RPSBLAST alignment of GI: 254780288 and MMDB domain: 2j63_A_1-134_233-439

>2j63_A (A:1-134,A:233-439) AP-endonuclease; base excision repair, lyase; 2.48A {Leishmania major}Length = 341
 Score =  149 bits (376), Expect = 5e-37
 Identities = 33/202 (16%), Positives = 66/202 (32%), Gaps = 31/202 (15%)

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPG--DDLDVQARFIEATFTINT------QTLRIGNLY 112
             +   G A+ S+ Q               D + R +    + +         + + N Y
Sbjct: 139 HARCTRGFALPSEPQADAAAGSRVLVEGAGDEEGRVLTTFLSPDPDSASSSSRIALVNTY 198

Query: 113 LPHGNPITSTKYDDKISWIKRFLRFASQRLEL------------------EEPLIFAGDY 154
           + +     +       S+      +  +                          I+AGD 
Sbjct: 199 VANSGMGLTRLPYRVQSFDPSMREYLHRLDTWATENAAVPSAAAMGSGSSPHGFIWAGDL 258

Query: 155 NIIPQPHDCYNPIIWEN---DACFTLEVRQSFQK-LQNMGFTDAIRA-THDTHHLYSFWD 209
           N+  + +D Y    +++    + F  E R SF++ +Q     D  R        +YSFW 
Sbjct: 259 NVAERDYDRYYAGTFKSMQECSGFAPEERMSFRETMQRTNSVDIFRQLYPQAGPVYSFWS 318

Query: 210 YYADSWSKNKGIRIDHIMLSPE 231
              +   +N G R+D+ ++S  
Sbjct: 319 QRINGRPRNLGWRLDYFVVSSR 340