RPSBLAST alignment of GI: 254780288 and protein with PDBid: 2imq

>2imq_X Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} SCOP: d.151.1.2 PDB: 1ntf_A* 1y21_A* 1yjh_A* 1si6_X* Length = 282
 Score =  129 bits (325), Expect = 6e-31
 Identities = 27/283 (9%), Positives = 62/283 (21%), Gaps = 34/283 (12%)

Query: 4   VTVATWNVNSIRAR--IHNLAAWIKENNPDI--ICLQETKTEDKNFPFETLQSLNYHIET 59
           V   +WN    RA   +  L        PD+  + +Q    +           +      
Sbjct: 9   VHTVSWNSGHERAPTNLEELLGLNSGETPDVIAVAVQGFGFQTDKPQQG-PACVKNFQSL 67

Query: 60  CGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPI 119
              K Y  +           V  L         +      T     +   +     G  +
Sbjct: 68  LTSKGYTKLKNTITETMGLTVYCLE----KHLDQNTLKNET----IIVTVDDQKKSGGIV 119

Query: 120 TSTKYDDKISWI-----------KRFLRFASQRLELEEPLIFAGDYNIIPQPHDCY---- 164
           TS    +K                   ++A              D+       +      
Sbjct: 120 TSFTIYNKRFSFTTSRMSDEDVTSTNTKYAYDTRLDYSKKDDPSDFLFWIGDLNVRVETN 179

Query: 165 NPIIWENDACFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRI- 223
                       ++   +F +L+            +    +     +  +  +       
Sbjct: 180 ATHAKSLVDQNNIDGLMAFDQLKKAKEQKLFDGWTEPQVTFKPTYKFKPNTDEYDLSATP 239

Query: 224 ---DHIMLSPEATSLLHSARIDTKPRGWTKPSDHTPVIVSLDI 263
              D  +        +     ++      K ++H PV+    +
Sbjct: 240 SWTDRALYKSGTGKTIQPLSYNS--LTNYKQTEHRPVLAKFRV 280