RPSBLAST alignment of GI: 254780288 and protein with PDBid: 3i41

>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A {Staphylococcus aureus RN4220} PDB: 3i46_A 3i48_A Length = 317
 Score = 93.9 bits (232), Expect = 3e-20
 Identities = 47/303 (15%), Positives = 88/303 (29%), Gaps = 67/303 (22%)

Query: 4   VTVATWNVNSIRA----------RIHNLAAWIKENNPDIICLQE--TKTEDKNFPFETLQ 51
           + + + NV  +            R   +       N D++   E               +
Sbjct: 30  LKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKK 89

Query: 52  SLNYHIETCGQKSY----------------NGVAILSKYQPIEIVTHL----PGDDLDVQ 91
              Y     G+                    GVAI+SKY   E + H+     G D D  
Sbjct: 90  EYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSN 149

Query: 92  ARFIEATFTINTQTLRIGNLYLPHGNPITSTKYDDKISW--IKRFLRF-ASQRLELEEPL 148
             F+      N + + +   +    +      +D KI    +K    F   + +  +E +
Sbjct: 150 KGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETV 209

Query: 149 IFAGDYNIIPQPHDCYNPIIWENDACFTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFW 208
              GD N+     +  +                    L+N+   D + A H++       
Sbjct: 210 YIGGDLNVNKGTPEFKDM-------------------LKNLNVNDVLYAGHNSTWDPQSN 250

Query: 209 DYYADSWSKNKGIRIDHIMLSPE--ATSLLHSARIDTKPRGW-----------TKPSDHT 255
                ++   K   +D+I    +      L +  +  KP+ W              SDH 
Sbjct: 251 SIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAAAYYYVYNDFSDHY 310

Query: 256 PVI 258
           P+ 
Sbjct: 311 PIK 313