RPSBLAST alignment of GI: 254780288 and protein with PDBid: 2voa

>2voa_A AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endonuclease, lyase; 1.7A {Archaeoglobus fulgidus} Length = 257
 Score =  194 bits (492), Expect = 3e-50
 Identities = 87/259 (33%), Positives = 137/259 (52%), Gaps = 6/259 (2%)

Query: 6   VATWNVNSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLNYHIETCGQKSY 65
           +AT+NVNSIR+R+H +  W+KEN PDI+C+QETK E++ FP      + YH+   G K  
Sbjct: 4   IATFNVNSIRSRLHIVIPWLKENKPDILCMQETKVENRKFPEADFHRIGYHVVFSGSKGR 63

Query: 66  NGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPITSTKYD 125
           NGVAI S  +P ++   L  +  D           I      + N Y+P G  I S KY 
Sbjct: 64  NGVAIASLEEPEDVSFGLDSEPKDEDRLIRAKIAGI-----DVINTYVPQGFKIDSEKYQ 118

Query: 126 DKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSFQK 185
            K+ W++R   +  + ++     ++ GD N+ P+P D ++P   +N  CF  + R++++K
Sbjct: 119 YKLQWLERLYHYLQKTVDFRSFAVWCGDMNVAPEPIDVHSPDKLKNHVCFHEDARRAYKK 178

Query: 186 LQNMGFTDAIRATHDTHHLYSFWDYYA-DSWSKNKGIRIDHIMLSPEATSLLHSARIDTK 244
           +  +GF D +R  H    +Y+F+DY    +  +  G R D I+ +P           D K
Sbjct: 179 ILELGFVDVLRKIHPNERIYTFYDYRVKGAIERGLGWRGDAILATPPLAERCVDCYADIK 238

Query: 245 PRGWTKPSDHTPVIVSLDI 263
           PR   KPSDH P++   D+
Sbjct: 239 PRLAEKPSDHLPLVAVFDV 257