENS 273


>gi|255530789|ref|YP_003091161.1| exodeoxyribonuclease III Xth [Pedobacter heparinus DSM 2366]
 gi|255343773|gb|ACU03099.1| exodeoxyribonuclease III Xth [Pedobacter heparinus DSM 2366]
          Length = 264

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 99/267 (37%), Positives = 144/267 (53%), Gaps = 5/267 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A++N+N I AR+ NL  W+KE  PD++CLQE K  D  FP + L    YH    GQK
Sbjct: 1   MKIASYNINGINARLDNLLRWLKEARPDVVCLQELKAPDNRFPAQLLLDAGYHAIWHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILS+Y  I+                           + IG LYLP+GNP    K
Sbjct: 61  SWNGVAILSRYAEIKETRRGL---EGDPEDLHSRYIEAFINGVVIGCLYLPNGNPFPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           ++ K++WIKR  + A++      P+   GDYNIIP   D Y P  +  +A F  E R+ +
Sbjct: 118 FEYKLNWIKRLTKHAAKLNAFGLPVALVGDYNIIPTDLDTYKPEKYLENALFRPEARKLW 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L   G+TDA R  +    +Y+FWDY  +++ ++ G+R+DH +L+ +    L +A +D 
Sbjct: 178 TALLKQGWTDAFRKLYPKDRIYTFWDYLRNAYHRDAGLRLDHFLLNDKLVDRLDAAGVDK 237

Query: 244 KPRGWTKPSDHTPVIVSLD--IPEPRK 268
             RGW   SDH PV V L   +P+  K
Sbjct: 238 HVRGWDHSSDHAPVWVVLKDHLPDQAK 264


>gi|30062986|ref|NP_837157.1| exonuclease III [Shigella flexneri 2a str. 2457T]
 gi|30041235|gb|AAP16964.1| exonuclease III [Shigella flexneri 2a str. 2457T]
 gi|281600889|gb|ADA73873.1| Exonuclease III [Shigella flexneri 2002017]
 gi|313649224|gb|EFS13658.1| exodeoxyribonuclease III [Shigella flexneri 2a str. 2457T]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 123/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSLLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLMSWGVVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|325267794|ref|ZP_08134444.1| exodeoxyribonuclease III [Kingella denitrificans ATCC 33394]
 gi|324980675|gb|EGC16337.1| exodeoxyribonuclease III [Kingella denitrificans ATCC 33394]
          Length = 258

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 136/259 (52%), Gaps = 4/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+ ++  W+ ++ PDI+ LQE K E   FP   L  + +     GQK
Sbjct: 1   MKICTWNVNSLNVRLPHVTDWLAQHQPDILVLQELKLEHDKFPVAALNMMGWQCAWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S++   ++ T LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRHAIKDVHTGLPALPDDPQQRVIAATVNG----VRVVNVYCVNGESLDSEK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F  Q+++    L+  GD+NI P   D Y+P  W      + E R  F
Sbjct: 117 FAYKRQWFAALTDFIRQQMQQYPKLVLLGDFNIAPTDDDVYDPEKWREHIHCSSEERAWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD +R  H T   Y++WDY    + +  G+RIDHI+ +     +L   +IDT
Sbjct: 177 QALLDLGLTDCLRHVHPTGAHYTWWDYRGAMFQRKLGLRIDHILATAALRDVLRDVQIDT 236

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + R   +PSDH PV    D
Sbjct: 237 EARAKERPSDHAPVFALFD 255


>gi|259908294|ref|YP_002648650.1| Exodeoxyribonuclease III [Erwinia pyrifoliae Ep1/96]
 gi|224963916|emb|CAX55420.1| Exodeoxyribonuclease III [Erwinia pyrifoliae Ep1/96]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 81/266 (30%), Positives = 122/266 (45%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E + SL YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLQAIVEQHQPDVIGLQETKVHDDMFPLEEVASLGYHVFCHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L K QP+ +     GD+ D Q R I A        L + N Y P G       
Sbjct: 61  GHYGVALLCKQQPVAVRRGFAGDNEDAQRRIIMADILTPAGPLTVINGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q+ + +  L+  GD NI           +     +      F 
Sbjct: 121 KFPAKEKFYRDLQSYLEQQQKADNQLLIMGDMNISSSDLDIGIGEESRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATH-DTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+    L N G  D  R  +   +  +S++DY +  +  N+G+RID I+ S      
Sbjct: 181 PEEREWMSTLMNWGLYDTWRTQNATVNDRFSWFDYRSKGFDDNRGLRIDLILASRPLADR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
             +  ID   R   KPSDH P+    
Sbjct: 241 CVATGIDYDIRAMEKPSDHAPIWAEF 266


>gi|161486214|ref|NP_754044.2| exonuclease III [Escherichia coli CFT073]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFSAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|190891414|ref|YP_001977956.1| exodeoxyribonuclease III protein [Rhizobium etli CIAT 652]
 gi|218516597|ref|ZP_03513437.1| exodeoxyribonuclease III protein [Rhizobium etli 8C-3]
 gi|190696693|gb|ACE90778.1| exodeoxyribonuclease III protein [Rhizobium etli CIAT 652]
          Length = 263

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 116/262 (44%), Positives = 162/262 (61%), Gaps = 5/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN I  R+  L  W+KE+ PD++CLQE KT+D  FP    +   Y     GQ+
Sbjct: 1   MKIATYNVNGINGRLDILLRWLKEDAPDVVCLQELKTDDAKFPRTETERAGYGAVWHGQR 60

Query: 64  SYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           S+NGVAIL+K   PI     LPGD  D  +R+IEA          IG LYLP+GNP  S 
Sbjct: 61  SWNGVAILAKGKTPILTRRGLPGDPDDTHSRYIEAAVDGM----LIGCLYLPNGNPFPSA 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K++ K+ W +R   +A++ LE+E P I AGD+N++P   D Y P  W +DA F  EVR +
Sbjct: 117 KFEYKLRWFRRLSAYAAELLEIEVPSILAGDFNVMPTEIDVYKPERWLDDALFRPEVRNA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           + +L   G+TDA+R  H    +Y+FW Y+ +S+ ++ G+RIDH++LSP     L SA + 
Sbjct: 177 YAQLVAQGWTDAVRHLHPGERIYTFWKYWRNSFERDAGLRIDHLLLSPTVAPWLRSASVR 236

Query: 243 TKPRGWTKPSDHTPVIVSLDIP 264
            KPRGW   SDH PV++ LDIP
Sbjct: 237 RKPRGWEHTSDHAPVVIELDIP 258


>gi|160872135|ref|ZP_02062267.1| exodeoxyribonuclease III [Rickettsiella grylli]
 gi|159120934|gb|EDP46272.1| exodeoxyribonuclease III [Rickettsiella grylli]
          Length = 261

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 90/260 (34%), Positives = 144/260 (55%), Gaps = 5/260 (1%)

Query: 2   SVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCG 61
            +  +ATWN+NS+R R+ ++  W+  + P ++ LQETK ++ +FP E  +   YH+   G
Sbjct: 3   RLFKIATWNINSLRIRLAHVLTWLNTHQPHLLALQETKVQNHHFPEEPFKRAGYHVLYNG 62

Query: 62  QKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS 121
           QK+YNGVA +S+      VT      L            +   +LRI N+Y+P+G+ + S
Sbjct: 63  QKTYNGVAFISRIPMQNEVT-----CLPHFDDTQRRILVVTIGSLRIVNIYVPNGSHLGS 117

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQ 181
            K+  K+ W+K+   +    L L   LI  GD+NI P+ +D ++P IW+     + + R+
Sbjct: 118 EKFLYKLKWLKQLKIYLQHELSLHPSLIVLGDFNIAPKDNDVHDPQIWQGKVLVSPQERK 177

Query: 182 SFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARI 241
           + Q +  +G  D+ R  H+  H Y++WDY A ++ +N G+RIDHI+ S    S      I
Sbjct: 178 ALQDIVALGLKDSFRLFHNEPHQYTWWDYRAGAFRRNHGLRIDHILSSTHLISQCIDCEI 237

Query: 242 DTKPRGWTKPSDHTPVIVSL 261
           D + R W KPSDH PVI + 
Sbjct: 238 DKEIRRWEKPSDHVPVIATY 257


>gi|254247764|ref|ZP_04941085.1| Exonuclease III [Burkholderia cenocepacia PC184]
 gi|124872540|gb|EAY64256.1| Exonuclease III [Burkholderia cenocepacia PC184]
          Length = 258

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 84/256 (32%), Positives = 133/256 (51%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ FP   L+++ Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLAQSGTDVLCLQELKLPDEKFPRADLEAVGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL +   + +       ++       +         +RI + Y P+G  + S K
Sbjct: 61  TYNGVAILVRDT-LAVDESDVVRNIPGFDDPQQRVIAATVDGVRIVSAYFPNGQALDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLRTELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP   +   S  +D 
Sbjct: 180 AQLIELGFVDAFRRFEQPEKTFTWWDYRMMAFRRNAGLRIDHILLSPALAATCASCEVDR 239

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDHTPV+ 
Sbjct: 240 TPRTWEQPSDHTPVVA 255


>gi|153837336|ref|ZP_01990003.1| exodeoxyribonuclease III [Vibrio parahaemolyticus AQ3810]
 gi|260903451|ref|ZP_05911846.1| exodeoxyribonuclease III [Vibrio parahaemolyticus AQ4037]
 gi|149749367|gb|EDM60140.1| exodeoxyribonuclease III [Vibrio parahaemolyticus AQ3810]
 gi|308110362|gb|EFO47902.1| exodeoxyribonuclease III [Vibrio parahaemolyticus AQ4037]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 81/268 (30%), Positives = 133/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPIEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P  ++   +   +      N + + + N Y P G+ I+  
Sbjct: 61  AHYGVAMLCKQEPIRVQKGFPTDNEEHQKRMIMATFENENGEKVTVLNGYFPQGDNISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYKDLMTYLNDHHSNDEQLIVMGDINISPIDSDIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L N GF D  R  +   +  +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLQTLLNWGFEDTFRKLYPEVNDRFSWFDYRSRGFDDNRGLRIDVILATPSLAQ 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  +  
Sbjct: 241 KCIESGIDYELRGIEKPSDHAPIWSTFK 268


>gi|113969789|ref|YP_733582.1| exonuclease III [Shewanella sp. MR-4]
 gi|113884473|gb|ABI38525.1| Exodeoxyribonuclease III [Shewanella sp. MR-4]
          Length = 270

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 86/268 (32%), Positives = 130/268 (48%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +R+R+H L A I  + PDII LQETK  D+ FP   ++++ YH+   G K
Sbjct: 1   MKIVSFNINGLRSRLHQLQALIDSHQPDIIGLQETKVHDEAFPLAEVEAMGYHVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
           ++ GVA+LSK  PI++      D  D Q R I  TF   N + L + N Y P G  I   
Sbjct: 61  AHYGVAMLSKVAPIKVQKGFATDGEDAQRRMIIGTFAQANGRPLTVLNGYFPQGESIDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            KY  K  + +  +         +E +   GD NI P   D           +      F
Sbjct: 121 TKYPAKRKFYQDLMAHLHANHSNDEDIAIIGDINISPIDLDIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + LQ+ G  D  R  H      YS++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLKTLQDWGLVDTFRQLHPDRSERYSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            L  + +D   RG  KPSDH P+  +  
Sbjct: 241 RLVESDVDYDLRGIDKPSDHAPIWSTFK 268


>gi|148977573|ref|ZP_01814152.1| exonuclease III [Vibrionales bacterium SWAT-3]
 gi|145963224|gb|EDK28491.1| exonuclease III [Vibrionales bacterium SWAT-3]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 130/268 (48%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP   ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAVIDKHQPDVIGLQEIKVHDEAFPIADVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P  ++   +   +      N + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKQEPISVQKGFPTDNEDHQKRMIMATFEDENGEKVTVLNGYFPQGDNIKHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TKY  K  + K  + + +     +E +I  GD NI P               +      F
Sbjct: 121 TKYPYKREFYKDLMTYLNDYHNNDEQIIVMGDINISPIDADIGIGEPNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D  R  H      YS++DY +  +  N+G+RID ++ + +   
Sbjct: 181 QPEEREWLKALMDWGFVDTFRQLHPEVTDQYSWFDYRSKGFLDNRGLRIDVVLATQKLAD 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + RG  KPSDH P+  +  
Sbjct: 241 KCTEAGIDYELRGIEKPSDHAPIWSTFK 268


>gi|159029855|emb|CAO90909.1| xthA [Microcystis aeruginosa PCC 7806]
          Length = 262

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 93/262 (35%), Positives = 149/262 (56%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR+R   +  W++ N  +++CLQETK  D++FP E  +SL YH+   GQK
Sbjct: 1   MKIATWNVNSIRSRQDQVINWLQLNPVEVLCLQETKVIDRDFPREAFESLGYHLYISGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHL---PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           +YNGVAI S+    +I        G++L  +    +   T     +RI NLY+P+G+ + 
Sbjct: 61  AYNGVAIFSQKPLDDITVGFSPIIGENLTGELDEQKRLITGVIGDIRIINLYVPNGSSLD 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPL-IFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
           S KY  K+ W++   ++  + +  +       GD+NI  +  D Y+P   EN    + + 
Sbjct: 121 SDKYIYKLKWLETLRKYLDKIINSQPQELCICGDFNIALEDKDIYDPKGKENHIMSSAKE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++ +K+  +G  DA R        YS+WDY +  +++N+G RIDH+ L+P+      + 
Sbjct: 181 REALEKVLEIGLQDAFRKFTSAAGHYSWWDYRSGGFARNRGWRIDHLYLTPQLYEKAVNC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            ID +PR   KPSDHTPVI+ +
Sbjct: 241 LIDREPRKQEKPSDHTPVILEI 262


>gi|152969774|ref|YP_001334883.1| exonuclease III [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|330012539|ref|ZP_08307413.1| exodeoxyribonuclease III [Klebsiella sp. MS 92-3]
 gi|150954623|gb|ABR76653.1| exonuclease III [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|328533786|gb|EGF60471.1| exodeoxyribonuclease III [Klebsiella sp. MS 92-3]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 82/266 (30%), Positives = 126/266 (47%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLAAIVEKHQPDVIGLQETKVHDDMFPLEEVARLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G      T
Sbjct: 61  GHYGVALLTKETPIAVRRGFPDDGEEAQRRIIMAEIPSPFGNVTVINGYFPQGESRDHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K ++ +    +    L  E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAAFYQNLQNYLETELNKENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTHH-LYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +  +H  +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLLGWGLVDTWRQANPDNHEHFSWFDYRSKGFDDNRGLRIDLLLASQPLAQR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + RG  KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRGMEKPSDHAPVWATF 266


>gi|262404202|ref|ZP_06080757.1| exodeoxyribonuclease III [Vibrio sp. RC586]
 gi|262349234|gb|EEY98372.1| exodeoxyribonuclease III [Vibrio sp. RC586]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 127/268 (47%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D  FP + ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDDAFPRQEVEAMGYQVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGD-DLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVAIL K  P+E++   P D +   +   +      +     I N Y P G+ +   
Sbjct: 61  AHYGVAILCKQTPVEVIKGFPTDSEEHQKRMIMATFVDQDGNKTTILNGYFPQGDNVEHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + +  + +  +     E L+  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYRDLMTYLGEHRSNAERLVVMGDINISPLDLDIGIGEANRKRWLQTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H      +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLQSLMDWGLVDTFRQLHPEVSDQFSWFDYRSRGFDDNRGLRIDVILATPTLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + RG  KPSDH P+  +  
Sbjct: 241 TCQEAGIDYELRGIDKPSDHAPIWATFK 268


>gi|86146435|ref|ZP_01064758.1| exodeoxyribonuclease III [Vibrio sp. MED222]
 gi|85835698|gb|EAQ53833.1| exodeoxyribonuclease III [Vibrio sp. MED222]
          Length = 268

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 132/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP   ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAIIDKHQPDVIGLQEIKVHDEAFPLADVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P  ++   +   +      N + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKQEPISVQKGFPTDNEDHQKRMIMATFEDDNGEKITVLNGYFPQGDNIKHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
           TKY  K  + K  + + +     +E +I  GD NI P               +      F
Sbjct: 121 TKYPYKREFYKDLMTYLNDYHNKDEQVIVMGDINISPTDIDIGIGEPNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D+ R  H   +  YS++DY +  +  N+G+RID ++ + +   
Sbjct: 181 QPEEREWLKTLMDWGFVDSFRLLHPEVNDQYSWFDYRSKGFVDNRGLRIDVVLATQKLAD 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + RG  KPSDH P+  +  
Sbjct: 241 KCTEAGIDYELRGIEKPSDHAPIWSTFK 268


>gi|294012654|ref|YP_003546114.1| exodeoxyribonuclease III [Sphingobium japonicum UT26S]
 gi|292675984|dbj|BAI97502.1| exodeoxyribonuclease III [Sphingobium japonicum UT26S]
          Length = 256

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 104/259 (40%), Positives = 152/259 (58%), Gaps = 5/259 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N I+AR+  L  W+ E  PDI CLQE KT D  FP   ++ + Y     GQK
Sbjct: 1   MRIATFNINGIKARLPRLLEWLDETRPDIACLQEIKTSDDTFPVRDIEDVGYGAIWHGQK 60

Query: 64  SYNGVAILSK-YQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
            +NGVAIL++   P+E+   L G+  D  +R++EA        LR+ ++YLP+GNP    
Sbjct: 61  GFNGVAILARGETPVEVRRGLEGEPEDEHSRYLEADVKG----LRVASIYLPNGNPQPGP 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W+KR    A+Q    E P I AGDYN+IP+  D Y+      DA    E R +
Sbjct: 117 KFDYKLRWMKRLRDRAAQIWAEEVPAILAGDYNVIPRDRDVYSVKAMAEDALMQPESRAA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           +++L   G+TDAI + H    ++++WDY  ++W ++ G RIDH++LSP A   L  A++D
Sbjct: 177 YRRLLGDGWTDAIASRHPAGRVWTYWDYQMNAWPRDAGFRIDHLLLSPAAADRLIDAQVD 236

