RPSBLAST alignment of GI: 254780288 and MMDB domain: 3g6s_A_

>3g6s_A (A:) Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482}Length = 267
 Score =  125 bits (314), Expect = 5e-30
 Identities = 33/278 (11%), Positives = 67/278 (24%), Gaps = 25/278 (8%)

Query: 4   VTVATWNVNSIRA---------RIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQS-- 52
           V  AT+N+              R   +  +IK++  DI+  QE            L    
Sbjct: 4   VRWATFNIRYDNPQDSLNNWQYRKDRVCQFIKDHELDIVGXQEVLHNQFQDLRAGLPEYD 63

Query: 53  LNYHIETCGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLY 112
                   G+ +     +  +    E++        +         +      + +    
Sbjct: 64  GIGVGRDDGKTAGEYAPLFYRKDKYEVLDSNTFWLAENPDSVGXXGW----DAVCVRIAT 119

Query: 113 LPHGNPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWEND 172
                   + K    ++     +         E     A       +      P +   D
Sbjct: 120 WAKFKDKATGKIFXAVNTHFDHVGE-------EARRQSALLIIRKIKEIVGERPAVVTGD 172

Query: 173 ACFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEA 232
              T           N         T        +  +           +ID I ++P+ 
Sbjct: 173 FNVTDASDAYETITTNEFVXKDAYKTAARVTGVDYTFHDFARIPAEDCEKIDFIFVTPQV 232

Query: 233 TSLLHSARIDTKPRGWTKPSDHTPVIVSLDIPEPRKKQ 270
              + S  I  +       SDH P +  L++       
Sbjct: 233 L--VKSCEIPAEVP-EALLSDHNPQLADLELEHHHHHH 267