>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1; InterPro: IPR014326 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme . RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes. With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognized by the major sigma factors , . This group of sigma factors are members of the sigma-70 family (IPR014284 from INTERPRO) and are apparently found only in the Planctomycetaceae family including the genus s Gemmata and Pirellula, in which seven sequences are found.; GO: 0003677 DNA binding, 0003700 transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, 0006355 regulation of transcription DNA-dependent.

Probab=98.69 E-value=4.6e-07 Score=74.73 Aligned_cols=167 Identities=23% Similarity=0.355 Sum_probs=120.5 Q ss_pred HHHHHHH--HHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHHHHHHHHHHCCCEEECCCHHHH Q ss_conf 7555789--99887522356777887544367999988743854573120102898999999999722870461420588 Q gi|254780289|r 450 EANLRLV--ISVAKKYTNRGLQFLDLIQEGNIGLMKAAEKFDWCLGYKFSTYAMWWVKQAITRSIADQSCTIRIPVHMRD 527 (682) Q Consensus 450 ~anlr~v--~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~g~~f~tya~~~i~~~i~~~~~~~~~~~r~~~~~~~ 527 (682) T Consensus 17 ~~yLr~La~~~L~~~L~~r-~dpSD~VQe~---~l~A~~~~~~fRG~t~~Ef~~-WLR~IL~~~l~~~------------ 79 (190) T TIGR02984 17 RNYLRLLARVQLDRRLRRR-VDPSDVVQET---LLEAHRDFDQFRGKTEGEFAG-WLRQILANVLADA------------ 79 (190) T ss_pred HHHHHHHHHHHHHHHHHCC-CCHHHHHHHH---HHHHHHHHHHHCCCCHHHHHH-HHHHHHHHHHHHH------------ T ss_conf 2499999999760884001-5754589999---999998887532898578999-9999999999999------------ Q ss_pred HHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCC--EEEEEECCCCCCCHHHHHH Q ss_conf 98999999999877608899978999870999899999998608987553635889986--0475623898899899999 Q gi|254780289|r 528 KIHKVVRTARRMSNKIKREPTPEEIAKKLAMPVEGVRKVLKITKEPISLETPIGDEDTS--HLGDFIEDKNAVSPLDSAI 605 (682) Q Consensus 528 ~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~sl~~~~~~~~~~--~~~~~~~d~~~~~~~~~~~ 605 (682) T Consensus 80 --------~~~h~~~qkRD-----------------------~rrE~~l~~~~~~~~~Ss~~L~~~Laa-~~~sPS~~a~ 127 (190) T TIGR02984 80 --------LRRHLGAQKRD-----------------------IRREQSLDAGAARVDESSVRLEAQLAA-DGPSPSQAAA 127 (190) T ss_pred --------HHHHHHHHCCC-----------------------CHHCCCCCCCCCCHHHHHHHHHHHHCC-CCCCCHHHHH T ss_conf --------99886642026-----------------------201012012457658879999997518-9998558999 Q ss_pred HHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCC Q ss_conf 9999999999973299889999999818798674688999899667899999999999998329 Q gi|254780289|r 606 QANLRETTTRVLASLTPREERVLRMRFGIGMNTDHTLEEVGKQFCVTRERIRQIEAKAIRKLKH 669 (682) Q Consensus 606 ~~~~~~~~~~~l~~l~~re~~v~~~r~g~~~~~~~tl~e~~~~~~~~~er~rqi~~~a~~~l~~ 669 (682) T Consensus 128 r~E~~~~L~~AL~~L~e~~REvi~LR~----~EGLS~~EvA~~Md~~~~av~~l~~Ral~~Lr~ 187 (190) T TIGR02984 128 RRESAVRLAQALAKLPEDYREVILLRH----LEGLSFAEVAERMDRSEGAVSMLWVRALARLRQ 187 (190) T ss_pred HHHHHHHHHHHHHHCCHHHHHHHHHHH----HHCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHH T ss_conf 977999999999647922589999987----603555899987079758987589999999987

HHsearch alignment for GI: 254780289 and conserved domain: TIGR02984