RPSBLAST alignment of GI: 254780288 and MMDB domain: 1i9z_A_18-321

>1i9z_A (A:18-321) Synaptojanin, phosphatidylinositol phosphate phosphatase; spsynaptojanin, IPP5C, IP3, IP2,, hydrolase; HET: 2IP; 1.80A {Schizosaccharomyces pombe}Length = 304
 Score = 93.6 bits (231), Expect = 2e-20
 Identities = 29/301 (9%), Positives = 62/301 (20%), Gaps = 51/301 (16%)

Query: 4   VTVATWNVNSIRA--RIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIE--- 58
           + VA++N+N   A  ++ N          DI  +   +                  E   
Sbjct: 10  IFVASYNLNGCSATTKLENWLFPENTPLADIYVVGFQEIVQLTPQQVISADPAKRREWES 69

Query: 59  -------------------TCGQKSYNGVAILSKYQPIEIVTHLPGDDLDV-------QA 92
                                GQ     + I  K   +  + ++ G              
Sbjct: 70  CVKRLLNGKCTSGPGYVQLRSGQLVGTALMIFCKESCLPSIKNVEGTVKKTGLGGVSGNK 129

Query: 93  RFIEATFTINTQTLRIGNLYLPHGNPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAG 152
             +   F      L     +L  G      +  D  +          + +   + +++ G
Sbjct: 130 GAVAIRFDYEDTGLCFITSHLAAGYTNYDERDHDYRTIASGLRFRRGRSIFNHDYVVWFG 189

Query: 153 DYNIIP--------QPHDCYNPIIWENDACFTLEVRQSFQKLQNMGFTDAIRATH-DTHH 203
           D+N                              ++                  T+     
Sbjct: 190 DFNYRISLTYEEVVPCIAQGKLSYLFEYDQLNKQMLTGKVFPFFSELPITFPPTYKFDIG 249

Query: 204 LYSFWDYYADSWSKNKGIRIDHIMLSPEATSLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
              +               +    L P +                   SDH P+  + + 
Sbjct: 250 TDIYDTSDKHRVPAWTDRILYRGELVPHSYQ-----------SVPLYYSDHRPIYATYEA 298

Query: 264 P 264
            
Sbjct: 299 N 299