Query: 243 TKPRGWTKPSDHTPVIVSL 261
              RG  K SDH P  V L
Sbjct: 237 KDFRGREKASDHAPTWVEL 255


>gi|255326144|ref|ZP_05367231.1| exodeoxyribonuclease III [Rothia mucilaginosa ATCC 25296]
 gi|255296855|gb|EET76185.1| exodeoxyribonuclease III [Rothia mucilaginosa ATCC 25296]
          Length = 288

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 71/264 (26%), Positives = 124/264 (46%), Gaps = 6/264 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NSIRAR + +  W+ E++ D++ LQETKT+D+ FPF+  + + Y +   G  
Sbjct: 23  MKIATWNINSIRARENRVEDWLDEHDVDVLALQETKTKDETFPFDLFEFMGYEVAHFGLN 82

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIE----ATFTINTQTLRIGNLYLPHGNPI 119
            +NGVAI S+    ++           +    E             +R+ +LY+P+G  +
Sbjct: 83  QWNGVAIASRVGLEDVQRGFDNQPHFGKTGEPEVLEARAIGATCGGVRVWSLYVPNGRGL 142

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLI--FAGDYNIIPQPHDCYNPIIWENDACFTL 177
           T    D K+ W++   +     L           GD+N+ P+  D ++   +  +    +
Sbjct: 143 TDPHMDYKLRWMEALRQNVHNELADNPQSQLALVGDWNVAPEDADVWDIDYFLRNEMTHV 202

Query: 178 EVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLH 237
              +       +           T   Y++WDY A  ++K++G+RID  + SP   + + 
Sbjct: 203 SAPERRAFAALLEEGMVDVVRPHTPGEYTYWDYQAGRFTKDEGMRIDFQLFSPALAARVE 262

Query: 238 SARIDTKPRGWTKPSDHTPVIVSL 261
            A ID   R     SDHTPV+V +
Sbjct: 263 RAWIDKVERAGEGASDHTPVVVEI 286


>gi|82776806|ref|YP_403155.1| exonuclease III [Shigella dysenteriae Sd197]
 gi|309788829|ref|ZP_07683424.1| exodeoxyribonuclease III [Shigella dysenteriae 1617]
 gi|81240954|gb|ABB61664.1| exonuclease III [Shigella dysenteriae Sd197]
 gi|308923100|gb|EFP68612.1| exodeoxyribonuclease III [Shigella dysenteriae 1617]
          Length = 268

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 77/266 (28%), Positives = 122/266 (45%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A + ++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVDKHQPDVIGLQETKVHDDMFPLEDVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGD  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDGEEAQRRIIMAEIPSPLGNVTVINGYFPQGERRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|260642288|ref|ZP_05415267.2| exodeoxyribonuclease III [Bacteroides finegoldii DSM 17565]
 gi|260622802|gb|EEX45673.1| exodeoxyribonuclease III [Bacteroides finegoldii DSM 17565]
          Length = 255

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 140/263 (53%), Gaps = 12/263 (4%)

Query: 3   VVTVATWNVNSIRARI-HNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNY--HIET 59
           ++ + T+NVN +RA +      W+ + NPDI+CLQETK +   +P E  ++L Y  ++ +
Sbjct: 1   MMKIITYNVNGLRAAVSKGFPEWLAQENPDILCLQETKLQPDQYPAEVFEALGYKSYLYS 60

Query: 60  CGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
             +K Y+GVAIL+K +P  +   +  +  D + RFI A F      L + ++Y P G   
Sbjct: 61  AQKKGYSGVAILTKQEPDHVEYGMGIEAYDNEGRFIRADFG----DLSVVSVYHPSG-TS 115

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              +   K+ W++ F ++ ++  +    LI  GDYNI  +P D ++P+    ++ F  E 
Sbjct: 116 GDERQAFKMVWLEDFQKYVTELRKTRPNLILCGDYNICHEPIDIHDPVRNAKNSGFLPEE 175

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+   +  + GF D+ R  +     Y++W Y  +S +KNKG RID+ M S      L SA
Sbjct: 176 REWMTRFLSAGFIDSFRLLYPEKQEYTWWSYRFNSRAKNKGWRIDYCMTSEPVRRWLKSA 235

Query: 240 RIDTKPRGWTKPSDHTPVIVSLD 262
           RI  +       SDH P+++ +D
Sbjct: 236 RILNEA----VHSDHCPMVLEID 254


>gi|312881205|ref|ZP_07741003.1| exonuclease III [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309371097|gb|EFP98551.1| exonuclease III [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 268

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 134/268 (50%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAVIDKHQPDVIGLQEIKVHDEAFPLEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P D+ D Q R I  T    N + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKKEPISVQKGFPTDNDDHQKRMIMVTMEDDNGEKVTVLNGYFPQGDNIEHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TKY  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKYPYKRQFYKDLMTYLNDHHTNDEQLIVMGDINISPIDADIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + G  D  R  H      +S++DY +  +  N+G+RID ++ +P+   
Sbjct: 181 QPEEREWLKTLLDWGLVDTFRQIHPEVEDRFSWFDYRSRGFDDNRGLRIDVVLATPKLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  +  
Sbjct: 241 KCTESDIDYELRGIEKPSDHAPIWSTFK 268


>gi|170749328|ref|YP_001755588.1| exodeoxyribonuclease III Xth [Methylobacterium radiotolerans JCM
           2831]
 gi|170655850|gb|ACB24905.1| exodeoxyribonuclease III Xth [Methylobacterium radiotolerans JCM
           2831]
          Length = 264

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 112/261 (42%), Positives = 165/261 (63%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNSI+ R+ +L  +++E  PD++CLQE K +D++FP   +++  Y +ET GQK
Sbjct: 1   MRITTWNVNSIKQRLPHLLGFLEEARPDVVCLQELKCQDESFPRADIEAAGYAVETLGQK 60

Query: 64  SYNGV--AILSKYQPIEIVTHLPGDDLDVQARFIEATFTI-NTQTLRIGNLYLPHGNPIT 120
           +YNGV   + +     +I   LPGD  D QAR+IEA  +  +T+ +R+ ++YLP+GNP+ 
Sbjct: 61  AYNGVALLVRAPLAMSKIRRGLPGDADDAQARYIEALISGADTRPVRVASIYLPNGNPVD 120

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           S KY  K+++++R    A   LE E  ++ AGDYN+IP+  D  +P  W +DA F    R
Sbjct: 121 SPKYPYKLAFLERLRLHARALLEDEIAVVLAGDYNVIPEAADAADPEAWRSDALFLGTTR 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +F+ +   G+TDA+RA      LY+FWDY A  W +N GIRIDH++LSP+A   L SA 
Sbjct: 181 AAFRAILAEGYTDALRACDPRDGLYTFWDYQAGCWQRNAGIRIDHLLLSPQAGDRLVSAS 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           +    RG  KPSDH PV   L
Sbjct: 241 VQKHLRGLDKPSDHVPVTAEL 261


>gi|254506149|ref|ZP_05118293.1| exodeoxyribonuclease III [Vibrio parahaemolyticus 16]
 gi|219550967|gb|EED27948.1| exodeoxyribonuclease III [Vibrio parahaemolyticus 16]
          Length = 268

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 88/268 (32%), Positives = 137/268 (51%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAVIDKHQPDVIGLQEIKVHDEAFPLEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEAT-FTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI I    P D+ + Q R I  T    N + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKKEPISIQKGFPTDNDEHQKRMIMVTLEDDNGEKVTVLNGYFPQGDNIGHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYKDLMTYLNDHHNNDEQLIVMGDINISPIDADIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E RQ  Q L + GF D  R  H   +  +S++DY +  +  N+G+RID ++ +P+  +
Sbjct: 181 QPEERQWLQTLLDWGFVDTFRQIHPDVNDRFSWFDYRSKGFPDNRGLRIDVVLATPKLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + RG  KPSDH P+  +  
Sbjct: 241 KCIEADIDYELRGIEKPSDHAPIWSTFK 268


>gi|62179894|ref|YP_216311.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62127527|gb|AAX65230.1| exonuclease III, may repair singlet oxygen induced lesions
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322714361|gb|EFZ05932.1| exonuclease III [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 268

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 77/268 (28%), Positives = 120/268 (44%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A +++  PD+I LQETK  D+ FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKRQPDVIGLQETKVHDEMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKATPISVRRGFPDDGEEAQRRIIMAEIPSPLGNITVINGYFPQGESRDHPL 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +    L+   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKCNNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMSRLLKWGLVDTFRQANPQTMDKFSWFDYRSKGFVDNRGLRIDLLLASAPLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                ID   R   KPSDH PV  +  +
Sbjct: 241 CAETGIDYDIRSMEKPSDHAPVWATFRV 268


>gi|28897777|ref|NP_797382.1| exonuclease III [Vibrio parahaemolyticus RIMD 2210633]
 gi|260363798|ref|ZP_05776553.1| exodeoxyribonuclease III [Vibrio parahaemolyticus K5030]
 gi|260876941|ref|ZP_05889296.1| exodeoxyribonuclease III [Vibrio parahaemolyticus AN-5034]
 gi|260897916|ref|ZP_05906412.1| exodeoxyribonuclease III [Vibrio parahaemolyticus Peru-466]
 gi|28805990|dbj|BAC59266.1| exodeoxyribonuclease III [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085493|gb|EFO35188.1| exodeoxyribonuclease III [Vibrio parahaemolyticus Peru-466]
 gi|308093887|gb|EFO43582.1| exodeoxyribonuclease III [Vibrio parahaemolyticus AN-5034]
 gi|308113909|gb|EFO51449.1| exodeoxyribonuclease III [Vibrio parahaemolyticus K5030]
          Length = 268

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 132/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPIEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P  ++   +   +      N + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKQEPIRVQKGFPTDNEEHQKRMIMATFENENGEKVTVLNGYFPQGDNINHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYKDLMTYLNDHHSNDEQLIVMGDINISPIDSDIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D  R  +   +  +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLKTLLDWGFEDTFRKLYPEVNDRFSWFDYRSRGFDDNRGLRIDVILATPSLAQ 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  +  
Sbjct: 241 KCIESGIDYELRGIEKPSDHAPIWSTFK 268


>gi|160875927|ref|YP_001555243.1| exonuclease III [Shewanella baltica OS195]
 gi|160861449|gb|ABX49983.1| exodeoxyribonuclease III [Shewanella baltica OS195]
 gi|315268120|gb|ADT94973.1| exodeoxyribonuclease III [Shewanella baltica OS678]
          Length = 270

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 87/268 (32%), Positives = 131/268 (48%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR+H L A I  + PDII LQETK  D+ FP   ++++ Y +   G K
Sbjct: 1   MKIVSFNINGLRARLHQLQALIDSHQPDIIGLQETKVHDEAFPLAEVEAMGYQVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
           ++ GVA+LSK  P ++    P DD D Q R I  TF   N + L + N Y P G  I   
Sbjct: 61  AHYGVAMLSKVAPEKLQKGFPTDDEDAQRRMIIGTFAQANGRPLTVFNGYFPQGESIDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            KY  K  + +  + +       +E +   GD NI P   D           +      F
Sbjct: 121 TKYPAKRKFYQDLMHYLQTNHSNDEDIAIIGDINISPTDLDIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + LQ+ G  D  R  H      YS++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLKTLQDWGLVDTFRQLHPERIERYSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            L  + +D   RG  KPSDH P+  +  
Sbjct: 241 RLVESDVDYDLRGIDKPSDHAPIWSTFK 268


>gi|240168902|ref|ZP_04747561.1| putative exodeoxyribonuclease III protein [Mycobacterium kansasii
           ATCC 12478]
          Length = 276

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 77/265 (29%), Positives = 122/265 (46%), Gaps = 7/265 (2%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
            + +ATWNVNSIR R+  +  WI   + D++ +QETK  D  FP   L  L Y +   G 
Sbjct: 5   TLRLATWNVNSIRTRLDRVLDWIARADVDVLAMQETKCADGQFPALPLFELGYEVAHVGF 64

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTIN-----TQTLRIGNLYLPHGN 117
             +NGVAI S+    ++     G     +   + AT            +R+ +LY+P+G 
Sbjct: 65  DQWNGVAIASRVGIDDVQVGFDGQPTWSRKPEVAATAEARALGATCGGVRVWSLYVPNGR 124

Query: 118 PITSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACF 175
            +    Y  K+ W+      A   L  +    +  AGD+NI P   D ++   +      
Sbjct: 125 ALGDPHYTYKLDWLAALKDTAEGWLRDDPAAAIALAGDWNIAPTDDDVWSTEFYAGATHV 184

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
           +   R++F  + +  F D +R       +Y++WDY    + K +G+RID I+ SP     
Sbjct: 185 SEPERKAFNAIVDAQFADLVRPFAPGPGVYTYWDYTQLRFPKRQGMRIDFILGSPALARR 244

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVS 260
           +  A+I  + R    PSDH PV V 
Sbjct: 245 VVDAQIVREERKGKAPSDHAPVFVD 269


>gi|323968517|gb|EGB63923.1| exodeoxyribonuclease III [Escherichia coli M863]
 gi|327252867|gb|EGE64521.1| exodeoxyribonuclease III [Escherichia coli STEC_7v]
          Length = 268

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 77/266 (28%), Positives = 121/266 (45%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    P D  + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPDDGEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLISWGLVDTFRHANPETADRFSWFDYRSKGFDDNRGLRIDLLLASQPLADC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|92113745|ref|YP_573673.1| exodeoxyribonuclease III [Chromohalobacter salexigens DSM 3043]
 gi|91796835|gb|ABE58974.1| Exodeoxyribonuclease III [Chromohalobacter salexigens DSM 3043]
          Length = 276

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 78/269 (28%), Positives = 129/269 (47%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N IRAR+H L A +  + PD+I LQETK +D  FP E +++L YH+   GQK
Sbjct: 1   MRLVSFNINGIRARLHQLEALVDAHAPDVIGLQETKVQDSEFPREAVEALGYHVAFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTH-LPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
            + GVA+L++  P  +        +   +          + + L + N Y P G  +   
Sbjct: 61  GHYGVALLTRQAPEAVYYGLPDDGEEAQRRLIGVRLACDDGEPLTVYNGYFPQGENVDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            K+ +K  +  R      +R    E L   GD+NI P   D           + E    F
Sbjct: 121 TKFPNKRDFYARLTTLLQERHTPSERLAVMGDFNISPADIDIGIGEANRKRWLREGKTSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKN--KGIRIDHIMLSPEA 232
               R+   +L + G +D  R  +      +S++DY +  + ++  +G+RID+IM++P  
Sbjct: 181 QPVEREWLARLVDWGLSDCYRLRYPEVDDRFSWFDYRSRGFERDPKRGLRIDYIMVTPAL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +  A ID + RG  +PSDH PV   L
Sbjct: 241 CERVTDAGIDYELRGIQRPSDHAPVWAQL 269


>gi|107028675|ref|YP_625770.1| exodeoxyribonuclease III (xth) [Burkholderia cenocepacia AU 1054]
 gi|116690166|ref|YP_835789.1| exodeoxyribonuclease III Xth [Burkholderia cenocepacia HI2424]
 gi|105897839|gb|ABF80797.1| Exodeoxyribonuclease III [Burkholderia cenocepacia AU 1054]
 gi|116648255|gb|ABK08896.1| Exodeoxyribonuclease III [Burkholderia cenocepacia HI2424]
          Length = 258

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 84/256 (32%), Positives = 133/256 (51%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ FP   L+++ Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLAQSGTDVLCLQELKLPDEKFPRADLEAVGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL +   + +       ++       +         +RI + Y P+G  + S K
Sbjct: 61  TYNGVAILVRDT-LAVDESDVVRNIPGFDDPQQRVIAATVDGVRIVSAYFPNGQALDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLRTELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP   +   S  +D 
Sbjct: 180 AQLIELGFVDAFRRFEQPEKTFTWWDYRMMAFRRNAGLRIDHILLSPALAATCASCEVDR 239

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDHTPV+ 
Sbjct: 240 VPRTWEQPSDHTPVVA 255


>gi|254670248|emb|CBA05478.1| exodeoxyribonuclease III [Neisseria meningitidis alpha153]
          Length = 256

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 90/260 (34%), Positives = 134/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRNAPEDVHIGLPALPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRYGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP   + L   R+D 
Sbjct: 177 KNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAAALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D 
Sbjct: 237 ETRALERPSDHAPVAAEFDW 256


>gi|117919951|ref|YP_869143.1| exonuclease III [Shewanella sp. ANA-3]
 gi|117612283|gb|ABK47737.1| Exodeoxyribonuclease III [Shewanella sp. ANA-3]
          Length = 270

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 85/268 (31%), Positives = 130/268 (48%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +R+R+H L A I  + PDII LQETK  D+ FP   ++++ YH+   G K
Sbjct: 1   MKIVSFNINGLRSRLHQLQALIDSHQPDIIGLQETKVHDEAFPLAEVEAMGYHVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
           ++ GVA+LSK  P+++      D+ D Q R I  TF   N   L + N Y P G  I   
Sbjct: 61  AHYGVAMLSKVAPLKVQKGFATDEEDAQRRMIIGTFAQANGHPLTVLNGYFPQGESIDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            KY  K  + +  +         +E +   GD NI P   D           +      F
Sbjct: 121 TKYPAKRKFYQDLMAHLHANHSNDEDIAIIGDINISPIDLDIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + LQ  G  D  R  H      YS++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLKTLQGWGLVDTFRQLHPDRCERYSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            L  + +D + RG  KPSDH P+  +  
Sbjct: 241 RLVESDVDYELRGIDKPSDHAPIWSTFK 268


>gi|123965783|ref|YP_001010864.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9515]
 gi|123200149|gb|ABM71757.1| exodeoxyribonuclease III [Prochlorococcus marinus str. MIT 9515]
          Length = 281

