RPSBLAST alignment of GI: 254780288 and protein with PDBid: 3l1w

>3l1w_A Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Length = 257
 Score = 99.5 bits (246), Expect = 8e-22
 Identities = 41/267 (15%), Positives = 73/267 (27%), Gaps = 27/267 (10%)

Query: 4   VTVATWNV---------NSIRARIHNLAAWIKENNPDIICLQETKTEDKNFPFETLQSLN 54
           + +AT+NV              R   +   I  ++  + C+QE +               
Sbjct: 1   MKIATYNVRVDTEYDQDWQWSFRKEAVCQLINFHDWSLCCIQEVRPNQVRDLKAYTTFTC 60

Query: 55  YHIETCGQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLP 114
              E  G     G+AIL   Q ++ +        +   +          +    G     
Sbjct: 61  LSAEREGDGQGEGLAILYNEQKVQAIDTGYFWLSETPQQPSIHPEAGCPRIALWGLFKET 120

Query: 115 HGNPITSTKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDAC 174
                     +  +  I    R A   + LEE       Y           P +   D  
Sbjct: 121 -TQNTPFLVINVHLDHISAHARLAGMTVILEELHDKIAQY-----------PTLLMGD-- 166

Query: 175 FTLEVRQSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSPEATS 234
           F  E  +   +L    F D+           +F ++        +   ID+I +      
Sbjct: 167 FNAESGEEVHQLVQKKFQDSKNLATHYGPRGTFQNFTYT-KPWAELEEIDYIYVKG---W 222

Query: 235 LLHSARIDTKPRGWTKPSDHTPVIVSL 261
            +      T       PSDH P+   +
Sbjct: 223 QVQQTASLTDSIDGRFPSDHFPLEAEV 249