>TIGR02850 spore_sigG RNA polymerase sigma-G factor; InterPro: IPR014212 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme . RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes. With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognized by the major sigma factors , . Members of this entry comprise the Firmicutes lineage endospore formation-specific sigma factor SigG. It is also designated stage III sporulation protein G (SpoIIIG). Members of this entry are closely related to sigma-F (SpoIIAC), another sporulation sigma factor.; GO: 0003677 DNA binding, 0003700 transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, 0006355 regulation of transcription DNA-dependent.

Probab=99.97 E-value=4e-28 Score=240.97 Aligned_cols=235 Identities=31% Similarity=0.499 Sum_probs=209.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEHHHH Q ss_conf 12688999999876533211246899987555789998875223567778875443679999887438545731201028 Q gi|254780289|r 422 ISISEFRHIVSMVRKGECEASIAKKEMVEANLRLVISVAKKYTNRGLQFLDLIQEGNIGLMKAAEKFDWCLGYKFSTYAM 501 (682) Q Consensus 422 l~i~ElK~i~r~I~~ge~e~~~AK~~l~~anlr~v~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~g~~f~tya~ 501 (682) T Consensus 16 l~~~~~~~l~~~~~~G~~---~ar~~l~~~nlrlvlsviqrf~nrGe~~ddlfqvGCiGl~k~idnfdl~~nv~fstyav 92 (254) T TIGR02850 16 LKNEEMRELFVRMKSGDK---SAREKLINGNLRLVLSVIQRFNNRGEYVDDLFQVGCIGLIKSIDNFDLSQNVKFSTYAV 92 (254) T ss_pred CCHHHHHHHHHHHHCCHH---HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH T ss_conf 354789999999851207---89999875226888888887511454034567632577777655310111320011346 Q ss_pred HHHHHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCCC Q ss_conf 98999999999722870461420588989999999998776088999789998709998999999986089875536358 Q gi|254780289|r 502 WWVKQAITRSIADQSCTIRIPVHMRDKIHKVVRTARRMSNKIKREPTPEEIAKKLAMPVEGVRKVLKITKEPISLETPIG 581 (682) Q Consensus 502 ~~i~~~i~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~sl~~~~~ 581 (682) T Consensus 93 PmiiGeirrylrdn-~~irvsrslrd~ay~alqvr~~l~~~~~~eP~~~~ia~~l~~~~~~~v~aldaiq~PvslfeP~y 171 (254) T TIGR02850 93 PMIIGEIRRYLRDN-NPIRVSRSLRDIAYKALQVRDKLVSKNSKEPTVSEIAKELDVPKEEVVFALDAIQDPVSLFEPIY 171 (254) T ss_pred HHHHHHHHHHHHCC-CCEEEHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHH T ss_conf 67889889985248-74130355889999999999999853125875889998734755787765664216423431001 Q ss_pred CCCCC--EEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCHHHHHHH Q ss_conf 89986--0475623898899899999999999999997329988999999981879867468899989966789999999 Q gi|254780289|r 582 DEDTS--HLGDFIEDKNAVSPLDSAIQANLRETTTRVLASLTPREERVLRMRFGIGMNTDHTLEEVGKQFCVTRERIRQI 659 (682) Q Consensus 582 ~~~~~--~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~l~~l~~re~~v~~~r~g~~~~~~~tl~e~~~~~~~~~er~rqi 659 (682) T Consensus 172 ~d~Gd~i~vmdq~~d~~~~---d~~W~~~~--~l~~~~~~l~~re~~il~~rf----f~G~tqmeva~eiGisqaqvsrl 242 (254) T TIGR02850 172 NDGGDPIYVMDQISDEKNK---DEQWLEEI--ALKEALKRLNEREKLILKLRF----FEGKTQMEVAEEIGISQAQVSRL 242 (254) T ss_pred CCCCCEEEEEECCCCHHHH---HHHHHHHH--HHHHHHHHHHHHHHHHHHHHH----HCCCHHHHHHHHHCCHHHHHHHH T ss_conf 3799748874010020345---69999888--999999987667887777553----14631334565403016888888 Q ss_pred HHHHHHHHCC Q ss_conf 9999998329 Q gi|254780289|r 660 EAKAIRKLKH 669 (682) Q Consensus 660 ~~~a~~~l~~ 669 (682) T Consensus 243 ek~a~~~~~k 252 (254) T TIGR02850 243 EKAALKHMRK 252 (254) T ss_pred HHHHHHHHHH T ss_conf 8999999751

HHsearch alignment for GI: 254780289 and conserved domain: TIGR02850