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 93/269 (34%), Positives = 148/269 (55%), Gaps = 4/269 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+R R+  +  WIK  NPDI+CLQETK  D +FP    + L Y +   GQK
Sbjct: 1   MLIATWNVNSVRTRLSQIINWIKNVNPDILCLQETKVIDNSFPLTPFEELGYEVTVHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT----INTQTLRIGNLYLPHGNPI 119
           SYNGVAI+SK++   I+     ++ +                +   L+I N+Y+P+G+ +
Sbjct: 61  SYNGVAIISKFKIENIIKGFTNENEEKSNFLNFNEQKRLISADINGLKIINVYVPNGSSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S K+D KI W+     F  +++  ++ + F GD+NI P   D + P  +E     +   
Sbjct: 121 DSDKFDYKIKWLNHLSSFLDKQVREDDLVCFVGDFNIAPFDIDIHCPQKYEGGIMASKIE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++ +K+    F D+ R        +S+WDY  +++  NKG RIDHI +S   +S L S 
Sbjct: 181 REALKKVIKGRFIDSFRIFEKNTGHWSWWDYRNNAYELNKGWRIDHIYISNNLSSQLKSC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSLDIPEPRK 268
            I+   R  ++PSDH PV+++L+I    +
Sbjct: 241 VIERSQRENSQPSDHAPVLINLEIDNQSE 269


>gi|296128411|ref|YP_003635661.1| exodeoxyribonuclease III Xth [Cellulomonas flavigena DSM 20109]
 gi|296020226|gb|ADG73462.1| exodeoxyribonuclease III Xth [Cellulomonas flavigena DSM 20109]
          Length = 264

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 81/261 (31%), Positives = 131/261 (50%), Gaps = 3/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NSIRAR+    A+++    D++ LQETK +D+ FP E  ++L Y + T G  
Sbjct: 1   MLLATWNINSIRARVDRAVAFLERTGVDVLALQETKVKDEAFPREPFEALGYEVATHGYS 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQT-LRIGNLYLPHGNPITST 122
            +NGVAI+S+    ++    PG          EA     T   +R+ +LY+P+G  I   
Sbjct: 61  QWNGVAIVSRVGLTDVERGFPGQPTWGDPGVAEARALGATCGGVRVWSLYVPNGREIEDP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIF--AGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
            Y  K+ W+      A   L  +        GD+NI P   D ++   +      T   R
Sbjct: 121 HYTYKLDWLGALRDAAEGWLTADPRAQVALVGDWNIAPLDTDVWDIARFAGRTHVTPAER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           Q+F+ L + G+++  R      H Y++WDY    + +N+G+RID    SP   + +   R
Sbjct: 181 QAFEALAHAGYSEVSRVHVPAEHTYTYWDYQQLRFPRNEGMRIDLTYASPTLAARVTGVR 240

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           I+   R   +PSDH PV++ +
Sbjct: 241 IERDERKGKQPSDHVPVVLEI 261


>gi|170721841|ref|YP_001749529.1| exodeoxyribonuclease III Xth [Pseudomonas putida W619]
 gi|169759844|gb|ACA73160.1| exodeoxyribonuclease III Xth [Pseudomonas putida W619]
          Length = 260

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 104/262 (39%), Positives = 154/262 (58%), Gaps = 5/262 (1%)

Query: 1   MSVVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           M  + +AT+N+N I +R+  L AW++   PD+ CLQE K  D  FP E +++  Y     
Sbjct: 1   MKPLRIATFNINGIGSRLPALLAWLEREKPDVACLQELKAADTKFPREAIEAAGYGCLYM 60

Query: 61  GQKSYNGVAILSKY-QPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           GQ S+NGVAIL++  QP+E+   LPG + D Q+R++EA        + +G LYLP+GNP 
Sbjct: 61  GQPSWNGVAILARDSQPLEVRRGLPGMEDDSQSRYLEAAVQG----VLVGCLYLPNGNPQ 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              K++ K+ W +  ++ A   L    P + AGD+N++P   D YNP  W  DA    E 
Sbjct: 117 PGPKFEYKLRWFECLVKHAHDLLGSGHPTVLAGDFNVVPTDFDIYNPKSWLKDALLQPES 176

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R  +Q L   G+TDAIR  +    +Y+FWDY+ + W++N G+RIDH++LSP+  S L + 
Sbjct: 177 RNCYQALLEQGWTDAIRQLYPDERIYTFWDYFRNHWARNAGLRIDHLLLSPDIASHLKAG 236

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            +D   R   KPSDH P  + L
Sbjct: 237 GVDAWVRNEPKPSDHAPAWIEL 258


>gi|16331188|ref|NP_441916.1| exodeoxyribonuclease III [Synechocystis sp. PCC 6803]
 gi|1653682|dbj|BAA18594.1| exodeoxyribonuclease III [Synechocystis sp. PCC 6803]
          Length = 275

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 91/264 (34%), Positives = 138/264 (52%), Gaps = 5/264 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+R+R  ++  W+  N  D++CLQETK  D++FP +  +   YH    GQK
Sbjct: 11  MDIASWNVNSVRSRQQHILDWLGTNPVDVLCLQETKVVDEDFPRQPFEEAGYHCHISGQK 70

Query: 64  SYNGVAILSKYQPIEIVTHL---PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
           SYNGVAI S+    ++           L       +   +     +RI NLY+P+G+ + 
Sbjct: 71  SYNGVAIFSREPLQDVKIGFAALVEPALTGDLDEQKRVISGVYDGVRIVNLYVPNGSALD 130

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLI-FAGDYNIIPQPHDCYNPIIWENDACFT-LE 178
           S KY  K+ W+     +  Q    + P     GD+NI P+  D ++P+  EN    T +E
Sbjct: 131 SEKYLYKLRWLNLLQTYLEQLRRSDTPEFLVCGDFNIAPEDRDIHDPVGRENHIMATAME 190

Query: 179 VRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHS 238
                + L      DA R   +    YS+WDY    +S+N+G RIDH  L+P+       
Sbjct: 191 REALTEVLAIANLQDAFRKFTEETGHYSWWDYRTRGFSRNRGWRIDHHYLTPQLYDQAQK 250

Query: 239 ARIDTKPRGWTKPSDHTPVIVSLD 262
             ID +PRGW KPSDH PV+V+++
Sbjct: 251 CWIDREPRGWEKPSDHAPVVVTIN 274


>gi|325527267|gb|EGD04639.1| exodeoxyribonuclease III [Burkholderia sp. TJI49]
          Length = 258

 Score =  202 bits (514), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 82/256 (32%), Positives = 129/256 (50%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D+ FP   L+++ Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLAQSGTDVLCLQELKLPDEKFPRADLEAIGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       + +  +                   +R  + Y P+G    S K
Sbjct: 61  TYNGVAILARDTLPFDESDIVRNIPGFDDPQQRVVAVTIDG-VRFVSAYFPNGQAPDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    ++    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALQAWLRAEMQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +GF DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 180 AQLIELGFVDAFRRFEQPEKTFTWWDYRMFAFRRNAGLRIDHILLSPALADTCTSCVVDR 239

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDHTPV+ 
Sbjct: 240 TPRTWEQPSDHTPVVA 255


>gi|304391804|ref|ZP_07373746.1| exodeoxyribonuclease III [Ahrensia sp. R2A130]
 gi|303296033|gb|EFL90391.1| exodeoxyribonuclease III [Ahrensia sp. R2A130]
          Length = 265

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 122/262 (46%), Positives = 179/262 (68%), Gaps = 5/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WN+N I+AR   L  W+K+  PDI+ LQE K+ D+NFP   +++L Y+++T GQK
Sbjct: 1   MKIASWNINGIKARHDVLIEWLKQAEPDIVGLQEIKSVDENFPASEIEALGYNVQTHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTH----LPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
            +NGVA+LS+    E+          +D D QARFIE  F+I  ++LR+ +LYLP+GNP+
Sbjct: 61  GFNGVALLSRLPFDEVNRGLPLLRESEDEDEQARFIEGVFSIEGKSLRVVSLYLPNGNPV 120

Query: 120 TSTK-YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLE 178
              + +D K+ W+ R   +A+ RL LEEPLI AGDYN+IPQP+DC+NP +WE DA F  E
Sbjct: 121 DDPRKFDYKLRWMDRLHAWAADRLALEEPLILAGDYNVIPQPNDCWNPKVWEGDALFRDE 180

Query: 179 VRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHS 238
            R  F+ L+N+GFT+A+R++ +   +Y+FWDY A +W KN GIRIDH+++S EA  + + 
Sbjct: 181 TRSRFEALKNLGFTEALRSSANADGIYTFWDYQAGAWPKNHGIRIDHLLMSAEAADMFNG 240

Query: 239 ARIDTKPRGWTKPSDHTPVIVS 260
             ID+  R W KPSDH P+ + 
Sbjct: 241 CGIDSFVRDWEKPSDHVPIWLE 262


>gi|325272311|ref|ZP_08138717.1| exonuclease III [Pseudomonas sp. TJI-51]
 gi|324102557|gb|EGB99997.1| exonuclease III [Pseudomonas sp. TJI-51]
          Length = 270

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 86/269 (31%), Positives = 134/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +  +N+N +RAR H LAA I+++ PD+I LQETK  D+ FP   +Q+L YH+   GQK
Sbjct: 1   MKIVCFNINGLRARPHQLAALIEKHQPDVIGLQETKVSDEQFPLADVQALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GD+ D Q RFI  TF       + I N Y P G      
Sbjct: 61  GHYGVALLSRQAPLSLHKGFAGDEEDAQRRFIWGTFADAQGNPITIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  +          +   ++P++  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYSDLQVLLESQFRNDQPVLVMGDMNISPQDCDIGIGPDNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+  G  D+ R  +   +  +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKGWGLVDSFRHLYPDVNDRFSWFDYRSRGFEDEPKRGLRIDLIMASHAL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D + RG  KPSDH P+ + L
Sbjct: 241 VPRIKAAGVDYELRGMEKPSDHAPIWLEL 269


>gi|148242745|ref|YP_001227902.1| exodeoxyribonuclease III [Synechococcus sp. RCC307]
 gi|147851055|emb|CAK28549.1| Exodeoxyribonuclease III [Synechococcus sp. RCC307]
          Length = 275

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 90/262 (34%), Positives = 136/262 (51%), Gaps = 4/262 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIR+R  +L  W+++  PD++ LQETK ED  FP   ++   Y     GQK
Sbjct: 1   MRIATWNVNSIRSRQSHLLRWLEQAKPDVLGLQETKVEDAQFPAAAMEEAGYRTVISGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHL----PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
           SYNGVA+LS+    E+        PGD+  ++    +   +     +R+ NLY+P+G+ +
Sbjct: 61  SYNGVALLSREPLEEVRIGFDALLPGDEAAIELSQQKRVISAWVDGVRVLNLYVPNGSEV 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
            S KY  K++W+    R+   + E  EP    GD+NI P+  D +NP         +   
Sbjct: 121 GSEKYAYKLAWLDCLRRYLDVQREQGEPFCMLGDFNIGPEARDLHNPERSTGGIMASDAE 180

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R++ +        DA R        +S+WDY + +W+ ++G RIDH+ L  E      + 
Sbjct: 181 REALKACLGDDLRDAFRMFEQGSGHWSWWDYRSGAWNGDRGWRIDHLYLDEELQQRALAC 240

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            I    RG  KPSDH PV V L
Sbjct: 241 EIHKSERGLEKPSDHAPVSVDL 262


>gi|269960966|ref|ZP_06175335.1| exodeoxyribonuclease III [Vibrio harveyi 1DA3]
 gi|269834185|gb|EEZ88275.1| exodeoxyribonuclease III [Vibrio harveyi 1DA3]
          Length = 268

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 82/268 (30%), Positives = 131/268 (48%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPIEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P  ++   +   +      N + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKQEPISVQKGFPTDNEEHQKRMIMATFEDENEEKVTVLNGYFPQGDNIAHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TKY  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKYPYKRQFYKDLMTYLNNHHSNDEQLIVMGDINISPIDADIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + GF D  R  H      +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLQTLLDWGFEDTFRNLHPEVDDRFSWFDYRSRGFDDNRGLRIDVILATPSLAK 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  +  
Sbjct: 241 KCIESDIDYELRGIEKPSDHAPIWSTFK 268


>gi|66045712|ref|YP_235553.1| exonuclease III [Pseudomonas syringae pv. syringae B728a]
 gi|63256419|gb|AAY37515.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth [Pseudomonas
           syringae pv. syringae B728a]
 gi|330971266|gb|EGH71332.1| exonuclease III [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 270

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 88/269 (32%), Positives = 133/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIISFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPQAEVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD + Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNAPLALHKGFEGDDEESQKRFIWGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +            ++PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQTLLEGHFRNDQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRHLYPEVVDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +  A +D   R   KPSDH P+ + L
Sbjct: 241 QPRIKEAGVDYDLRAMEKPSDHAPIWLEL 269


>gi|289673873|ref|ZP_06494763.1| exonuclease III [Pseudomonas syringae pv. syringae FF5]
          Length = 270

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 88/269 (32%), Positives = 134/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H LAA I ++ PD+I LQETK  D+ FP   +++L YH+   GQK
Sbjct: 1   MKIVSFNINGLRARPHQLAALIDKHQPDVIGLQETKVSDEQFPQAEVEALGYHVHFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +     GDD + Q RFI  T+   N Q + I N Y P G      
Sbjct: 61  GHYGVALLSRNAPLALHKGFEGDDEESQKRFIWGTYADSNGQPVTIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  + +        +   ++PLI  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYENLQTLLEGQFRNDQPLIVMGDVNISPQDCDIGIGADNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+N G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKNWGLVDSFRHLYPEVVDRFSWFDYRSRGFEDEPKRGLRIDLIMTSTGL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              +  A +D   R   KPSDH P+ + L
Sbjct: 241 QPRIKEAGVDYDLRAMEKPSDHAPIWLEL 269


>gi|209548989|ref|YP_002280906.1| exodeoxyribonuclease III Xth [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534745|gb|ACI54680.1| exodeoxyribonuclease III Xth [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 263

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 115/264 (43%), Positives = 163/264 (61%), Gaps = 5/264 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+NVN I  R+  L  W+KE+ PD++CLQE KT+D  FP + ++   Y     GQ+
Sbjct: 1   MKIATYNVNGINGRLAILLRWLKEDAPDVVCLQELKTDDAGFPRKEIERSGYGAVWHGQR 60

Query: 64  SYNGVAILSKYQ-PIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           S+NGVAIL+K + PI     LPGD  D  +R+IEA        + IG LYLP+GNP    
Sbjct: 61  SWNGVAILAKDKTPILTRRGLPGDPDDSHSRYIEAVIDG----IVIGCLYLPNGNPFPGA 116

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           K+D K+ W +R   +A++ L LE P I AGD+N++P   D Y P  W +DA F  EVR++
Sbjct: 117 KFDYKLRWFRRLHDYAAELLALEVPSILAGDFNVMPTEIDVYKPERWLDDALFRPEVRKA 176

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           +  L   G+TDA+R  H    +Y+FW Y+ +S+ ++ G+RIDH +LSP     L SA + 
Sbjct: 177 YAHLVGQGWTDAVRHLHPHERIYTFWKYWRNSFERDAGLRIDHFLLSPAVAPWLRSATVR 236

Query: 243 TKPRGWTKPSDHTPVIVSLDIPEP 266
            KPRGW   SDH PV++ LD+P  
Sbjct: 237 RKPRGWEHTSDHAPVMIELDVPSV 260


>gi|49475800|ref|YP_033841.1| exodeoxyribonuclease III [Bartonella henselae str. Houston-1]
 gi|49238607|emb|CAF27848.1| Exodeoxyribonuclease III [Bartonella henselae str. Houston-1]
          Length = 260

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 132/259 (50%), Positives = 178/259 (68%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWN+  I+AR   L  W+++N PDI+CLQE K+ D+NFP + ++SL YHIET GQK
Sbjct: 1   MKIVTWNIAGIKARHETLYQWLQQNRPDIVCLQEIKSTDENFPRDAIESLGYHIETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK  P E++  LPG+D D Q R+IEA ++ N   +R+ +LYLP+GNPI S K
Sbjct: 61  SFNGVAILSKKTPDEVIRQLPGNDKDEQTRYIEAVYSTNKGVIRVASLYLPNGNPINSEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++R    A   L+ EEPL+ AGDYN+IP P D   P  W +DA F  + RQ+F
Sbjct: 121 YPYKMEWMERLYTHAKSLLKYEEPLVLAGDYNVIPTPLDAKTPKEWSDDALFLPQTRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q++ ++GF DAIR   DT   +SFWD+ A +W KN GIRIDH++LSPEA   L  A    
Sbjct: 181 QRIIHLGFYDAIRNVTDTP-SFSFWDFQAAAWRKNNGIRIDHLLLSPEAVDQLICAYSQK 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + RG+ KPSDHTPV + L+
Sbjct: 240 EVRGYQKPSDHTPVWIDLN 258


>gi|167586711|ref|ZP_02379099.1| Exodeoxyribonuclease III xth [Burkholderia ubonensis Bu]
          Length = 258

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 84/256 (32%), Positives = 126/256 (49%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R  ++  W+ ++  D++CLQE K  D  FP   L++  Y     GQK
Sbjct: 1   MKIATWNVNSLNVRKQHVLDWLAQSGTDVLCLQELKLPDDKFPRADLEAAGYRSWFTGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAIL++       + +  +                  T RI + Y P+G    S K
Sbjct: 61  TYNGVAILARDTLPFDESDVTRNVPGFDDPQQRVIAVTIDGT-RIISAYFPNGQAPDSDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     +    L+    L   GDYNI P+  D ++P  WE     + + R  F
Sbjct: 120 FVYKMQWLDALNAWLRSELQRYPKLALLGDYNIAPEDRDVHDPAKWEGQNLVSPQERAHF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
             L  +G  DA R        +++WDY   ++ +N G+RIDHI+LSP       S  +D 
Sbjct: 180 AGLLELGLVDAFRRFEQPEKTFTWWDYRMMAFRRNAGLRIDHILLSPALAETCTSCVVDR 239

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDHTPV+ 
Sbjct: 240 TPRTWEQPSDHTPVVA 255


>gi|153213065|ref|ZP_01948603.1| exodeoxyribonuclease III [Vibrio cholerae 1587]
 gi|124116112|gb|EAY34932.1| exodeoxyribonuclease III [Vibrio cholerae 1587]
          Length = 268

