RPSBLAST alignment of GI: 254780288 and SCOP domain: d2a40b1

Alignment
>d2a40b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} Length = 260
 Score = 65.0 bits (156), Expect = 6e-12
 Identities = 29/271 (10%), Positives = 68/271 (25%), Gaps = 29/271 (10%)

Query: 6   VATWNVNSI---RARIHNLAAWIKE--NNPDIICLQETKTEDKNFPFETLQSLNYHIETC 60
           +A +N+ +    +     LA++I       DI+ +QE +        + L  LN      
Sbjct: 3   IAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGKLLDYLNQDDPNT 62

Query: 61  GQKSYNGVAILSKYQPIEIVTHLPGDDLDVQARFIEATFTINTQTLRIGNLYLPHGNPIT 120
                +     + Y+   +    P     +     +                +   +  +
Sbjct: 63  YHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCESCGNDSFSREPAVVKFSSHS 122

Query: 121 STKYDDKISWIKRFLRFASQRLELEEPLIFAGDYNIIPQPHDCYNPIIWENDACFTLEVR 180
           +   +  I  +      A   +     +               +   +            
Sbjct: 123 TKVKEFAIVALHSAPSDAVAEINSLYDVYLD-------VQQKWHLNDVMLMGDFNADCSY 175

Query: 181 QSFQKLQNMGFTDAIRATHDTHHLYSFWDYYADSWSKNKGIRIDHIMLSP---------- 230
            +  +  ++           +          AD+ + +     D I+++           
Sbjct: 176 VTSSQWSSIRL-------RTSSTFQWLIPDSADTTATSTNCAYDRIVVAGSLLQSSVVPG 228

Query: 231 EATSLLHSARIDTKPRGWTKPSDHTPVIVSL 261
            A      A            SDH PV V+L
Sbjct: 229 SAAPFDFQAAYGLSNEMALAISDHYPVEVTL 259

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: DNase I-like
domain: Deoxyribonuclease I
species: Cow (Bos taurus) [TaxId: 9913]