RPSBLAST alignment of GI: 254780288 and MMDB domain: 2o3h_A_

>2o3h_A (A:) DNA-(apurinic or apyrimidinic site) lyase; APE, endonuclease; 1.90A {Homo sapiens} PDB: 1bix_A 1dew_A* 1de8_B* 1de9_A* 2o3c_ALength = 285
 Score =  144 bits (362), Expect = 2e-35
 Identities = 75/267 (28%), Positives = 130/267 (48%), Gaps = 17/267 (6%)

Query: 4   VTVATWNVNSIRARI-HNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETC-- 60
           + +A+WNV+ +RA I      W+KE  PDI+CLQETK  +   P E  +      +    
Sbjct: 29  LKIASWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSA 88

Query: 61  --GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNP 118
              ++ Y+GV +LS+  P+++   +  ++ D + R I A F     +  +   Y+P+   
Sbjct: 89  PSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEF----DSFVLVTAYVPNAGR 144

Query: 119 ITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLE 178
               + + +  W + F +F  + L   +PL+  GD N+  +  D  NP   + +A FT +
Sbjct: 145 -GLVRLEYRQRWDEAFRKFL-KGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQ 202

Query: 179 VRQSFQKLQNM-GFTDAIRATH-DTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATSLL 236
            RQ F +L       D+ R  + +T + Y+FW Y  ++ SKN G R+D+ +LS      L
Sbjct: 203 ERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPAL 262

Query: 237 HSARIDTKPRGWTKPSDHTPVIVSLDI 263
             ++I          SDH P+ + L +
Sbjct: 263 CDSKIR----SKALGSDHCPITLYLAL 285