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 80/268 (29%), Positives = 128/268 (47%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP + ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPRQEVEAMGYQVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDL-DVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVAIL K  P+E++   P D+    +   +      N Q   I N Y P G+ +   
Sbjct: 61  AHYGVAILCKQTPVEVIKGFPTDNAEHQKRMIMATFADQNGQKTTILNGYFPQGDNVEHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + +  + +  +     E L+  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYRDLMTYLREHRSNSERLVVMGDINISPLDLDIGIGEANRKRWLQTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H      +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLQTLLDWGLVDTFRQLHPDVSDQFSWFDYRSRGFEDNRGLRIDVILATPTLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + R   KPSDH P+  +  
Sbjct: 241 TCQEAGIDYELRAIDKPSDHAPIWATFK 268


>gi|261378301|ref|ZP_05982874.1| exodeoxyribonuclease III [Neisseria cinerea ATCC 14685]
 gi|269145396|gb|EEZ71814.1| exodeoxyribonuclease III [Neisseria cinerea ATCC 14685]
          Length = 256

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 89/260 (34%), Positives = 136/260 (52%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N+PD++ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNSPDVLVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRSVPQDVHFGLPSLPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRHGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSIERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI+++ E  ++L   R+D 
Sbjct: 177 QNLLDLGLTDSLRHIHPEGAFYTWFDYRGAMFQRKLGLRIDHILVTSEMAAVLKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R   +PSDH PV    D+
Sbjct: 237 DTRALERPSDHAPVAAEFDL 256


>gi|301156424|emb|CBW15895.1| exonuclease III [Haemophilus parainfluenzae T3T1]
          Length = 267

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 128/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I++  PD+I LQE K  D++FP+   ++L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEDFPYTITENLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  +    P D+ D Q R I A        L + N Y P G      T
Sbjct: 61  GHYGVALLTKQEPKAVRRGFPTDNEDAQKRIIMADLETPFGLLTVINGYFPQGESRAHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     R+  Q  +   P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQRYLEQDHDKANPVLIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+ +Q+L + G  D  R  + T +  +S++DY +  +  N+G+RIDHI+++ +    
Sbjct: 181 PEEREWYQRLYDYGLEDTFRKLNPTVNDKFSWFDYRSKGFDDNRGLRIDHILVNRQLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDVGIALDIRAMEKPSDHAPIWAEFK 267


>gi|28198769|ref|NP_779083.1| exodeoxyribonuclease III [Xylella fastidiosa Temecula1]
 gi|28056860|gb|AAO28732.1| exodeoxyribonuclease III [Xylella fastidiosa Temecula1]
          Length = 262

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 86/261 (32%), Positives = 136/261 (52%), Gaps = 6/261 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+  R+  L  W+ E  PD++ LQETK ED  FP   L +L Y     GQK
Sbjct: 1   MRIASWNVNSLNVRLSQLQQWLVEAAPDVLGLQETKLEDHQFPEAALAALGYVSVYAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+L++    ++   +P                     +R+ NLY+ +G  + + K
Sbjct: 61  TYNGVALLARVALEDVQVGIP-----EFEDVQRRVIAATVDGIRVVNLYVVNGQEVGTDK 115

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+SW+     + ++ L+    L+  GD+NI P   D Y+P +W  D   T    ++ 
Sbjct: 116 YAYKLSWLDAVYHWLAEELQRYPRLVVLGDFNIAPDARDVYDPQVWNEDHILTSTTERAA 175

Query: 184 -QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
             KL  +G  D  R  H    ++S+WDY   S+ +N+G+RID  ++S    +   ++ ID
Sbjct: 176 LDKLLGLGLHDGFRLHHQDAGIFSWWDYRQASFRRNRGLRIDLTLVSEALRAQAVASGID 235

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
             PRGW +PSDH P  + L +
Sbjct: 236 RVPRGWERPSDHAPAWIELAL 256


>gi|126174923|ref|YP_001051072.1| exonuclease III [Shewanella baltica OS155]
 gi|153001253|ref|YP_001366934.1| exonuclease III [Shewanella baltica OS185]
 gi|217972826|ref|YP_002357577.1| exonuclease III [Shewanella baltica OS223]
 gi|125998128|gb|ABN62203.1| Exodeoxyribonuclease III [Shewanella baltica OS155]
 gi|151365871|gb|ABS08871.1| exodeoxyribonuclease III [Shewanella baltica OS185]
 gi|217497961|gb|ACK46154.1| exodeoxyribonuclease III [Shewanella baltica OS223]
          Length = 270

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 87/268 (32%), Positives = 131/268 (48%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR+H L A I  + PDII LQETK  D+ FP   ++++ Y +   G K
Sbjct: 1   MKIVSFNINGLRARLHQLQALIDSHQPDIIGLQETKVHDEAFPLADVEAMGYQVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
           ++ GVA+LSK  P ++    P DD D Q R I  TF   N + L + N Y P G  I   
Sbjct: 61  AHYGVAMLSKVAPEKLQKGFPTDDEDAQRRMIIGTFAQANGRPLTVFNGYFPQGESIDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            KY  K  + +  + +       +E +   GD NI P   D           +      F
Sbjct: 121 TKYPAKRKFYQDLMHYLQTNHSNDEDIAIIGDINISPTDLDIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + LQ+ G  D  R  H      YS++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLKTLQDWGLVDTFRQLHPERIERYSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            L  + +D   RG  KPSDH P+  +  
Sbjct: 241 RLVESDVDYDLRGIDKPSDHAPIWSTFK 268


>gi|328473247|gb|EGF44095.1| exonuclease III [Vibrio parahaemolyticus 10329]
          Length = 268

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 133/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPIEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P  ++   +   +      N + + + N Y P G+ I+  
Sbjct: 61  AHYGVAMLCKQEPIRVQKGFPTDNEEHQKRMIMVTFEDENGEKVTVLNGYFPQGDNISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYKDLMTYLNDHHSNDEQLIVMGDINISPIDSDIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D  R  +   +  +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLKTLLDWGFEDTFRKLYPEVNDRFSWFDYRSRGFDDNRGLRIDVILATPSLAQ 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  +  
Sbjct: 241 KCIESGIDYELRGIEKPSDHAPIWSTFK 268


>gi|319404431|emb|CBI78034.1| exodeoxyribonuclease III [Bartonella rochalimae ATCC BAA-1498]
          Length = 260

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 136/259 (52%), Positives = 182/259 (70%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+  I+AR   L  W+K+N PD++CLQE K+ D+NFP +T+++L YHIET GQK
Sbjct: 1   MKIATWNIAGIKARHETLCKWLKQNQPDVVCLQEIKSVDENFPRDTIENLGYHIETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK  P E++  LPG++ D+QAR+IE  ++ NT ++R+ +LYLP+GNPI S K
Sbjct: 61  SFNGVAILSKTVPDEVILQLPGNNNDMQARYIETVYSTNTGSIRVASLYLPNGNPINSEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  KI W+KR    A   L  EEPLI AGDYN+IP P D  NP  W NDA F  ++RQ F
Sbjct: 121 YLYKIEWMKRLYTHAKSLLAYEEPLILAGDYNVIPTPLDAKNPQEWSNDALFLPQIRQIF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q + ++GF DAIR   D    +SFWD+ A++W KN GIRIDH++LSPEA   L  A   T
Sbjct: 181 QCITHLGFYDAIRNVTDAP-SFSFWDFQANAWKKNNGIRIDHLLLSPEAADQLICAYSQT 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + RG+ KPSDH P+ + L+
Sbjct: 240 EARGYQKPSDHVPIWIELN 258


>gi|91763300|ref|ZP_01265264.1| exodeoxyribonuclease III [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717713|gb|EAS84364.1| exodeoxyribonuclease III [Candidatus Pelagibacter ubique HTCC1002]
          Length = 258

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 95/258 (36%), Positives = 157/258 (60%), Gaps = 1/258 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + +WNVNS+RARI N+  ++++ +P+++ +QE KT+D+ FP++   +L+Y     GQK
Sbjct: 1   MIITSWNVNSVRARIENIKEYLQKFSPNVVMMQEIKTQDETFPYDDFSALDYESHVFGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           SYNGVAI+SK++   +   L  D L               + +++ N+Y P+GNP+ + K
Sbjct: 61  SYNGVAIISKHKLENVRIDLIKDKLKQSRIISA-ELKHKKKNVQLINIYTPNGNPVDTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K  W+ + ++      +  E +I AGD+NI+P   D YN   +E+DA + LE+R+ F
Sbjct: 120 YTYKKDWLDKLIKQLKTLSKKNENIILAGDFNILPSAEDAYNIKGFEDDALYRLEIRKKF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           +++ N+GF DA R  H     Y++WDY   +W KN G+RIDH ++S    +++ +  I+ 
Sbjct: 180 REMINLGFHDAYRHIHGEKEGYTYWDYMRGAWQKNNGLRIDHFLVSNSLLNIVKNVNINK 239

Query: 244 KPRGWTKPSDHTPVIVSL 261
            PRG  KPSDHTP+ + L
Sbjct: 240 DPRGKEKPSDHTPIEIEL 257


>gi|304411895|ref|ZP_07393506.1| exodeoxyribonuclease III [Shewanella baltica OS183]
 gi|307303337|ref|ZP_07583092.1| exodeoxyribonuclease III [Shewanella baltica BA175]
 gi|304349755|gb|EFM14162.1| exodeoxyribonuclease III [Shewanella baltica OS183]
 gi|306913697|gb|EFN44119.1| exodeoxyribonuclease III [Shewanella baltica BA175]
          Length = 270

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 87/268 (32%), Positives = 131/268 (48%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR+H L A I  + PDII LQETK  D+ FP   ++++ Y +   G K
Sbjct: 1   MKIVSFNINGLRARLHQLQALIDSHQPDIIGLQETKVHDEAFPLADVEAMGYQVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
           ++ GVA+LSK  P ++    P DD D Q R I  TF   N + L + N Y P G  I   
Sbjct: 61  AHYGVAMLSKVAPEKLQKGFPTDDEDAQRRMIIGTFSQANGRPLTVFNGYFPQGESIDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            KY  K  + +  + +       +E +   GD NI P   D           +      F
Sbjct: 121 TKYPAKRKFYQDLMHYLQTNHSNDEDIAIIGDINISPTDLDIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + LQ+ G  D  R  H      YS++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLKTLQDWGLVDTFRQLHPERIERYSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            L  + +D   RG  KPSDH P+  +  
Sbjct: 241 RLVESDVDYDLRGIDKPSDHAPIWSTFK 268


>gi|94310134|ref|YP_583344.1| exodeoxyribonuclease III [Cupriavidus metallidurans CH34]
 gi|93353986|gb|ABF08075.1| exodeoxyribonuclease III (xth) [Cupriavidus metallidurans CH34]
          Length = 265

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 82/265 (30%), Positives = 137/265 (51%), Gaps = 6/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNP-----DIICLQETKTEDKNFPFETLQSLNYHIE 58
           + +A+WNVNS++ R+  +  W+   +      D +CLQE K  D  +P   LQ+  +H  
Sbjct: 1   MRIASWNVNSLKVRLPQVLQWLGAQDAAGTPIDALCLQELKLPDDKYPLAELQAAGFHSI 60

Query: 59  TCGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNP 118
             GQK+YNGVAIL++   + + T +  +    +              +R+ + Y P+G  
Sbjct: 61  FTGQKTYNGVAILARNAAMPVPTDVVRNIPGYEDAQQRVIAGTYGD-VRLISAYFPNGQA 119

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLE 178
           + S K+  K+ W+K  + +    +     L   GD+NI P+  D ++P  WE     + +
Sbjct: 120 LDSDKFVYKLDWLKAMIEWLRAEMTRYPKLALLGDFNIAPEDRDVHDPAKWEGQNLVSPQ 179

Query: 179 VRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHS 238
            R +FQ L  +G  D+ R       ++S+WDY    + +N G+RIDHI+LS +      +
Sbjct: 180 ERDAFQTLIGLGLVDSFRMFEQPEKMFSWWDYRMMGFRRNAGLRIDHILLSADLARQCAT 239

Query: 239 ARIDTKPRGWTKPSDHTPVIVSLDI 263
             ID +PR W +PSDHTPV+ +L +
Sbjct: 240 CVIDKEPRRWEQPSDHTPVVATLTL 264


>gi|260913979|ref|ZP_05920453.1| exodeoxyribonuclease III [Pasteurella dagmatis ATCC 43325]
 gi|260632066|gb|EEX50243.1| exodeoxyribonuclease III [Pasteurella dagmatis ATCC 43325]
          Length = 267

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 80/266 (30%), Positives = 125/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR H L A I+   PD++ LQE K  D+ FP+E ++ L YH+   GQK
Sbjct: 1   MKIISFNINGLRARPHQLEAIIERYQPDVLGLQEIKVADEVFPYELVEHLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P  +    P D  D Q R I A F  +   L + N Y P G      T
Sbjct: 61  GHYGVALLTKQEPKAVRKGFPTDAEDAQKRIIMADFETDFGLLTVVNGYFPQGESRQHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     ++  +   ++ P+I  GD NI P         +     +      F 
Sbjct: 121 KFPAKEKFYADLQQYLEKDHNVDNPIIIMGDMNISPTDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +   +  +S++DY +  +  N+G+RIDHI+ +    + 
Sbjct: 181 PEEREWMNRLYGYGLVDTFRHLNPDVNDKFSWFDYRSKGFDDNRGLRIDHIIANHSLAAR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                I    R   KPSDH PV    
Sbjct: 241 CVDTGIALDIRAMEKPSDHAPVWAEF 266


>gi|325203504|gb|ADY98957.1| exodeoxyribonuclease III [Neisseria meningitidis M01-240355]
          Length = 256

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 90/260 (34%), Positives = 134/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRNAPEDVHIVLPALPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRYGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP   + L   R+D 
Sbjct: 177 KNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMAAALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D 
Sbjct: 237 ETRALERPSDHAPVTAEFDW 256


>gi|261252552|ref|ZP_05945125.1| exodeoxyribonuclease III [Vibrio orientalis CIP 102891]
 gi|260935943|gb|EEX91932.1| exodeoxyribonuclease III [Vibrio orientalis CIP 102891]
          Length = 268

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 82/268 (30%), Positives = 135/268 (50%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAVIDKHQPDVIGLQEIKVHDEAFPLEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEAT-FTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +P+ +    P D+ D Q R I  T    N + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKKEPLSVQKGFPTDNEDHQKRMIMVTLEDDNGEKVTVLNGYFPQGDNIGHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  +    + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYSDLMTYLNDHHSNDEQLIVMGDINISPIDADIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D  R  H   +  +S++DY +  +  N+G+RID ++ +P+   
Sbjct: 181 QPEEREWLKTLLDWGFVDTFRQIHPDVNDRFSWFDYRSKGFPDNRGLRIDVVLATPKLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + +D + RG  KPSDH P+  +  
Sbjct: 241 KCIESDVDYELRGIEKPSDHAPIWSTFK 268


>gi|124514320|gb|EAY55834.1| Exodeoxyribonuclease III [Leptospirillum rubarum]
          Length = 265

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 78/257 (30%), Positives = 127/257 (49%), Gaps = 5/257 (1%)

Query: 7   ATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQKSYN 66
            TWNVNS++ R+  +  W+     D++CLQETK  D  FPF+  + + Y     GQ +YN
Sbjct: 14  TTWNVNSLKVRLPQVLDWLLREKADVVCLQETKLPDAQFPFQAFREIGYDAVWSGQPTYN 73

Query: 67  GVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTKYDD 126
           GVAILS        T +     D +              +RI N+Y+P+G  + S K+  
Sbjct: 74  GVAILSNTPIEMTETSMDDHPDDHRRFLSARVRG-----VRIVNVYVPNGQDLDSPKFAY 128

Query: 127 KISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSFQKL 186
           K+ W+ R  R+  +     +P++  GD+NI+P   D ++P  +++    +   R +   +
Sbjct: 129 KLEWLNRLTRYIEKVRAAPDPVLLMGDFNIVPGDLDTWDPAGFKDQIFHSPPERNALGNI 188

Query: 187 QNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDTKPR 246
              GF D  R  +     +S+WDY   S+ +N+G+RID I+ +P  +       ID + R
Sbjct: 189 FRTGFADLYRTLYPDRQEFSWWDYRMGSFHRNRGLRIDLILSTPPLSEQCQEVFIDREAR 248

Query: 247 GWTKPSDHTPVIVSLDI 263
              +PSDH PV     +
Sbjct: 249 KAERPSDHVPVTALFAL 265


>gi|254286781|ref|ZP_04961735.1| exodeoxyribonuclease III [Vibrio cholerae AM-19226]
 gi|150423208|gb|EDN15155.1| exodeoxyribonuclease III [Vibrio cholerae AM-19226]
          Length = 268

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 78/268 (29%), Positives = 127/268 (47%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP + ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPRQEVEAMGYQVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           ++ GVAIL K  P+E++   P  ++   +   +      N Q   I N Y P G+ +   
Sbjct: 61  AHYGVAILCKQTPVEVIKGFPTDNEEHQKRMIMATFADQNGQKTTILNGYFPQGDNVEHK 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
            K+  K  + +  + +  +     E L+  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYRDLMTYLREHRSNSERLVVMGDINISPLDLDIGIGEANRKRWLQTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H      +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLQTLLDWGLVDTFRQLHPDVSDQFSWFDYRSRGFEDNRGLRIDVILATPTLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + R   KPSDH P+  +  
Sbjct: 241 TCQEAGIDYELRAIDKPSDHAPIWATFK 268


>gi|153825215|ref|ZP_01977882.1| exodeoxyribonuclease III [Vibrio cholerae MZO-2]
 gi|153830542|ref|ZP_01983209.1| exodeoxyribonuclease III [Vibrio cholerae 623-39]
 gi|229523879|ref|ZP_04413284.1| exodeoxyribonuclease III [Vibrio cholerae bv. albensis VL426]
 gi|229529117|ref|ZP_04418507.1| exodeoxyribonuclease III [Vibrio cholerae 12129(1)]
 gi|297579378|ref|ZP_06941306.1| exodeoxyribonuclease III [Vibrio cholerae RC385]
 gi|148873972|gb|EDL72107.1| exodeoxyribonuclease III [Vibrio cholerae 623-39]
 gi|149741194|gb|EDM55245.1| exodeoxyribonuclease III [Vibrio cholerae MZO-2]
 gi|229332891|gb|EEN98377.1| exodeoxyribonuclease III [Vibrio cholerae 12129(1)]
 gi|229337460|gb|EEO02477.1| exodeoxyribonuclease III [Vibrio cholerae bv. albensis VL426]
 gi|297536972|gb|EFH75805.1| exodeoxyribonuclease III [Vibrio cholerae RC385]
 gi|327484412|gb|AEA78819.1| Exodeoxyribonuclease III [Vibrio cholerae LMA3894-4]
          Length = 268

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 128/268 (47%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP + ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPRQEVEAMGYQVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVAIL K  P+E++   P  ++   +   +      N Q   I N Y P G+ +   
Sbjct: 61  AHYGVAILCKQTPVEVIKGFPTDNEEHQKRMIMATFADQNGQKTTILNGYFPQGDNVEHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + +  + +  +     E L+  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYRDLMTYLREHRSNSERLVVMGDINISPLDLDIGIGEANRKRWLQTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H      +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLQTLLDWGLVDTFRQLHPDVSDQFSWFDYRSRGFEDNRGLRIDVILATPTLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + R   KPSDH P+  +  
Sbjct: 241 TCQEAGIDYELRAIDKPSDHAPIWATFK 268


>gi|296313346|ref|ZP_06863287.1| exodeoxyribonuclease III [Neisseria polysaccharea ATCC 43768]
 gi|296840163|gb|EFH24101.1| exodeoxyribonuclease III [Neisseria polysaccharea ATCC 43768]
          Length = 256

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 90/260 (34%), Positives = 135/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRSVPQDVHFGLPSLPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRYGKLVLLGDFNIAPADADCYDPEKWYEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI+++ E  ++L   R+D 
Sbjct: 177 QNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVTSEMAAVLKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             R   +PSDH PV    D+
Sbjct: 237 DTRALERPSDHAPVAAEFDL 256


>gi|71898520|ref|ZP_00680691.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth [Xylella
           fastidiosa Ann-1]
 gi|182681462|ref|YP_001829622.1| exodeoxyribonuclease III Xth [Xylella fastidiosa M23]
 gi|71731644|gb|EAO33704.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth [Xylella
           fastidiosa Ann-1]
 gi|182631572|gb|ACB92348.1| exodeoxyribonuclease III Xth [Xylella fastidiosa M23]
 gi|307579913|gb|ADN63882.1| exodeoxyribonuclease III Xth [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 264

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 86/261 (32%), Positives = 136/261 (52%), Gaps = 6/261 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+  R+  L  W+ E  PD++ LQETK ED  FP   L +L Y     GQK
Sbjct: 3   MRIASWNVNSLNVRLSQLQQWLVEAAPDVLGLQETKLEDHQFPEAALAALGYVSVYAGQK 62

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+L++    ++   +P                     +R+ NLY+ +G  + + K
Sbjct: 63  TYNGVALLARVALEDVQVGIP-----EFEDVQRRVIAATVDGIRVVNLYVVNGQEVGTDK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+SW+     + ++ L+    L+  GD+NI P   D Y+P +W  D   T    ++ 
Sbjct: 118 YAYKLSWLDAVYHWLAEELQRYPRLVVLGDFNIAPDARDVYDPQVWNEDHILTSTTERAA 177

Query: 184 -QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
             KL  +G  D  R  H    ++S+WDY   S+ +N+G+RID  ++S    +   ++ ID
Sbjct: 178 LDKLLGLGLHDGFRLHHQDAGIFSWWDYRQASFRRNRGLRIDLTLVSEALRAQAVASGID 237

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
             PRGW +PSDH P  + L +
Sbjct: 238 RVPRGWERPSDHAPAWIELAL 258


>gi|332036974|gb|EGI73433.1| exodeoxyribonuclease III [Pseudoalteromonas haloplanktis ANT/505]
          Length = 268

 Score =  201 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 124/268 (46%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E +Q + YH+   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAIIDKHQPDVIGLQEIKVHDEAFPLEDVQKMGYHVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHL-PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +P  ++       +   +          N + L + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKKEPKSVLKGFATDTEESQKRMISVTVEQDNGRDLTVMNGYFPQGDNINHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
           TK+  K  + K  +          + +I  GD NI P   D           +      F
Sbjct: 121 TKFPYKRQFYKDLMTHLETNHTPVQDVIVMGDINISPTDLDIGIGEVNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
               R+    L N GF D  R  +      YS++DY +  +  N+G+RID ++ + E  +
Sbjct: 181 QPVEREWLATLLNWGFKDTFREQNPETDDQYSWFDYRSKGFVDNRGLRIDVVLATNELAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
                 ID + RG  KPSDH P+  +  
Sbjct: 241 RCIDTGIDYELRGIEKPSDHAPIWSTFK 268


>gi|118580060|ref|YP_901310.1| exonuclease III [Pelobacter propionicus DSM 2379]
 gi|118502770|gb|ABK99252.1| Exodeoxyribonuclease III [Pelobacter propionicus DSM 2379]
          Length = 270

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 89/270 (32%), Positives = 135/270 (50%), Gaps = 11/270 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++NVN +R+R+H L A I    P+II LQETK  D+ FP + +QSL YH+   GQK
Sbjct: 1   MKIVSFNVNGLRSRLHQLEALINAQRPEIIALQETKVRDEEFPVDAVQSLGYHVVFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTI-NTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+LS+    ++   LPGD  + Q RFI AT  + +   +R+ N Y P G      
Sbjct: 61  THYGVALLSRLPLQDVQLGLPGDGDEAQKRFIAATIPLSDGTPVRVINGYFPQGENRDHA 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWE------NDACF 175
            K+  K  +    L       +   PL+  GD+N+ P+  D                 CF
Sbjct: 121 VKFPAKQRFYAELLGHLQGECDPATPLVVLGDFNVAPRDMDLGIGTDNVKRWLKSGKCCF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSW--SKNKGIRIDHIMLSPEA 232
             E R  F+ L   G  D+ R  +      +S++DY +  +     +G+RIDHI+L+   
Sbjct: 181 LPEERLWFECLIEWGLHDSFRELNPAVADRFSWFDYRSRGFEGEPKRGLRIDHILLTRSL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            +   +A ID   R   KPSDH PV V ++
Sbjct: 241 LARCRAAGIDYDIRSMAKPSDHCPVWVEIE 270


>gi|238919557|ref|YP_002933072.1| exodeoxyribonuclease III, putative [Edwardsiella ictaluri 93-146]
 gi|238869126|gb|ACR68837.1| exodeoxyribonuclease III, putative [Edwardsiella ictaluri 93-146]
          Length = 269

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 80/269 (29%), Positives = 124/269 (46%), Gaps = 8/269 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H LAA +++++PD+I LQETK  D  FP + L  L Y +   GQK
Sbjct: 1   MKFISFNINGLRARPHQLAAIVEKHSPDVIGLQETKVHDDMFPLQDLAHLGYQLHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L++  P+ +    PGDD + Q R I A       TL + N Y P G       
Sbjct: 61  GHYGVALLTRMAPLAVRKGFPGDDAEAQRRVIMADIPTELGTLTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDC------YNPIIWENDACFT 176
            +  K  +     R+    L  + P++  GD NI P+  D           +      F 
Sbjct: 121 KFPAKSKFYADLQRYLQDSLTPQNPVLIMGDMNISPRDIDIGIGDESRRRWLRSGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L   G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWLDRLLAWGLVDTYRQANPQGDDHFSWFDYRSKGFDDNRGLRIDLLLASQPLAQR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDIP 264
                ID + R   KPSDH P+     + 
Sbjct: 241 CTDTGIDYEIRAMEKPSDHAPIWAEFALS 269


>gi|114047018|ref|YP_737568.1| exonuclease III [Shewanella sp. MR-7]
 gi|113888460|gb|ABI42511.1| Exodeoxyribonuclease III [Shewanella sp. MR-7]
          Length = 270

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 86/268 (32%), Positives = 131/268 (48%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +R+R+H L A I  + PDII LQETK  D+ FP   ++++ YH+   G K
Sbjct: 1   MKIVSFNINGLRSRLHQLQALIDSHQPDIIGLQETKVHDEAFPLAEVEAMGYHVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
           ++ GVA+LSK  PI++      D+ D Q R I  TF   N + L + N Y P G  I   
Sbjct: 61  AHYGVAMLSKAAPIKVQKGFATDEEDAQRRMIIGTFAQANGRPLTVLNGYFPQGESIDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            KY  K  + +  +         +E +   GD NI P   D           +      F
Sbjct: 121 TKYPAKRKFYQDLMAHLHANHSNDEDIAIIGDINISPIDLDIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + LQ+ G  D  R  H      YS++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLKTLQDWGLVDTFRQLHPDRSERYSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            L  + +D   RG  KPSDH P+  +  
Sbjct: 241 RLIESDVDYDLRGIDKPSDHAPIWSTFK 268


>gi|317048409|ref|YP_004116057.1| exodeoxyribonuclease III [Pantoea sp. At-9b]
 gi|316950026|gb|ADU69501.1| exodeoxyribonuclease III [Pantoea sp. At-9b]
          Length = 268

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 127/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEALVEQHQPDVIGLQETKVHDDMFPLEEVSKLGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K +P+ +    P D  D Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKAEPVAVHRGFPSDGEDAQRRLIMAEIPSPIGDITVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +   +L +++P++  GD NI           +     +      F 
Sbjct: 121 KFPAKEKFYQDLQSYLQTQLAVDKPVLIMGDMNISSTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L N G  D  RA +      +S++DY +  +  N+G+RID ++ S    S 
Sbjct: 181 PEEREWMDRLLNWGLVDTWRAQYPETADRFSWFDYRSKGFDDNRGLRIDLLLASQPLASR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             ++ ID   R   KPSDH PV  +  +
Sbjct: 241 CIASGIDYDIRSMEKPSDHAPVWSTFKL 268


>gi|260779121|ref|ZP_05888013.1| exodeoxyribonuclease III [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605285|gb|EEX31580.1| exodeoxyribonuclease III [Vibrio coralliilyticus ATCC BAA-450]
          Length = 268

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 133/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAVIDKHQPDVIGLQEIKVHDEAFPIEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +P+ +    P  ++   +   +      N + + + N Y P G+ I+  
Sbjct: 61  AHYGVAMLCKKEPLSVQKGFPTDNEDHQKRMIMATFEDDNGEKVTVLNGYFPQGDNISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TKY  K  + K  + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKYPYKRQFYKDLMTYLNDHHNNDEQLIVMGDINISPIDADIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + GF D  R  H      +S++DY +  +  N+G+RID ++ +P+   
Sbjct: 181 QPEEREWLKTLMDWGFVDTFRQLHPEVEDRFSWFDYRSRGFDDNRGLRIDVVLATPKLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + ID + RG  KPSDH P+  +  
Sbjct: 241 KCIESDIDYELRGIEKPSDHAPIWSTFK 268


>gi|148548014|ref|YP_001268116.1| exonuclease III [Pseudomonas putida F1]
 gi|148512072|gb|ABQ78932.1| Exodeoxyribonuclease III [Pseudomonas putida F1]
          Length = 270

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 86/269 (31%), Positives = 132/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +  +N+N +RAR H LAA I+++ PD+I LQETK  D  FP   +Q+L YH+   GQK
Sbjct: 1   MKIVCFNINGLRARPHQLAALIEKHQPDVIGLQETKVSDDQFPLADVQALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +      D+ D Q RFI  TF   N   + I N Y P G      
Sbjct: 61  GHYGVALLSRQAPLSLHKGFATDEEDAQRRFIWGTFADANGSPITIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  +          +   ++P++  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYSDLQALLESQFRNDQPVLVMGDMNISPQDCDIGIGPDNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+  G  D+ R  +      +S++DY +  +     +G+RID IM S   
Sbjct: 181 LPEEREWMERLKGWGLVDSFRHLYPEVTDRFSWFDYRSRGFEDEPKRGLRIDLIMASQPL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D + RG  KPSDH P+ + L
Sbjct: 241 VPRIKAAGVDYELRGMEKPSDHAPIWLEL 269


>gi|71275821|ref|ZP_00652105.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth [Xylella
           fastidiosa Dixon]
 gi|71902300|ref|ZP_00684290.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth [Xylella
           fastidiosa Ann-1]
 gi|170730198|ref|YP_001775631.1| exodeoxyribonuclease III [Xylella fastidiosa M12]
 gi|71163399|gb|EAO13117.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth [Xylella
           fastidiosa Dixon]
 gi|71727953|gb|EAO30176.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth [Xylella
           fastidiosa Ann-1]
 gi|167964991|gb|ACA12001.1| exodeoxyribonuclease III [Xylella fastidiosa M12]
          Length = 264

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 86/261 (32%), Positives = 138/261 (52%), Gaps = 6/261 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+  R+  L  W+ E  PD++ LQETK ED  FP   L +L Y     GQK
Sbjct: 3   MRIASWNVNSLNVRLSQLQQWLVEAAPDVLGLQETKLEDHQFPGAALAALGYVSVYAGQK 62

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+L++    ++   +P  +   +              +R+ NLY+ +G  + + K
Sbjct: 63  TYNGVALLARVALEDVQVGIPEFEDVQRRVIAATVDG-----IRVVNLYVVNGQEVGTEK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+SW+     + ++ L+    L+  GD+NI P   D Y+P +W  D   T    ++ 
Sbjct: 118 YAYKLSWLDAVYHWLAEELQRYPRLVVLGDFNIAPDARDVYDPQVWNEDHILTSTTERAA 177

Query: 184 -QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
             KL  +G  D  R  H    ++S+WDY   S+ +N+G+RID  ++S    +   ++ ID
Sbjct: 178 LDKLLGLGLHDGFRLHHQDAGIFSWWDYRQASFRRNRGLRIDLTLVSEALRAQAVASGID 237

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
             PRGW +PSDH P  + L +
Sbjct: 238 RVPRGWERPSDHAPAWIELAL 258


>gi|300742521|ref|ZP_07072542.1| exodeoxyribonuclease III [Rothia dentocariosa M567]
 gi|300381706|gb|EFJ78268.1| exodeoxyribonuclease III [Rothia dentocariosa M567]
          Length = 278

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 76/265 (28%), Positives = 123/265 (46%), Gaps = 7/265 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNSIRAR   +  W+ +   D++ LQETKT+D+ FPFE  + L Y +   G  
Sbjct: 12  MKIATWNVNSIRARADRIEDWLDKTEVDVLALQETKTKDETFPFELFEFLGYEVAHYGLN 71

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLD----VQARFIEATFTINTQTLRIGNLYLPHGNPI 119
            +NGVAI S+     +    P           A             +RI +LY+P+G  +
Sbjct: 72  QWNGVAIASRVGLDSVERTFPNQPAFGKPGDPAEVEARAIGATCNGVRIWSLYVPNGRGL 131

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACFTL 177
           T      K+ W+++     +  L  +        GD+N+ P+  D ++   +  +    +
Sbjct: 132 TDPHMAYKMEWMRQLRTNVNGWLHADPAAQFALVGDWNVAPEDTDVWDIDFFRENDLTHV 191

Query: 178 EVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
              +       +     I          Y++WDY A  +SKN+G+RID  + SP   + +
Sbjct: 192 SAPEREAFYALLNDEGLIDPVRPYTQGEYTYWDYQAGRFSKNEGMRIDFQLCSPALAARV 251

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSL 261
            +A ID + R     SDHTPV++ L
Sbjct: 252 ENAWIDREEREGDGASDHTPVVIEL 276


>gi|261391913|emb|CAX49373.1| exodeoxyribonuclease III (exonuclease III; EXO III) [Neisseria
           meningitidis 8013]
          Length = 256

 Score =  201 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 90/260 (34%), Positives = 133/260 (51%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRNAPEDVHIGLPALPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMTRYGKLVLLGDFNIAPADADCYDPEKWHEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           + L ++G TD++R  H     Y+++DY    + +  G+RIDHI++SP     L   R+D 
Sbjct: 177 KNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVSPAMVEALKDVRVDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D 
Sbjct: 237 ETRALERPSDHAPVAAEFDW 256


>gi|188533711|ref|YP_001907508.1| Exodeoxyribonuclease III [Erwinia tasmaniensis Et1/99]
 gi|188028753|emb|CAO96615.1| Exodeoxyribonuclease III [Erwinia tasmaniensis Et1/99]
          Length = 268

 Score =  201 bits (512), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 83/268 (30%), Positives = 127/268 (47%), Gaps = 8/268 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E + SL YH+   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLQAIVEQHQPDVIGLQETKVHDDMFPLEEVASLGYHVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L K QPI +     GDD D Q R I A    +   + + N Y P G       
Sbjct: 61  GHYGVAMLCKQQPIAVRRGFEGDDEDAQRRIIMADIPTSDGVITVLNGYFPQGESRDHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACFT 176
           K+  K  + +    +  Q+ + +  ++  GD NI     D           +      F 
Sbjct: 121 KFPAKEKFYRDLQSYLEQQQKADNQVVIMGDMNISSSDLDIGIGEVNRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATH-DTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L N G  D  RA + + +  +S++DY +  +  N+G+RID I+ S      
Sbjct: 181 PEEREWMDRLMNWGLVDTWRAQNAEVNDRFSWFDYRSKGFDDNRGLRIDLILASRPLAGR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLDI 263
             +  ID   R   KPSDH P+     +
Sbjct: 241 CVATGIDYDIRAMEKPSDHAPIWAQFSL 268


>gi|120554411|ref|YP_958762.1| exodeoxyribonuclease III [Marinobacter aquaeolei VT8]
 gi|120324260|gb|ABM18575.1| Exodeoxyribonuclease III [Marinobacter aquaeolei VT8]
          Length = 270

 Score =  201 bits (512), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 87/271 (32%), Positives = 137/271 (50%), Gaps = 11/271 (4%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           ++   ++NVNSIR R+H L A I++ NPD+I LQETK  D+ FP E ++ L YH+   GQ
Sbjct: 1   MM-FVSFNVNSIRTRLHQLEAVIQQLNPDVIGLQETKVTDEEFPVEAIRELGYHVHFHGQ 59

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K++ GVA+LS+ +P +++   P D  D Q R I   FT+N + L + N Y P G      
Sbjct: 60  KTHYGVALLSRAKPEQVIKGYPSDGEDSQRRLITGHFTVNGEPLTVINGYFPQGESRDHP 119

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  +    + +  +  +    ++  GD NI P         D     +      F
Sbjct: 120 VKFPAKEKFYADLMAYLDELTKKPGHILVMGDMNISPTDRDIGIGADNAKRWLRSGKCSF 179

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKN--KGIRIDHIMLSPEA 232
             E R+   +++  GFTD  R  H    + +S++DY +  + ++  +G+RID IM S   
Sbjct: 180 LPEEREWLGQVEQRGFTDVFRHLHPDEANTFSWFDYRSKGFERDPRRGLRIDLIMASDSL 239

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
                +A +    R   +PSDH PV  S D+
Sbjct: 240 LPKAKAAGVSYDIRAMERPSDHCPVWASFDL 270


>gi|256833636|ref|YP_003162363.1| exodeoxyribonuclease III Xth [Jonesia denitrificans DSM 20603]
 gi|256687167|gb|ACV10060.1| exodeoxyribonuclease III Xth [Jonesia denitrificans DSM 20603]
          Length = 264

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 75/261 (28%), Positives = 127/261 (48%), Gaps = 4/261 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WN+NSIRAR     A ++ ++ D++ LQETK +D+ FP    +   Y +   G  
Sbjct: 1   MRLASWNINSIRARTDRALAVLERHDIDVLALQETKCKDEQFPVAAFEEAGYEVAHVGVN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQ-TLRIGNLYLPHGNPITST 122
            +NGVA++S+    ++    PG     +   +EA         +R+ +LY+P+G  I   
Sbjct: 61  QWNGVALISRVGLDDVHRAFPGQPGFGEDPVVEARAVGAICGGVRVWSLYVPNGREIDHP 120

Query: 123 KYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
            Y  K+ W+ +    A Q    +    +   GD+N+ P+  D ++   +E     T   R
Sbjct: 121 HYHYKLQWLHQLKNSAQQWTADDPAAQVALVGDWNVAPRDTDVWDREFFEGKTHVTDPER 180

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
            +F    ++G+T+  R       +Y++WDY    + KN+G+RID    SP  T  +    
Sbjct: 181 AAFAAFGDIGYTEVSRVHVP-EDVYTYWDYQQLRFPKNQGMRIDFAWCSPALTKRVTGVE 239

Query: 241 IDTKPRGWTKPSDHTPVIVSL 261
           ID   R     SDH PVI+ +
Sbjct: 240 IDRNERKGKGASDHVPVILDI 260


>gi|119961356|ref|YP_946272.1| exodeoxyribonuclease III [Arthrobacter aurescens TC1]
 gi|119948215|gb|ABM07126.1| exodeoxyribonuclease III [Arthrobacter aurescens TC1]
          Length = 268

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 127/266 (47%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+RAR   + AW++ ++ D++ +QETK +D+NFP+E  + + Y +   G  
Sbjct: 1   MKIATWNVNSLRARADRVEAWLERSDCDVLAIQETKCKDENFPWELFERMGYEVAHFGVN 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLD----VQARFIEATFTINTQTLRIGNLYLPHGNPI 119
            +NGVAI S+    ++                              +RI +LY+P+G  +
Sbjct: 61  QWNGVAIASRVGLDDVQRTFLDQPAFGKAGKDPAQEARAIAATCGGIRIWSLYVPNGRSL 120

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEE--PLIFAGDYNIIPQPHDCYNP--IIWENDACF 175
                  KI W+      A++ ++ E    +   GD+NI P   D ++       N    
Sbjct: 121 DDEHMPYKIKWLDVLQGHAAEWVKSEPTAQIALMGDWNIAPFDDDVWDIELFRNNNYTHV 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
           +   R +F   +  GFTD +R       +Y++WDY    + K +G+RID  + SP   S 
Sbjct: 181 SEPERAAFHAFETAGFTDVVRPYTPGPGVYTYWDYTQLRFPKKEGMRIDFCLASPALASR 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
           +  A ID + R     SDH PVIV L
Sbjct: 241 VTGASIDREERKGKGASDHAPVIVEL 266


>gi|323494946|ref|ZP_08100037.1| exonuclease III [Vibrio brasiliensis LMG 20546]
 gi|323310741|gb|EGA63914.1| exonuclease III [Vibrio brasiliensis LMG 20546]
          Length = 268

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 132/268 (49%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAVIDKHQPDVIGLQEIKVHDEAFPLEDVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P  ++   +   +      N + + I N Y P G+ I   
Sbjct: 61  AHYGVAMLCKKEPISVQKGFPTDNEDHQKRMIMVTVEDDNGEKVTILNGYFPQGDNINHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  +    + + +     +E LI  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYSDLMTYLNDHHTNDEQLIVMGDINISPIDADIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E RQ  + L + GF D  R  H   +  +S++DY +  +  N+G+RID ++ +P+   
Sbjct: 181 QPEERQWLKTLLDWGFVDTFRQIHPDVNDRFSWFDYRSKGFPDNRGLRIDVVLATPKLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               + +D + RG  KPSDH P+  +  
Sbjct: 241 KCIESDVDYELRGIEKPSDHAPIWSTFK 268


>gi|191171643|ref|ZP_03033190.1| exodeoxyribonuclease III [Escherichia coli F11]
 gi|190907973|gb|EDV67565.1| exodeoxyribonuclease III [Escherichia coli F11]
          Length = 268

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 79/266 (29%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDVMFPLEEVAKLGYNVFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSPLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ E P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRENPVLIMGDMNISPGDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+  ++L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMERLMSWGLVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|157374807|ref|YP_001473407.1| exonuclease III [Shewanella sediminis HAW-EB3]
 gi|157317181|gb|ABV36279.1| exodeoxyribonuclease III [Shewanella sediminis HAW-EB3]
          Length = 268

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 86/268 (32%), Positives = 135/268 (50%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N IRAR+H L A I  + PD+I LQETK  D  FP   ++++ Y +   G K
Sbjct: 1   MKIVSFNINGIRARLHQLQALIDSHQPDVIGLQETKAHDDVFPVADVEAMGYKVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTI-NTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+LSK +P+++    P DD + Q R I  TFT  N + L I N Y P G+ I+  
Sbjct: 61  AHYGVAMLSKLEPVKVQKGFPTDDDEAQRRMIMGTFTQENGRPLTILNGYFPQGDNISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TKY  K  + K  + + ++    +E +   GD NI P               +      F
Sbjct: 121 TKYPAKRKFYKDLMVYLNEHHTPDEDIAIIGDINISPVDLDIGIGAPNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + G  D  R  H      YS++DY +  +  N+G+RID ++ +     
Sbjct: 181 QPEEREWLKTLMDWGLVDTFRELHPERSERYSWFDYRSKGFVDNRGLRIDVVLATKSLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            L  + +D + RG  KPSDH P+  +  
Sbjct: 241 RLVESDVDYELRGIEKPSDHAPIWSTFK 268


>gi|229515240|ref|ZP_04404700.1| exodeoxyribonuclease III [Vibrio cholerae TMA 21]
 gi|229520320|ref|ZP_04409746.1| exodeoxyribonuclease III [Vibrio cholerae TM 11079-80]
 gi|229342686|gb|EEO07678.1| exodeoxyribonuclease III [Vibrio cholerae TM 11079-80]
 gi|229347945|gb|EEO12904.1| exodeoxyribonuclease III [Vibrio cholerae TMA 21]
          Length = 268

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 79/268 (29%), Positives = 128/268 (47%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP + ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPRQEVEAMGYQVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVAIL K  P+E++   P  ++   +   +      N Q   I N Y P G+ +   
Sbjct: 61  AHYGVAILCKQTPVEVIKGFPTDNEEHQKRMIMATFADQNGQKTTILNGYFPQGDNVEHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K  + +  + +  +     E L+  GD NI P               +      F
Sbjct: 121 TKFPYKRQFYRDLMTYLCEHRSNSERLVVMGDINISPLDLDIGIGEANRKRWLQTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H      +S++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLQTLLDWGLVDTFRQLHPDVSDQFSWFDYRSRGFEDNRGLRIDVILATPTLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
               A ID + R   KPSDH P+  +  
Sbjct: 241 TCQEAGIDYELRAIDKPSDHAPIWATFK 268


>gi|312172585|emb|CBX80841.1| Exonuclease III [Erwinia amylovora ATCC BAA-2158]
          Length = 301

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 82/266 (30%), Positives = 124/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP   + SL YH+   GQK
Sbjct: 34  MKFVSFNINGLRARPHQLQAIVEQHQPDVIGLQETKVHDDMFPLAEVASLGYHVFYHGQK 93

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L K QP+ +      DD D Q R I A    ++  L + N Y P G       
Sbjct: 94  GHYGVALLCKQQPVAVRRGFASDDEDAQRRIIMADIMTHSGLLTVINGYFPQGESRDHPT 153

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q+ + +  L+  GD NI           +     +      F 
Sbjct: 154 KFPAKEKFYRDLHSYLEQQQKPDNQLLIMGDMNISSGDLDIGIGEENRKRWLRTGKCSFL 213

Query: 177 LEVRQSFQKLQNMGFTDAIRATH-DTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   KL N G  D  RA H   +  +S++DY +  +  N+G+RID ++ S      
Sbjct: 214 PEEREWMDKLMNWGLVDTWRAQHATINDRFSWFDYRSKGFDDNRGLRIDLVLASRPLADR 273

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
             +  ID   R   KPSDH P+    
Sbjct: 274 CVATGIDYDIRAMEKPSDHAPIWAEF 299


>gi|110805445|ref|YP_688965.1| exonuclease III [Shigella flexneri 5 str. 8401]
 gi|110614993|gb|ABF03660.1| exonuclease III [Shigella flexneri 5 str. 8401]
          Length = 268

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 123/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP E +  L Y++   GQK
Sbjct: 1   MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKLGYNMFYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
            + GVA+L+K  PI +    PGDD + Q R I A        + + N Y P G       
Sbjct: 61  GHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSLLGNVTVINGYFPQGESRDHPI 120

Query: 124 -YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
            +  K  + +    +    L+ + P++  GD NI P         +     +      F 
Sbjct: 121 KFPAKAQFYQNLQNYLETELKRDNPVLIMGDMNISPTDLDIGIGEENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDTH-HLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  R  +      +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWMDRLMSWGVVDTFRHANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAEC 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
                ID + R   KPSDH PV  + 
Sbjct: 241 CVETGIDYEIRSMEKPSDHAPVWATF 266


>gi|15838527|ref|NP_299215.1| exodeoxyribonuclease III [Xylella fastidiosa 9a5c]
 gi|9107031|gb|AAF84735.1|AE004013_1 exodeoxyribonuclease III [Xylella fastidiosa 9a5c]
          Length = 264

 Score =  201 bits (511), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 86/261 (32%), Positives = 139/261 (53%), Gaps = 6/261 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +A+WNVNS+  R+  L  W+ E  PD++ LQETK ED  FP   L +L Y     GQK
Sbjct: 3   MRIASWNVNSLNVRLSQLQQWLVEAAPDVLGLQETKLEDHQFPEAALAALGYVSVYAGQK 62

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVA+L++    ++   +PG +   +              +R+ NLY+ +G  + + K
Sbjct: 63  TYNGVALLARVALEDVQVGIPGFEDVQRRVIAATVDG-----IRVVNLYVVNGQEVGTEK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPI-IWENDACFTLEVRQS 182
           Y  K+SW+     + ++ L+    L+  GD+NI P   D Y+P    E+    +   R +
Sbjct: 118 YAYKLSWLDAVYHWLAEELQRYPRLVVLGDFNIAPDARDVYDPQVWNEDHILTSTTERVA 177

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
             KL  +G  D  R  H    ++S+WDY   S+ +N+G+RID  ++S    + + ++ ID
Sbjct: 178 LGKLLGLGLHDGFRLHHQDTGIFSWWDYRQASFRRNRGLRIDLTLVSEALRAQVVASGID 237

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
             PRGW +PSDH P  + L +
Sbjct: 238 CVPRGWERPSDHAPAWIELAL 258


>gi|206602794|gb|EDZ39275.1| Exodeoxyribonuclease III [Leptospirillum sp. Group II '5-way CG']
          Length = 265

 Score =  201 bits (511), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 79/257 (30%), Positives = 129/257 (50%), Gaps = 5/257 (1%)

Query: 7   ATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQKSYN 66
            TWNVNS++ R+  +  W+     D++CLQETK  D  FPF+  + + Y     GQ +YN
Sbjct: 14  TTWNVNSLKVRLPQVLDWLVREKADVVCLQETKLPDAQFPFQAFREIGYDAVWSGQPTYN 73

Query: 67  GVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTKYDD 126
           GVAILS          +     D +              +RI N+Y+P+G  + S K+  
Sbjct: 74  GVAILSNTPIELTEASMDDHPDDHRRFLSARIRG-----VRIVNVYVPNGQDLDSPKFTY 128

Query: 127 KISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSFQKL 186
           K+ W+ R  R+  +  E  EP++  GD+NI+P   D ++P  +++    +   R++   +
Sbjct: 129 KLEWLNRLTRYIEKVREAREPVLLMGDFNIVPGDLDTWDPEGFKDQIFHSPPERKALGNI 188

Query: 187 QNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDTKPR 246
              GF+D  R  +     +S+WDY   S+ +N+G+RID I+ +P  +       ID + R
Sbjct: 189 FQAGFSDLYRTLYPDRQEFSWWDYRMGSFHRNRGLRIDLILSTPPLSEQCREVFIDREAR 248

Query: 247 GWTKPSDHTPVIVSLDI 263
              +PSDH PV     +
Sbjct: 249 KAERPSDHVPVTALFSL 265


>gi|149191818|ref|ZP_01870055.1| exonuclease III [Vibrio shilonii AK1]
 gi|148834336|gb|EDL51336.1| exonuclease III [Vibrio shilonii AK1]
          Length = 268

 Score =  201 bits (511), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 78/267 (29%), Positives = 130/267 (48%), Gaps = 9/267 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP E ++++ Y +   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQALIDKHQPDVIGLQEIKVHDEAFPVEAVEAMGYKVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLP-GDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +PI +    P  ++   +   +     +    + + N Y P G+ I+  
Sbjct: 61  AHYGVAMLCKQEPISVQKGFPTDNEDHQKRMIMATFEDVKGDKVTVLNGYFPQGDNISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TK+  K ++ K  + + ++    +E LI  GD NI P               +      F
Sbjct: 121 TKFPYKEAFYKDLMTYLNEHHSNDEKLIVMGDINISPIDLDIGIGEPNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
               R+  Q L + GF D  R  H      +S++DY +  +  N+G+RID ++ +     
Sbjct: 181 QPIEREWLQTLLDWGFVDTFRQLHPNVDDQFSWFDYRSRGFDDNRGLRIDVVLATKSLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSL 261
               A ID + RG  KPSDH P+    
Sbjct: 241 TCSEAGIDYELRGIEKPSDHAPIWSVF 267


>gi|186476236|ref|YP_001857706.1| exodeoxyribonuclease III Xth [Burkholderia phymatum STM815]
 gi|184192695|gb|ACC70660.1| exodeoxyribonuclease III Xth [Burkholderia phymatum STM815]
          Length = 258

 Score =  201 bits (511), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 78/256 (30%), Positives = 125/256 (48%), Gaps = 1/256 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS++ R  ++  W++ +  D++CLQE K  D+ FP   L    Y     GQK
Sbjct: 1   MKLATWNVNSLKVRQQHVIDWLELSRTDVLCLQELKLPDEKFPRAELAEKGYRSWFAGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGV IL +   + +       ++       +       + +R+   Y P+G    + K
Sbjct: 61  TYNGVGILVRDG-VSVDEGSIVRNIPGFEDPQQRVIAATVEGVRVVCAYFPNGQAPGTDK 119

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W+     + S  L     L   GDYNI P+  D ++P  WE     + E R  F
Sbjct: 120 FAYKLRWLDAMYEWISSELTQHPKLALLGDYNIAPEDRDVHDPKAWEGQNLVSPEERAQF 179

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
            +L  +G  D+ R        +++WDY   ++ +N G+RIDHI+LS    +      +D 
Sbjct: 180 NRLIELGLVDSFRLFDQPEKTFTWWDYRMLAFRRNAGLRIDHILLSKPLAASCTHCDVDK 239

Query: 244 KPRGWTKPSDHTPVIV 259
            PR W +PSDH PV+ 
Sbjct: 240 TPRKWDQPSDHAPVVA 255


>gi|194289407|ref|YP_002005314.1| exodeoxyribonuclease iii [Cupriavidus taiwanensis LMG 19424]
 gi|193223242|emb|CAQ69247.1| EXODEOXYRIBONUCLEASE III [Cupriavidus taiwanensis LMG 19424]
          Length = 276

 Score =  201 bits (511), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 82/263 (31%), Positives = 130/263 (49%), Gaps = 6/263 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENN-----PDIICLQETKTEDKNFPFETLQSLNYHIE 58
           + +A+WNVNS++ R+  +  W+ E        D +CLQE K  D  +P   L++  +H  
Sbjct: 12  LRIASWNVNSLKVRLPQVLQWLAEQEQAGAPIDALCLQELKLPDDKYPLAELENAGFHSI 71

Query: 59  TCGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNP 118
             GQK+YNGVAIL++   +     +  +    +              LR+   Y P+G  
Sbjct: 72  YTGQKTYNGVAILARDASMPGPVDVVRNIPGFEDAQQRVIAATYGD-LRLVCAYFPNGQS 130

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLE 178
           + S K+  K+ W++    +  + +     L   GD+NI P+  D ++P  WE     +  
Sbjct: 131 LDSDKFAYKLQWLEAMTAWLREEMARHPRLALLGDFNIAPEDRDVHDPAKWEGQNLVSPP 190

Query: 179 VRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHS 238
            R +F  L  +G  DA R        +S+WDY   ++ +N G+RIDHI+LSP       +
Sbjct: 191 ERAAFAALLELGLADAFRKFEQPEKAFSWWDYRMLAFRRNAGLRIDHILLSPALAEQCTA 250

Query: 239 ARIDTKPRGWTKPSDHTPVIVSL 261
             ID  PR W +PSDHTPV+ +L
Sbjct: 251 CVIDRVPRTWEQPSDHTPVVATL 273


>gi|262381739|ref|ZP_06074877.1| exodeoxyribonuclease III [Bacteroides sp. 2_1_33B]
 gi|262296916|gb|EEY84846.1| exodeoxyribonuclease III [Bacteroides sp. 2_1_33B]
          Length = 253

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 82/262 (31%), Positives = 137/262 (52%), Gaps = 12/262 (4%)

Query: 4   VTVATWNVNSIRARI-HNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNY--HIETC 60
           + + T+N N +RA +   L  W+ +  PD++C+QETK +   FP ET ++L Y  ++ + 
Sbjct: 1   MKIITYNTNGLRAAVGKGLPEWLAQEQPDVLCIQETKLQPDQFPSETFEALGYKSYLFSA 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
            +K Y+GVAIL+K +P  I   +  +  D + RF+ A F      + I ++Y P G    
Sbjct: 61  QKKGYSGVAILTKQEPDHIEYGMGIEKYDNEGRFLRADFG----DVSIVSVYHPSG-TSG 115

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             + D K+ W++ F ++  +  +    LI  GDYNI  +P D ++PI    ++ F  E R
Sbjct: 116 DERQDFKMIWLEDFQKYVVELQKSRPNLILCGDYNICHEPIDIHDPIRNAKNSGFLPEER 175

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           +   +  + GFTD  R  +     Y++W Y  +S SKNKG RID+ M+S      + +A 
Sbjct: 176 EWMTRFLSAGFTDTFRFLNPDKQEYTWWSYRFNSRSKNKGWRIDYCMVSDNMKPKVKAAY 235

Query: 241 IDTKPRGWTKPSDHTPVIVSLD 262
           I          SDH P ++ ++
Sbjct: 236 ILNDA----VHSDHCPAVLEIE 253


>gi|153806611|ref|ZP_01959279.1| hypothetical protein BACCAC_00881 [Bacteroides caccae ATCC 43185]
 gi|149131288|gb|EDM22494.1| hypothetical protein BACCAC_00881 [Bacteroides caccae ATCC 43185]
          Length = 263

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/263 (31%), Positives = 139/263 (52%), Gaps = 12/263 (4%)

Query: 3   VVTVATWNVNSIRARI-HNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNY--HIET 59
           ++ + T+NVN +RA +   L  W+++ NPDI+CLQETK +   +P E  ++L Y  ++ +
Sbjct: 1   MMKIITYNVNGLRAAVSKGLPEWLEQENPDILCLQETKLQPDQYPVEVFEALGYKSYLYS 60

Query: 60  CGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
             +K Y+GVA+L+K +P  +   +  +  D + RFI A F      L + ++Y P G   
Sbjct: 61  AQKKGYSGVALLTKQEPDHVEYGMGMEAYDNEGRFIRADFG----DLSVVSVYHPSG-TS 115

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
              +   K+ W++ F ++  +  +    LI  GDYNI  +P D ++P+    ++ F  E 
Sbjct: 116 GDERQAFKMVWLEDFQKYVLELQKSRPNLILCGDYNICHEPIDIHDPVRNAKNSGFLPEE 175

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+   +    GF D+ R  +     Y++W Y  +S +KNKG RID+ M S     LL SA
Sbjct: 176 REWMTRFLAAGFIDSFRMLYPEKQEYTWWSYRFNSRAKNKGWRIDYCMASEPVRPLLMSA 235

Query: 240 RIDTKPRGWTKPSDHTPVIVSLD 262
           RI          SDH P+++ + 
Sbjct: 236 RILNDAM----HSDHCPMMLEIK 254


>gi|119469281|ref|ZP_01612220.1| exonuclease III [Alteromonadales bacterium TW-7]
 gi|119447145|gb|EAW28414.1| exonuclease III [Alteromonadales bacterium TW-7]
          Length = 268

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 76/267 (28%), Positives = 126/267 (47%), Gaps = 9/267 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR+H L A I ++ PD+I LQE K  D+ FP + +Q + YH+   GQK
Sbjct: 1   MKVISFNINGLRARLHQLQAVIDKHQPDVIGLQEIKVHDEAFPLDDVQKMGYHVYFHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHL-PGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+L K +P  ++       +   +          N + + + N Y P G+ I   
Sbjct: 61  AHYGVAMLCKKEPKSVLKGFATDTEESQKRMISVTIEQDNGRDITVMNGYFPQGDNINHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
           TK+  K  + K  +      L  ++ ++  GD NI P   D           +      F
Sbjct: 121 TKFPYKRQFYKDLMTHLDTNLTPDQDVVVMGDINISPTDLDIGIGEVNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E RQ    L + GF D  R  +   +  YS++DY +  +  N+G+RID ++ +     
Sbjct: 181 QPEERQWLSTLLDWGFKDTFRELYPDVNDQYSWFDYRSKGFLDNRGLRIDVVLATQSLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSL 261
               + ID + R   KPSDH P+  + 
Sbjct: 241 RCIDSGIDYELRAIDKPSDHAPIWSTF 267


>gi|134099932|ref|YP_001105593.1| AP endonuclease [Saccharopolyspora erythraea NRRL 2338]
 gi|291008673|ref|ZP_06566646.1| AP endonuclease [Saccharopolyspora erythraea NRRL 2338]
 gi|133912555|emb|CAM02668.1| AP endonuclease, family 1:exodeoxyribonuclease III xth
           [Saccharopolyspora erythraea NRRL 2338]
          Length = 265

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 68/265 (25%), Positives = 123/265 (46%), Gaps = 5/265 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+NS+ AR+  L  W+   +PD++C+QE K     FP   + +L Y +   G  
Sbjct: 1   MRIATWNLNSVTARLPRLLEWLSAASPDVLCVQELKCSSDMFPVAEVSALGYEVAAYGTG 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT-----INTQTLRIGNLYLPHGNP 118
            +NGV +LS+    E+   LPG+   +    +          ++   +R+ ++Y+P+G  
Sbjct: 61  RWNGVGVLSRVGLDEVRRGLPGEPGYLPEGAMFEVNEPRAIGVSCAGVRLWSVYVPNGRY 120

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLE 178
           +    YD K+ +++      +   +        GD+NI P   D ++   +      T  
Sbjct: 121 VGHPHYDYKLRFLEALRDTVAAERDHGRAFAVLGDFNIAPADDDVWDISAFAESTHVTEP 180

Query: 179 VRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHS 238
            R +   L+  G  D           +++WDY A ++ KN G+RID     P  T  +  
Sbjct: 181 ERSALADLRAAGLADVYPRALKYDVPFTYWDYRAGAFPKNMGMRIDLAYGDPRFTGAVSD 240

Query: 239 ARIDTKPRGWTKPSDHTPVIVSLDI 263
           + +D + R     SDH P+++ LD+
Sbjct: 241 SYVDREARKGKGASDHAPLVIDLDL 265


>gi|110633439|ref|YP_673647.1| exodeoxyribonuclease III [Mesorhizobium sp. BNC1]
 gi|110284423|gb|ABG62482.1| Exodeoxyribonuclease III [Chelativorans sp. BNC1]
          Length = 259

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 85/260 (32%), Positives = 136/260 (52%), Gaps = 3/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +AT+N+N+I  R+ NL  W+  + PD++CLQE K  D  FP   ++S  Y     GQK
Sbjct: 1   MKIATFNINNINKRLPNLLEWLHLSKPDVVCLQELKATDDAFPKSAIESFGYRAVWKGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILS+     +            A           + + I ++Y P+GNP    K
Sbjct: 61  SWNGVAILSRVGEPVLTR---TRLPGDAADTQARYIEAAVRGVLIASIYAPNGNPQPGPK 117

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +D K++W++R  + A+   +   P++ AGD+N+ P   D Y    W ++A    E R +F
Sbjct: 118 FDYKLAWLERLRKHATALRKTGAPIVLAGDFNVAPTDIDIYPTKSWGDNALIQPESRAAF 177

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           ++L    +TD IR  H    +Y+FWDY    W ++ G+R+DH++LS      +  A +D 
Sbjct: 178 RRLLGRSWTDGIRLLHPEQRIYTFWDYKRLRWQRDAGLRLDHLLLSENLRGAIVKAGVDR 237

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
             RG    SDH P  + L++
Sbjct: 238 DVRGREGASDHAPAWIELNL 257


>gi|126208451|ref|YP_001053676.1| exonuclease III [Actinobacillus pleuropneumoniae L20]
 gi|303251086|ref|ZP_07337272.1| exonuclease III [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|303253573|ref|ZP_07339711.1| exonuclease III [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|126097243|gb|ABN74071.1| exodeoxyribonuclease III [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|302647493|gb|EFL77711.1| exonuclease III [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|302650096|gb|EFL80266.1| exonuclease III [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
          Length = 267

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 80/267 (29%), Positives = 128/267 (47%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I+++ PD++ LQE K  D++FP++ +  L YH+   GQK
Sbjct: 1   MKFISFNINGLRARPHQLEAIIEKHQPDVLGLQEIKVADEDFPWDLVNHLGYHVFHHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P+ +    P D+ D Q R I A        L + N Y P G   +  T
Sbjct: 61  GHYGVALLTKKEPLAVRKGFPTDNADAQKRMIMADIETEFGVLTVLNGYFPQGENRSHET 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +      +    L  E P++  GD NI P               + +    F 
Sbjct: 121 KFPAKEKFYADLQHYLESELSPENPIVIMGDMNISPTDLDIGIGEPNRKRWLRDGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L + G  D  RA +   +  +S++DY +  +  N+G+RID ++ S      
Sbjct: 181 PEEREWLDRLYSYGLIDTFRAMNPQANDKFSWFDYRSKGFDDNRGLRIDLVLASKGLAER 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                ID + R   KPSDH+PV     
Sbjct: 241 CVETGIDLEIRAMEKPSDHSPVWAVFK 267


>gi|292488442|ref|YP_003531324.1| exonuclease III [Erwinia amylovora CFBP1430]
 gi|291553871|emb|CBA20916.1| Exonuclease III [Erwinia amylovora CFBP1430]
          Length = 301

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 82/266 (30%), Positives = 123/266 (46%), Gaps = 8/266 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A ++++ PD+I LQETK  D  FP   + SL YH+   GQK
Sbjct: 34  MKFVSFNINGLRARPHQLQAIVEQHQPDVIGLQETKVHDDMFPLAEVASLGYHVFYHGQK 93

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+L K QP+ +      DD D Q R I A     +  L + N Y P G       
Sbjct: 94  GHYGVALLCKQQPVAVRRGFASDDEDAQRRIIMADIMTPSGLLTVINGYFPQGESRDHPT 153

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  + +    +  Q+ + +  L+  GD NI           +     +      F 
Sbjct: 154 KFPAKEKFYRDLHSYLEQQQKPDNQLLIMGDMNISSGDLDIGIGEENRKRWLRTGKCSFL 213

Query: 177 LEVRQSFQKLQNMGFTDAIRATH-DTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   KL N G  D  RA H   +  +S++DY +  +  N+G+RID ++ S      
Sbjct: 214 PEEREWMDKLMNWGLVDTWRAQHATINDRFSWFDYRSKGFDDNRGLRIDLVLASRPLADR 273

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSL 261
             +  ID   R   KPSDH P+    
Sbjct: 274 CVATGIDYDIRAMEKPSDHAPIWAEF 299


>gi|127513190|ref|YP_001094387.1| exonuclease III [Shewanella loihica PV-4]
 gi|126638485|gb|ABO24128.1| Exodeoxyribonuclease III [Shewanella loihica PV-4]
          Length = 269

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 89/264 (33%), Positives = 134/264 (50%), Gaps = 9/264 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR+H L A I  ++PDII LQETK  D+ FP   ++++ Y +   G K
Sbjct: 1   MKIVSFNINGLRARLHQLQALIDSHSPDIIGLQETKVHDEAFPLAEVEAMGYQVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFT-INTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+LSK  P+++    P DD + Q R I  TFT  N + L + N Y P G  I+  
Sbjct: 61  AHYGVAMLSKLPPVKVQKGFPTDDDEAQRRMIMGTFTQANGRQLTVLNGYFPQGENISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
           TKY  K  + +  + +  Q    +E +   GD NI P   D           +      F
Sbjct: 121 TKYPAKRKFYQDLMHYLQQHHSPDEDIAIIGDINISPIDLDIGIGEVNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  Q L + G  D  R  H      YS++DY +  +  N+G+RID I+ +P    
Sbjct: 181 QPEEREWLQTLLDWGLVDTFRQLHPTRSERYSWFDYRSKGFDDNRGLRIDVILATPSLAE 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVI 258
            L  + +D   RG  KPSDH P+ 
Sbjct: 241 RLTESDVDYDLRGIDKPSDHAPIW 264


>gi|59801894|ref|YP_208606.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae FA 1090]
 gi|59718789|gb|AAW90194.1| putative exodeoxyribonuclease III [Neisseria gonorrhoeae FA 1090]
          Length = 256

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 91/260 (35%), Positives = 136/260 (52%), Gaps = 4/260 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + TWNVNS+  R+  +   + +N PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKITTWNVNSLNVRLPQVQNLLVDNPPDILVLQELKLDQDKFPAAALQMMGWHCVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+  P ++   LP    D Q R I AT       +R+ N+Y  +G  + S K
Sbjct: 61  TYNGVAIVSRSVPQDVHFGLPSLPDDPQRRVIAATVGG----VRVINVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    +     L+  GD+NI P   DCY+P  W      +   RQ F
Sbjct: 117 FKYKEQWFAALTEFVRDEMSRHGKLVLLGDFNIAPADADCYDPEKWYEKIHCSSVERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + +  G+RIDHI+++ E  ++L   RID 
Sbjct: 177 QNLLDLGLTDSLRQVHPEGAFYTWFDYRGAMFQRKLGLRIDHILVTSEMAAVLKDVRIDL 236

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + R   +PSDH PV    D+
Sbjct: 237 ETRALERPSDHAPVAAEFDL 256


>gi|313499091|gb|ADR60457.1| Exonuclease III [Pseudomonas putida BIRD-1]
          Length = 270

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 85/269 (31%), Positives = 133/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +  +N+N +RAR H LAA I+++ PD+I LQETK  D  FP   +Q+L YH+   GQK
Sbjct: 1   MKIVCFNINGLRARPHQLAALIEKHQPDVIGLQETKVSDDQFPLADVQALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +      D+ D Q RFI  TF   +   + I N Y P G      
Sbjct: 61  GHYGVALLSRQAPLSLHKGFATDEEDAQRRFIWGTFADADGSPITIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  +          +   ++P++  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYSDLQALLESQFRNDQPVLVMGDMNISPQDCDIGIGPDNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+  G  D+ R  +      +S++DY +  +     +G+RID IM S + 
Sbjct: 181 LPEEREWMERLKGWGLVDSFRHLYPEVTDRFSWFDYRSRGFEDEPKRGLRIDLIMASQQL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D + RG  KPSDH P+ + L
Sbjct: 241 VPRIKAAGVDYELRGMEKPSDHAPIWLEL 269


>gi|212634722|ref|YP_002311247.1| exonuclease III [Shewanella piezotolerans WP3]
 gi|212556206|gb|ACJ28660.1| AP endonuclease, family 1:Exodeoxyribonuclease III xth [Shewanella
           piezotolerans WP3]
          Length = 268

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 78/264 (29%), Positives = 131/264 (49%), Gaps = 9/264 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +RAR+H L A I  + PD+I LQETK  D+ FP   ++++ Y +   G K
Sbjct: 1   MKIVSFNINGLRARLHQLQALIDSHQPDVIGLQETKVHDEAFPLADVEAMGYKVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLD-VQARFIEATFTINTQTLRIGNLYLPHGNPITS- 121
           ++ GVA+LSK +P+++    P D+ D  +   +      N + L + N Y P G+ I+  
Sbjct: 61  AHYGVAMLSKAEPLKVQKGFPTDEEDAQRRMIMGTFMQENGRQLTVLNGYFPQGDNISHE 120

Query: 122 TKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACF 175
           TKY  K  + K  + + ++    +E +   GD NI P               +      F
Sbjct: 121 TKYPAKRKFYKDLMVYLNEHHSADEDIAIIGDINISPVDLDIGIGEPNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + L + G  D  R  H      YS++DY +  +  N+G+RID ++ +    +
Sbjct: 181 QPEEREWLKTLMDWGLVDTFRQLHPTRTERYSWFDYRSKGFVDNRGLRIDVVLATKSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVI 258
            L  + +D   RG  KPSDH P+ 
Sbjct: 241 RLVESDVDYDLRGIEKPSDHAPIW 264


>gi|254498807|ref|ZP_05111518.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254351971|gb|EET10795.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 265

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 90/261 (34%), Positives = 151/261 (57%), Gaps = 5/261 (1%)

Query: 3   VVTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           V  +A+WNVNS++ R+  + AW++ +  D++ LQETK  D+NFP        YHI   GQ
Sbjct: 8   VFKLASWNVNSLKIRLDQVLAWMETSQMDVLALQETKLLDENFPAAAFIEKGYHIVYSGQ 67

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K+YNGVAI+S+Y   +++T +P      +         +    +R+ +LY+P+G+ +TS 
Sbjct: 68  KTYNGVAIISRYPITDVMTDVPDLADPQRRIL-----AVTVAGIRLIDLYVPNGSELTSD 122

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           KY  K+ W+++   F  Q++ +   +   GD+NI P+  D ++P+ W++    +   R++
Sbjct: 123 KYQYKLHWLQKVTAFIQQQMSIYPKVAVVGDFNIAPEDRDVHDPLEWQDSVLVSPPEREA 182

Query: 183 FQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARID 242
           F  L  +G  D+ R        +S+WDY A  + +N+G+RIDH++LS E   L   + ID
Sbjct: 183 FAALLQLGLYDSFRNFVQAEQSFSWWDYRAAGFRRNRGLRIDHVLLSQELNVLCRQSCID 242

Query: 243 TKPRGWTKPSDHTPVIVSLDI 263
            +PR   +PSDH PV V L++
Sbjct: 243 VEPRKTERPSDHAPVWVELEL 263


>gi|26989609|ref|NP_745034.1| exonuclease III [Pseudomonas putida KT2440]
 gi|24984490|gb|AAN68498.1|AE016481_14 exodeoxyribonuclease III [Pseudomonas putida KT2440]
          Length = 270

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 86/269 (31%), Positives = 133/269 (49%), Gaps = 11/269 (4%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +  +N+N +RAR H LAA I+++ PD+I LQETK  D  FP   +Q+L YH+   GQK
Sbjct: 1   MKIVCFNINGLRARPHQLAALIEKHQPDVIGLQETKVSDDQFPLADVQALGYHVHYHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
            + GVA+LS+  P+ +      D+ D Q RFI  TF   N   + I N Y P G      
Sbjct: 61  GHYGVALLSRQPPLSLHKGFATDEEDAQRRFIWGTFADANGSPITIMNGYFPQGESRDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPH------DCYNPIIWENDACF 175
            K+  K  +          +   ++P++  GD NI PQ        D     +      F
Sbjct: 121 TKFPAKQRFYSDLQALLESQFRNDQPVLVMGDMNISPQDCDIGIGPDNAKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSK--NKGIRIDHIMLSPEA 232
             E R+  ++L+  G  D+ R  +      +S++DY +  +     +G+RID IM S + 
Sbjct: 181 LPEEREWMERLKGWGLVDSFRHLYPDVTDRFSWFDYRSRGFEDEPKRGLRIDLIMASQQL 240

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
              + +A +D + RG  KPSDH P+ + L
Sbjct: 241 VPRIKAAGVDYELRGMEKPSDHAPIWLEL 269


>gi|120598407|ref|YP_962981.1| exonuclease III [Shewanella sp. W3-18-1]
 gi|146293514|ref|YP_001183938.1| exonuclease III [Shewanella putrefaciens CN-32]
 gi|120558500|gb|ABM24427.1| Exodeoxyribonuclease III [Shewanella sp. W3-18-1]
 gi|145565204|gb|ABP76139.1| Exodeoxyribonuclease III [Shewanella putrefaciens CN-32]
          Length = 270

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 87/268 (32%), Positives = 131/268 (48%), Gaps = 9/268 (3%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + + ++N+N +R+R+H L A I  + PDII LQETK  D+ FP   ++++ Y +   G K
Sbjct: 1   MKIVSFNINGLRSRLHQLQALIDSHKPDIIGLQETKVHDEAFPLAEVEAMGYQVHYHGGK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATF-TINTQTLRIGNLYLPHGNPITST 122
           ++ GVA+LSK  P +I    P DD D Q R I  TF   N + L + N Y P G  I   
Sbjct: 61  AHYGVAMLSKVAPQKIQKGFPSDDEDAQRRMIIGTFSQANGRPLTVFNGYFPQGESIDHP 120

Query: 123 -KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHD------CYNPIIWENDACF 175
            KY  K  + +  + +       +E +   GD NI P   D           +      F
Sbjct: 121 TKYPAKRKFYQDLMHYLQTNHSNDEDIAIIGDINISPTDLDIGIGEVNRKRWLKTGKCSF 180

Query: 176 TLEVRQSFQKLQNMGFTDAIRATHD-THHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
             E R+  + LQ+ G  D  R  H      YS++DY +  +  N+G+RID I+ +P   +
Sbjct: 181 QPEEREWLKTLQDWGLIDTFRQLHPERTERYSWFDYRSKGFDDNRGLRIDVILATPSLAA 240

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSLD 262
            L  + +D   RG  KPSDH P+  +  
Sbjct: 241 RLVESDVDYDLRGIDKPSDHAPIWSTFK 268


>gi|251792404|ref|YP_003007130.1| exonuclease III [Aggregatibacter aphrophilus NJ8700]
 gi|247533797|gb|ACS97043.1| exodeoxyribonuclease III [Aggregatibacter aphrophilus NJ8700]
          Length = 267

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 81/267 (30%), Positives = 121/267 (45%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + V ++N+N +RAR H L   I +  PD++ LQE K  D+ FP+E +  L YH+   GQK
Sbjct: 1   MKVMSFNINGLRARPHQLEEIIDKYQPDVLGLQEIKVADEVFPYELVDHLGYHVNHYGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST- 122
            + GVA+LSK  P+ +    P D  + Q R I          L + N Y P G       
Sbjct: 61  GHYGVALLSKQAPLSVKKGFPTDGEEAQKRIIMIDLETPFGQLTVINGYFPQGESRKHPT 120

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +     R+  Q    E P+I  GD NI P         +     +      F 
Sbjct: 121 KFPAKQKFYADLQRYLEQEHNAENPVIIMGDMNISPSDLDIGIGDENRKRWLRTGKCSFL 180

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+ +Q+L   G  D  R  + T +  +S++DY +  +  N+G+RIDHI+ +    + 
Sbjct: 181 PEEREWYQRLYAYGLEDTFRYMNPTVNDKFSWFDYRSKGFDDNRGLRIDHILANKALVAH 240

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                I    R   KPSDH P+     
Sbjct: 241 CVDTGIALDIRAMEKPSDHAPIWAEFK 267


>gi|213961670|ref|ZP_03389936.1| exodeoxyribonuclease III [Capnocytophaga sputigena Capno]
 gi|213955459|gb|EEB66775.1| exodeoxyribonuclease III [Capnocytophaga sputigena Capno]
          Length = 254

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 82/262 (31%), Positives = 131/262 (50%), Gaps = 14/262 (5%)

Query: 4   VTVATWNVNSIRARI-HNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNY---HIET 59
           + + ++NVN IRA +    A W+K  NPD++CLQE K  +   P E    L Y   +  +
Sbjct: 1   MKIISYNVNGIRAALTKGFADWLKSANPDVLCLQEIKALEDQIPTEIFTELGYTYQYYHS 60

Query: 60  CGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
             +K Y+GVAILSK  P  +      D +D + R + A F      L + +LYLP G  I
Sbjct: 61  AEKKGYSGVAILSKIAPKHVEVGTGIDYMDKEGRVLRADFET----LSVMSLYLPSGTNI 116

Query: 120 TSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEV 179
                D K++++  F ++  +  +    L+  GDYNI  +  D ++P+     + F    
Sbjct: 117 DR--LDFKLTFMADFQKYIDKLKQTVPNLVICGDYNICHEAIDIHDPVRNATVSGFLPVE 174

Query: 180 RQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSA 239
           R+   K    GF D+ R  H   H YS+W Y A++ + NKG RID+ ++S    + +  A
Sbjct: 175 REWLDKFMKSGFIDSFRYFHKEPHQYSWWSYRANARNNNKGWRIDYHLVSTPLENRMERA 234

Query: 240 RIDTKPRGWTKPSDHTPVIVSL 261
            I  +     K SDH P+++ +
Sbjct: 235 LILPEA----KHSDHCPIVLEI 252


>gi|294670922|ref|ZP_06735778.1| hypothetical protein NEIELOOT_02626 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307409|gb|EFE48652.1| hypothetical protein NEIELOOT_02626 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 261

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 95/258 (36%), Positives = 135/258 (52%), Gaps = 4/258 (1%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWNVNS+  R+  +  W+ ++ PDI+ LQE K +   FP   LQ + +H    GQK
Sbjct: 1   MKIATWNVNSLNVRLPQVQNWLADHRPDILALQELKLDQDKFPAAALQMMGWHSVWSGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           +YNGVAI+S+ +P ++ T LP    D Q R I AT       +RI N+Y  +G  + S K
Sbjct: 61  TYNGVAIISRGEPQDVHTGLPTLPDDPQRRVIAATVNG----VRIVNVYCVNGEALDSPK 116

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K  W      F    L   E LI  GD+NI P   DCY P  W      +   RQ F
Sbjct: 117 FQYKEQWFAALTEFLRNELSRHEKLILLGDFNIAPADADCYAPEKWHEKILCSSIERQWF 176

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q L ++G TD++R  H     Y+++DY    + + +G+RIDHI+ S    S L   ++D 
Sbjct: 177 QNLLDLGLTDSLRQIHPEGAFYTWFDYRGAMFQRKQGLRIDHILTSRTMASALQDMQVDY 236

Query: 244 KPRGWTKPSDHTPVIVSL 261
             R   +PSDH PV    
Sbjct: 237 DTRALERPSDHAPVWAQF 254


>gi|319408771|emb|CBI82428.1| exodeoxyribonuclease III [Bartonella schoenbuchensis R1]
          Length = 263

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 131/259 (50%), Positives = 177/259 (68%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+  I+AR   L  W+++N PDI+CLQE K  D NFP + +++L YHIET GQK
Sbjct: 1   MKIATWNIAGIKARHDTLCKWLQKNQPDIVCLQEIKCIDANFPRDEIETLGYHIETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVA+LSK +P E++  LPGDD D QAR+IEA ++ N   +R+ +LYLP+GNPI S K
Sbjct: 61  SFNGVALLSKKRPDELIRQLPGDDNDEQARYIEAVYSTNKGVVRVASLYLPNGNPINSEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           +  K+ W++R    A   L  E+PLI AGDYN+IP P D   P  W+NDA F  + RQ+F
Sbjct: 121 HLYKMRWMERLYTHAKSLLAYEDPLILAGDYNVIPTPLDAKKPEEWKNDALFLPQTRQAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q++  +GF D+IR   D    +SFWD+ A +W KN GIRIDH++LSPEA   L  A   T
Sbjct: 181 QRIIYLGFYDSIRNVTD-DSSFSFWDFQAGAWRKNNGIRIDHLLLSPEAADQLVCAYSQT 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + RG+ KPSDH PV + L+
Sbjct: 240 EVRGYEKPSDHVPVWIELN 258


>gi|322514720|ref|ZP_08067746.1| exodeoxyribonuclease III [Actinobacillus ureae ATCC 25976]
 gi|322119315|gb|EFX91431.1| exodeoxyribonuclease III [Actinobacillus ureae ATCC 25976]
          Length = 305

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 82/267 (30%), Positives = 125/267 (46%), Gaps = 8/267 (2%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           +   ++N+N +RAR H L A I+++ PD+I LQE K  D++FP++ +  L YH+   GQK
Sbjct: 39  MKFISFNINGLRARPHQLEALIEKHQPDVIGLQEIKVADEDFPWDLVNHLGYHVFHHGQK 98

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITS-T 122
            + GVA+L+K +P+ +    P DD D Q R I A        L + N Y P G      T
Sbjct: 99  GHYGVALLTKKEPLAVRKGFPTDDADAQKRMIMADIETEFGVLTVLNGYFPQGENRAHET 158

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQP------HDCYNPIIWENDACFT 176
           K+  K  +      +    L  E P++  GD NI P               + +    F 
Sbjct: 159 KFPAKEKFYADLQHYLETELTPENPIVIMGDMNISPTDLDIGIGEPNRKRWLRDGKCSFL 218

Query: 177 LEVRQSFQKLQNMGFTDAIRATHDT-HHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSL 235
            E R+   +L N G  D  R  +   +  +S++DY +  +  N+G+RID ++ S      
Sbjct: 219 PEEREWLDRLYNYGLVDTFRVMNPQANDKFSWFDYRSKGFDDNRGLRIDLVLASKGLAGH 278

Query: 236 LHSARIDTKPRGWTKPSDHTPVIVSLD 262
                ID + R   KPSDH PV     
Sbjct: 279 CVETGIDLEIRAMEKPSDHAPVWAVFK 305


>gi|49474410|ref|YP_032452.1| exodeoxyribonuclease III [Bartonella quintana str. Toulouse]
 gi|49239914|emb|CAF26312.1| Exodeoxyribonuclease III [Bartonella quintana str. Toulouse]
          Length = 260

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 131/259 (50%), Positives = 177/259 (68%), Gaps = 1/259 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+  I+AR   L  W+++N PDI+CLQE K+ D+NFP + ++SL YHIET GQK
Sbjct: 1   MKIATWNIAGIKARHETLYQWLQQNQPDIVCLQEIKSTDENFPCDAIESLGYHIETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK  P E++  LPG++ D Q R+IEA ++ N   +R+ +LYLP+GNP+ S K
Sbjct: 61  SFNGVAILSKKTPDEVIRRLPGNNNDEQTRYIEAVYSTNKGVIRVASLYLPNGNPVKSEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  K+ W++R    A   L  EEPL+ AGDYN+IP P D  NP  W NDA F  + R +F
Sbjct: 121 YSYKMEWMERLYAHAKSLLAYEEPLVLAGDYNVIPTPLDAKNPQKWSNDALFLPQTRNAF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q++ ++GF DAIR   DT   +SFWD+ A +W KN GIRIDH++LSPEA   L  A   T
Sbjct: 181 QRIVHLGFYDAIRNVTDTP-SFSFWDFQAGAWHKNNGIRIDHLLLSPEAVDQLICAYSQT 239

Query: 244 KPRGWTKPSDHTPVIVSLD 262
           + RG+ K SDH PV + L+
Sbjct: 240 EVRGYPKSSDHAPVWIDLN 258


>gi|255013539|ref|ZP_05285665.1| exodeoxyribonuclease [Bacteroides sp. 2_1_7]
          Length = 253

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 81/260 (31%), Positives = 135/260 (51%), Gaps = 12/260 (4%)

Query: 4   VTVATWNVNSIRARI-HNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNY--HIETC 60
           + + T+N N +RA +   L  W+ +  PD++C+QETK +   FP ET ++L Y  ++ + 
Sbjct: 1   MKIITYNTNGLRAAVGKGLPEWLAQEQPDVLCIQETKLQPDQFPAETFEALGYKSYLFSA 60

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
            +K Y+GVAIL+K +P  +   +  +  D + RFI A F      L + ++Y P G    
Sbjct: 61  QKKGYSGVAILTKQEPDHVEYGMGIERYDNEGRFIRADFG----DLSVVSVYHPSG-TSG 115

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
             + D K+ W++ F ++  +  +    LI  GDYNI  +P D ++PI    ++ F  E R
Sbjct: 116 DERQDFKMVWLEDFQKYVVELQKSRPNLILCGDYNICHEPIDIHDPIRNAKNSGFLPEER 175

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSAR 240
           +   +  + GF D  R  +     Y++W Y  +S +KNKG RID+ M+S    S + +A 
Sbjct: 176 EWMTRFLSAGFIDTFRLLNPEKQEYTWWSYRFNSRAKNKGWRIDYCMVSEAMKSRVKAAY 235

Query: 241 IDTKPRGWTKPSDHTPVIVS 260
           I          SDH P ++ 
Sbjct: 236 ILNDA----VHSDHCPAVLE 251


>gi|240850841|ref|YP_002972241.1| exodeoxyribonuclease III [Bartonella grahamii as4aup]
 gi|240267964|gb|ACS51552.1| exodeoxyribonuclease III [Bartonella grahamii as4aup]
          Length = 260

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 134/260 (51%), Positives = 176/260 (67%), Gaps = 1/260 (0%)

Query: 4   VTVATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQK 63
           + +ATWN+  I+AR   L  W++++ PDI+CLQE K+ D+NFP + +++L YHIET GQK
Sbjct: 1   MKIATWNIAGIKARHETLCQWLQQSQPDIVCLQEIKSIDENFPRDAIENLGYHIETHGQK 60

Query: 64  SYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTK 123
           S+NGVAILSK  P E++  LPG+D D Q R+IEA ++ N   +R+ +LYLP+GNPI S K
Sbjct: 61  SFNGVAILSKKTPDEVIRRLPGNDNDEQTRYIEAVYSTNKGVVRVASLYLPNGNPIESEK 120

Query: 124 YDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSF 183
           Y  KI W++R    A   L  EEPLI AGDYN+IP P D   P  W  DA F  E R+ F
Sbjct: 121 YSYKIEWMERLYTHAKSLLAYEEPLILAGDYNVIPAPLDAKKPQEWYQDALFLQETRKVF 180

Query: 184 QKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDT 243
           Q++ N+G  DAIR   DT   +SFWD+ A +W KN GIRIDH++LSPEA   L  A   T
Sbjct: 181 QRILNLGLYDAIRNVTDTP-SFSFWDFQAGAWPKNNGIRIDHLLLSPEAVDQLICAHSQT 239

Query: 244 KPRGWTKPSDHTPVIVSLDI 263
           + RG+ KPSDH PV + L+I
Sbjct: 240 EVRGYQKPSDHVPVWIHLNI 259


>gi|116873216|ref|YP_849997.1| exodeoxyribonuclease III [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116742094|emb|CAK21218.1| exodeoxyribonuclease III [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 251

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 67/262 (25%), Positives = 121/262 (46%), Gaps = 13/262 (4%)

Query: 4   VTVATWNVNSIRARIH-NLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQ 62
           + + +WNVN +RA +      + +E + DI CLQETK ++     + L++   +     +
Sbjct: 1   MKLISWNVNGLRAAVKKGFLEYFEEVDADIFCLQETKLQEGQIELD-LKAYKDYWNYAVK 59

Query: 63  KSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITST 122
           K Y+G AI +K +P+ +   L   + D + R I   F                 +     
Sbjct: 60  KGYSGTAIFTKVEPLSVQYGLGIPEHDTEGRVITLEFEAF-----FMVTVYTPNSQAELK 114

Query: 123 KYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQS 182
           + D ++++    L +    L+  +P++  GD N+  +  D  NP     +A F+ E R  
Sbjct: 115 RLDYRMTFEDAILEYIKN-LDKTKPVVLCGDLNVAHEEIDLKNPKTNRKNAGFSDEERAK 1